Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|949
Gene name
LocationContig_12:275510..277481
Strand+
Gene length (bp)1971
Transcript length (bp)1911
Coding sequence length (bp)1911
Protein length (aa) 637

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07576 BRAP2 BRCA1-associated protein 2 9.6E-27 163 256
PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein 2.6E-17 358 416
PF13639 zf-RING_2 Ring finger domain 7.5E-09 290 330
PF17123 zf-RING_11 RING-like zinc finger 9.4E-07 291 318
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 1.5E-06 291 329
PF13445 zf-RING_UBOX RING-type zinc-finger 3.7E-05 291 321
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 8.1E-06 291 329

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13747|EPT1_SCHPO RING finger protein ETP1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16E8.13 PE=3 SV=1 105 617 8.0E-106
sp|P38748|ETP1_YEAST RING finger protein ETP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ETP1 PE=1 SV=1 134 616 3.0E-77
sp|Q7Z569|BRAP_HUMAN BRCA1-associated protein OS=Homo sapiens GN=BRAP PE=1 SV=2 131 616 7.0E-75
sp|Q99MP8|BRAP_MOUSE BRCA1-associated protein OS=Mus musculus GN=Brap PE=1 SV=1 131 616 2.0E-71
sp|Q95QN6|BRAP2_CAEEL BRCA1-associated protein homolog 2 OS=Caenorhabditis elegans GN=brap-2 PE=3 SV=1 93 636 4.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13747|EPT1_SCHPO RING finger protein ETP1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16E8.13 PE=3 SV=1 105 617 8.0E-106
sp|P38748|ETP1_YEAST RING finger protein ETP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ETP1 PE=1 SV=1 134 616 3.0E-77
sp|Q7Z569|BRAP_HUMAN BRCA1-associated protein OS=Homo sapiens GN=BRAP PE=1 SV=2 131 616 7.0E-75
sp|Q99MP8|BRAP_MOUSE BRCA1-associated protein OS=Mus musculus GN=Brap PE=1 SV=1 131 616 2.0E-71
sp|Q95QN6|BRAP2_CAEEL BRCA1-associated protein homolog 2 OS=Caenorhabditis elegans GN=brap-2 PE=3 SV=1 93 636 4.0E-66
sp|Q7ZUM8|UBP44_DANRE Ubiquitin carboxyl-terminal hydrolase 44 OS=Danio rerio GN=usp44 PE=2 SV=1 358 427 4.0E-07
sp|D2HBJ8|UBP44_AILME Ubiquitin carboxyl-terminal hydrolase 44 OS=Ailuropoda melanoleuca GN=USP44 PE=3 SV=1 358 427 6.0E-07
sp|O00237|RN103_HUMAN E3 ubiquitin-protein ligase RNF103 OS=Homo sapiens GN=RNF103 PE=1 SV=1 267 356 7.0E-07
sp|Q9H0E7|UBP44_HUMAN Ubiquitin carboxyl-terminal hydrolase 44 OS=Homo sapiens GN=USP44 PE=1 SV=2 358 415 7.0E-07
sp|Q7ZW78|RN181_DANRE E3 ubiquitin-protein ligase RNF181 OS=Danio rerio GN=rnf181 PE=2 SV=2 266 338 1.0E-06
sp|Q6P9L4|UBP49_MOUSE Ubiquitin carboxyl-terminal hydrolase 49 OS=Mus musculus GN=Usp49 PE=2 SV=1 358 446 2.0E-06
sp|Q54QE6|SIR2A_DICDI NAD-dependent deacetylase sir2A OS=Dictyostelium discoideum GN=sir2A PE=2 SV=1 358 417 3.0E-06
sp|Q9R1W3|RN103_MOUSE E3 ubiquitin-protein ligase RNF103 OS=Mus musculus GN=Rnf103 PE=2 SV=2 267 356 4.0E-06
sp|Q9EPZ8|RN103_RAT E3 ubiquitin-protein ligase RNF103 OS=Rattus norvegicus GN=Rnf103 PE=2 SV=1 267 356 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0008270 zinc ion binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0046914 transition metal ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|949
MPSYFYHVKFELYPWPDSHTSAVDNTRRRDDIWNPPAGASVFDKLPSHARSAQRRARSDSASGSCHTAAGGVRDW
RFGRVSIETADPTSSDGSMPNETVKEASSAAPALGPSFGGAGTATKAEYLPLETRNTELGWGVVHFYREGDETSS
LKAREQTTEQSTKDEGSTLCIPAVPVYMSPGDVMGFIGERWMGEISHCRMVMTSRMNRYLVLVRFRDAKRAKQWK
SEFDGKVFNAVEPLLCHVVFVKSITFETPTHSQRLEQSAPSGSASVSNTMKPFPPPTANLIELPTCPVCLERMDD
TNGLMTIPCSHVFHCSCLRSWKGSGCPVCRFTNTAEGATLNPNNPYSQPFGSPISNLCSVCDCIDDLWICLICGY
LGCGRYKGGHAKDHWKETAHSFALELDTQHVWDYAGDMWVHRLIRDKGDGKVVEFPGRSSGQEAADQDVVPRAKV
DNMGLEYMQLLTSQLETQRVYYEDMIKKAVDKAAKASAVAESSAAESASAAERLSELESKHEVLNRETLPQLERE
LERERRRSIKAETLARNLGKSLQEEKGMNQGLVERIQHLTDQSEALRKQVEALKAEGVELRETNRDLSMFISGQE
KLRELEQGGELQEGEIAEGSISLAERSIRKRPSKKK*
Coding >OphauB2|949
ATGCCTTCGTATTTTTATCACGTCAAATTCGAACTATATCCTTGGCCAGACTCACATACAAGCGCAGTGGATAAT
ACGAGGCGACGAGACGACATCTGGAACCCGCCGGCGGGTGCCAGCGTTTTTGACAAGTTACCCTCGCATGCGCGA
TCAGCGCAACGGCGCGCAAGAAGCGACAGCGCCTCTGGTTCATGTCACACAGCGGCGGGAGGGGTGCGAGATTGG
CGATTTGGCCGCGTGAGCATCGAGACGGCCGATCCGACAAGCTCGGACGGCAGCATGCCGAACGAGACAGTCAAG
GAAGCGTCGTCAGCGGCGCCGGCTCTGGGGCCCTCGTTTGGCGGTGCAGGCACAGCCACAAAGGCCGAATACCTG
CCACTAGAAACCAGGAACACGGAGCTGGGATGGGGAGTGGTGCATTTCTATCGCGAGGGCGACGAGACGTCATCG
CTCAAGGCGCGGGAGCAGACGACGGAGCAATCGACCAAGGACGAGGGCAGCACTCTGTGCATTCCTGCCGTGCCC
GTCTATATGTCACCTGGAGACGTCATGGGCTTCATAGGGGAGCGGTGGATGGGCGAGATAAGCCACTGTCGAATG
GTCATGACTTCGAGGATGAATCGCTATCTTGTTCTGGTGCGCTTCCGCGACGCTAAGCGAGCCAAGCAATGGAAG
AGCGAGTTTGACGGCAAAGTCTTCAACGCCGTCGAGCCCTTACTTTGTCACGTTGTCTTTGTCAAGTCCATCACA
TTCGAGACGCCGACGCACTCGCAGCGGCTCGAGCAGTCAGCTCCCTCTGGCTCGGCGTCTGTGTCAAACACCATG
AAGCCCTTTCCCCCGCCCACGGCCAACCTCATCGAGCTGCCGACATGTCCTGTTTGTCTGGAAAGAATGGACGAT
ACCAATGGGCTCATGACGATTCCCTGCTCTCACGTCTTTCACTGTAGCTGTCTGCGCAGCTGGAAGGGCAGTGGT
TGCCCTGTATGTCGATTCACTAATACTGCCGAGGGCGCCACGTTGAACCCCAACAATCCATACTCACAGCCCTTT
GGCTCGCCCATCTCCAACCTTTGCAGCGTGTGTGACTGTATAGATGATTTATGGATTTGCCTGATTTGTGGCTAC
CTGGGCTGCGGCCGCTACAAGGGCGGGCATGCCAAAGACCACTGGAAGGAGACAGCACACAGCTTCGCACTAGAA
CTAGACACGCAGCACGTCTGGGACTACGCAGGCGACATGTGGGTACACCGGCTGATACGCGACAAGGGCGACGGC
AAAGTGGTGGAGTTTCCTGGACGAAGCAGTGGACAAGAAGCAGCCGATCAAGATGTGGTGCCGCGAGCCAAAGTG
GACAACATGGGGCTCGAGTATATGCAGCTGCTTACGAGCCAACTCGAGACGCAACGCGTCTACTATGAAGACATG
ATAAAGAAGGCAGTTGACAAGGCGGCCAAGGCATCGGCAGTGGCAGAGAGCAGTGCAGCCGAGTCAGCCTCCGCA
GCGGAGCGCTTATCGGAGCTCGAGAGCAAGCATGAAGTGCTGAACCGGGAAACTCTTCCGCAACTGGAGCGGGAG
CTGGAGCGGGAGCGACGGCGAAGCATCAAGGCGGAGACGCTGGCGCGCAATTTGGGAAAATCGCTACAAGAGGAG
AAGGGAATGAACCAAGGGCTTGTGGAACGCATCCAGCATCTGACAGACCAAAGCGAGGCGCTGCGTAAACAGGTT
GAGGCGCTCAAGGCCGAAGGCGTTGAGCTGCGGGAAACAAACCGGGATTTGTCCATGTTCATCTCTGGCCAAGAA
AAGCTGCGTGAGCTGGAGCAAGGGGGCGAGCTGCAAGAGGGTGAGATTGCCGAGGGCAGCATCAGCCTTGCCGAG
AGAAGCATTCGGAAGCGGCCGAGCAAGAAGAAATAA
Transcript >OphauB2|949
ATGCCTTCGTATTTTTATCACGTCAAATTCGAACTATATCCTTGGCCAGACTCACATACAAGCGCAGTGGATAAT
ACGAGGCGACGAGACGACATCTGGAACCCGCCGGCGGGTGCCAGCGTTTTTGACAAGTTACCCTCGCATGCGCGA
TCAGCGCAACGGCGCGCAAGAAGCGACAGCGCCTCTGGTTCATGTCACACAGCGGCGGGAGGGGTGCGAGATTGG
CGATTTGGCCGCGTGAGCATCGAGACGGCCGATCCGACAAGCTCGGACGGCAGCATGCCGAACGAGACAGTCAAG
GAAGCGTCGTCAGCGGCGCCGGCTCTGGGGCCCTCGTTTGGCGGTGCAGGCACAGCCACAAAGGCCGAATACCTG
CCACTAGAAACCAGGAACACGGAGCTGGGATGGGGAGTGGTGCATTTCTATCGCGAGGGCGACGAGACGTCATCG
CTCAAGGCGCGGGAGCAGACGACGGAGCAATCGACCAAGGACGAGGGCAGCACTCTGTGCATTCCTGCCGTGCCC
GTCTATATGTCACCTGGAGACGTCATGGGCTTCATAGGGGAGCGGTGGATGGGCGAGATAAGCCACTGTCGAATG
GTCATGACTTCGAGGATGAATCGCTATCTTGTTCTGGTGCGCTTCCGCGACGCTAAGCGAGCCAAGCAATGGAAG
AGCGAGTTTGACGGCAAAGTCTTCAACGCCGTCGAGCCCTTACTTTGTCACGTTGTCTTTGTCAAGTCCATCACA
TTCGAGACGCCGACGCACTCGCAGCGGCTCGAGCAGTCAGCTCCCTCTGGCTCGGCGTCTGTGTCAAACACCATG
AAGCCCTTTCCCCCGCCCACGGCCAACCTCATCGAGCTGCCGACATGTCCTGTTTGTCTGGAAAGAATGGACGAT
ACCAATGGGCTCATGACGATTCCCTGCTCTCACGTCTTTCACTGTAGCTGTCTGCGCAGCTGGAAGGGCAGTGGT
TGCCCTGTATGTCGATTCACTAATACTGCCGAGGGCGCCACGTTGAACCCCAACAATCCATACTCACAGCCCTTT
GGCTCGCCCATCTCCAACCTTTGCAGCGTGTGTGACTGTATAGATGATTTATGGATTTGCCTGATTTGTGGCTAC
CTGGGCTGCGGCCGCTACAAGGGCGGGCATGCCAAAGACCACTGGAAGGAGACAGCACACAGCTTCGCACTAGAA
CTAGACACGCAGCACGTCTGGGACTACGCAGGCGACATGTGGGTACACCGGCTGATACGCGACAAGGGCGACGGC
AAAGTGGTGGAGTTTCCTGGACGAAGCAGTGGACAAGAAGCAGCCGATCAAGATGTGGTGCCGCGAGCCAAAGTG
GACAACATGGGGCTCGAGTATATGCAGCTGCTTACGAGCCAACTCGAGACGCAACGCGTCTACTATGAAGACATG
ATAAAGAAGGCAGTTGACAAGGCGGCCAAGGCATCGGCAGTGGCAGAGAGCAGTGCAGCCGAGTCAGCCTCCGCA
GCGGAGCGCTTATCGGAGCTCGAGAGCAAGCATGAAGTGCTGAACCGGGAAACTCTTCCGCAACTGGAGCGGGAG
CTGGAGCGGGAGCGACGGCGAAGCATCAAGGCGGAGACGCTGGCGCGCAATTTGGGAAAATCGCTACAAGAGGAG
AAGGGAATGAACCAAGGGCTTGTGGAACGCATCCAGCATCTGACAGACCAAAGCGAGGCGCTGCGTAAACAGGTT
GAGGCGCTCAAGGCCGAAGGCGTTGAGCTGCGGGAAACAAACCGGGATTTGTCCATGTTCATCTCTGGCCAAGAA
AAGCTGCGTGAGCTGGAGCAAGGGGGCGAGCTGCAAGAGGGTGAGATTGCCGAGGGCAGCATCAGCCTTGCCGAG
AGAAGCATTCGGAAGCGGCCGAGCAAGAAGAAATAA
Gene >OphauB2|949
ATGCCTTCGTATTTTTATCACGTCAAATTCGAACTATATCCTTGGCCAGACTCACATACAAGCGCAGTGGATAAT
ACGAGGCGACGAGACGACATCTGGAACCCGCCGGCGGGTGCCAGCGTTTTTGACAAGTTACCCTCGCATGCGCGA
TCAGCGCAACGGCGCGCAAGAAGCGACAGCGCCTCTGGTTCATGTCACACAGCGGCGGGAGGGGTGCGAGATTGG
CGATTTGGCCGCGTGAGCATCGAGACGGCCGATCCGACAAGCTCGGACGGCAGCATGCCGAACGAGACAGTCAAG
GAAGCGTCGTCAGCGGCGCCGGCTCTGGGGCCCTCGTTTGGCGGTGCAGGCACAGCCACAAAGGCCGAATACCTG
CCACTAGAAACCAGGAACACGGAGCTGGGATGGGGAGTGGTGCATTTCTATCGCGAGGGCGACGAGACGTCATCG
CTCAAGGCGCGGGAGCAGACGACGGAGCAATCGACCAAGGACGAGGGCAGCACTCTGTGCATTCCTGCCGTGCCC
GTCTATATGTCACCTGGAGACGTCATGGGCTTCATAGGGGAGCGGTGGATGGGCGAGATAAGCCACTGTCGAATG
GTCATGACTTCGAGGATGAATCGCTATCTTGTTCTGGTGCGCTTCCGCGACGCTAAGCGAGCCAAGCAATGGAAG
AGCGAGTTTGACGGCAAAGTCTTCAACGCCGTCGAGGTGAGTCACCCACCACGACTGGCTCGTGTCTTGTGGCTT
CTAACAGGAGCGTCGGGCCAGCCCTTACTTTGTCACGTTGTCTTTGTCAAGTCCATCACATTCGAGACGCCGACG
CACTCGCAGCGGCTCGAGCAGTCAGCTCCCTCTGGCTCGGCGTCTGTGTCAAACACCATGAAGCCCTTTCCCCCG
CCCACGGCCAACCTCATCGAGCTGCCGACATGTCCTGTTTGTCTGGAAAGAATGGACGATACCAATGGGCTCATG
ACGATTCCCTGCTCTCACGTCTTTCACTGTAGCTGTCTGCGCAGCTGGAAGGGCAGTGGTTGCCCTGTATGTCGA
TTCACTAATACTGCCGAGGGCGCCACGTTGAACCCCAACAATCCATACTCACAGCCCTTTGGCTCGCCCATCTCC
AACCTTTGCAGCGTGTGTGACTGTATAGATGATTTATGGATTTGCCTGATTTGTGGCTACCTGGGCTGCGGCCGC
TACAAGGGCGGGCATGCCAAAGACCACTGGAAGGAGACAGCACACAGCTTCGCACTAGAACTAGACACGCAGCAC
GTCTGGGACTACGCAGGCGACATGTGGGTACACCGGCTGATACGCGACAAGGGCGACGGCAAAGTGGTGGAGTTT
CCTGGACGAAGCAGTGGACAAGAAGCAGCCGATCAAGATGTGGTGCCGCGAGCCAAAGTGGACAACATGGGGCTC
GAGTATATGCAGCTGCTTACGAGCCAACTCGAGACGCAACGCGTCTACTATGAAGACATGATAAAGAAGGCAGTT
GACAAGGCGGCCAAGGCATCGGCAGTGGCAGAGAGCAGTGCAGCCGAGTCAGCCTCCGCAGCGGAGCGCTTATCG
GAGCTCGAGAGCAAGCATGAAGTGCTGAACCGGGAAACTCTTCCGCAACTGGAGCGGGAGCTGGAGCGGGAGCGA
CGGCGAAGCATCAAGGCGGAGACGCTGGCGCGCAATTTGGGAAAATCGCTACAAGAGGAGAAGGGAATGAACCAA
GGGCTTGTGGAACGCATCCAGCATCTGACAGACCAAAGCGAGGCGCTGCGTAAACAGGTTGAGGCGCTCAAGGCC
GAAGGCGTTGAGCTGCGGGAAACAAACCGGGATTTGTCCATGTTCATCTCTGGCCAAGAAAAGCTGCGTGAGCTG
GAGCAAGGGGGCGAGCTGCAAGAGGGTGAGATTGCCGAGGGCAGCATCAGCCTTGCCGAGAGAAGCATTCGGAAG
CGGCCGAGCAAGAAGAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail