Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|949
Gene name
LocationContig_12:275510..277481
Strand+
Gene length (bp)1971
Transcript length (bp)1911
Coding sequence length (bp)1911
Protein length (aa) 637

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07576 BRAP2 BRCA1-associated protein 2 9.6E-27 163 256
PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein 2.6E-17 358 416
PF13639 zf-RING_2 Ring finger domain 7.5E-09 290 330
PF17123 zf-RING_11 RING-like zinc finger 9.4E-07 291 318
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 1.5E-06 291 329
PF13445 zf-RING_UBOX RING-type zinc-finger 3.7E-05 291 321
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 8.1E-06 291 329

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13747|EPT1_SCHPO RING finger protein ETP1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16E8.13 PE=3 SV=1 105 617 8.0E-106
sp|P38748|ETP1_YEAST RING finger protein ETP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ETP1 PE=1 SV=1 134 616 3.0E-77
sp|Q7Z569|BRAP_HUMAN BRCA1-associated protein OS=Homo sapiens GN=BRAP PE=1 SV=2 131 616 7.0E-75
sp|Q99MP8|BRAP_MOUSE BRCA1-associated protein OS=Mus musculus GN=Brap PE=1 SV=1 131 616 2.0E-71
sp|Q95QN6|BRAP2_CAEEL BRCA1-associated protein homolog 2 OS=Caenorhabditis elegans GN=brap-2 PE=3 SV=1 93 636 4.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13747|EPT1_SCHPO RING finger protein ETP1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16E8.13 PE=3 SV=1 105 617 8.0E-106
sp|P38748|ETP1_YEAST RING finger protein ETP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ETP1 PE=1 SV=1 134 616 3.0E-77
sp|Q7Z569|BRAP_HUMAN BRCA1-associated protein OS=Homo sapiens GN=BRAP PE=1 SV=2 131 616 7.0E-75
sp|Q99MP8|BRAP_MOUSE BRCA1-associated protein OS=Mus musculus GN=Brap PE=1 SV=1 131 616 2.0E-71
sp|Q95QN6|BRAP2_CAEEL BRCA1-associated protein homolog 2 OS=Caenorhabditis elegans GN=brap-2 PE=3 SV=1 93 636 4.0E-66
sp|Q7ZUM8|UBP44_DANRE Ubiquitin carboxyl-terminal hydrolase 44 OS=Danio rerio GN=usp44 PE=2 SV=1 358 427 4.0E-07
sp|D2HBJ8|UBP44_AILME Ubiquitin carboxyl-terminal hydrolase 44 OS=Ailuropoda melanoleuca GN=USP44 PE=3 SV=1 358 427 6.0E-07
sp|O00237|RN103_HUMAN E3 ubiquitin-protein ligase RNF103 OS=Homo sapiens GN=RNF103 PE=1 SV=1 267 356 7.0E-07
sp|Q9H0E7|UBP44_HUMAN Ubiquitin carboxyl-terminal hydrolase 44 OS=Homo sapiens GN=USP44 PE=1 SV=2 358 415 7.0E-07
sp|Q7ZW78|RN181_DANRE E3 ubiquitin-protein ligase RNF181 OS=Danio rerio GN=rnf181 PE=2 SV=2 266 338 1.0E-06
sp|Q6P9L4|UBP49_MOUSE Ubiquitin carboxyl-terminal hydrolase 49 OS=Mus musculus GN=Usp49 PE=2 SV=1 358 446 2.0E-06
sp|Q54QE6|SIR2A_DICDI NAD-dependent deacetylase sir2A OS=Dictyostelium discoideum GN=sir2A PE=2 SV=1 358 417 3.0E-06
sp|Q9R1W3|RN103_MOUSE E3 ubiquitin-protein ligase RNF103 OS=Mus musculus GN=Rnf103 PE=2 SV=2 267 356 4.0E-06
sp|Q9EPZ8|RN103_RAT E3 ubiquitin-protein ligase RNF103 OS=Rattus norvegicus GN=Rnf103 PE=2 SV=1 267 356 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0008270 zinc ion binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0046914 transition metal ion binding No
GO:0043169 cation binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4971
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4934
Ophiocordyceps australis map64 (Brazil) OphauB2|949 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01543
Ophiocordyceps camponoti-rufipedis Ophun1|6557
Ophiocordyceps kimflemingae Ophio5|4878
Ophiocordyceps subramaniannii Hirsu2|2106

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|949
MPSYFYHVKFELYPWPDSHTSAVDNTRRRDDIWNPPAGASVFDKLPSHARSAQRRARSDSASGSCHTAAGGVRDW
RFGRVSIETADPTSSDGSMPNETVKEASSAAPALGPSFGGAGTATKAEYLPLETRNTELGWGVVHFYREGDETSS
LKAREQTTEQSTKDEGSTLCIPAVPVYMSPGDVMGFIGERWMGEISHCRMVMTSRMNRYLVLVRFRDAKRAKQWK
SEFDGKVFNAVEPLLCHVVFVKSITFETPTHSQRLEQSAPSGSASVSNTMKPFPPPTANLIELPTCPVCLERMDD
TNGLMTIPCSHVFHCSCLRSWKGSGCPVCRFTNTAEGATLNPNNPYSQPFGSPISNLCSVCDCIDDLWICLICGY
LGCGRYKGGHAKDHWKETAHSFALELDTQHVWDYAGDMWVHRLIRDKGDGKVVEFPGRSSGQEAADQDVVPRAKV
DNMGLEYMQLLTSQLETQRVYYEDMIKKAVDKAAKASAVAESSAAESASAAERLSELESKHEVLNRETLPQLERE
LERERRRSIKAETLARNLGKSLQEEKGMNQGLVERIQHLTDQSEALRKQVEALKAEGVELRETNRDLSMFISGQE
KLRELEQGGELQEGEIAEGSISLAERSIRKRPSKKK*
Coding >OphauB2|949
ATGCCTTCGTATTTTTATCACGTCAAATTCGAACTATATCCTTGGCCAGACTCACATACAAGCGCAGTGGATAAT
ACGAGGCGACGAGACGACATCTGGAACCCGCCGGCGGGTGCCAGCGTTTTTGACAAGTTACCCTCGCATGCGCGA
TCAGCGCAACGGCGCGCAAGAAGCGACAGCGCCTCTGGTTCATGTCACACAGCGGCGGGAGGGGTGCGAGATTGG
CGATTTGGCCGCGTGAGCATCGAGACGGCCGATCCGACAAGCTCGGACGGCAGCATGCCGAACGAGACAGTCAAG
GAAGCGTCGTCAGCGGCGCCGGCTCTGGGGCCCTCGTTTGGCGGTGCAGGCACAGCCACAAAGGCCGAATACCTG
CCACTAGAAACCAGGAACACGGAGCTGGGATGGGGAGTGGTGCATTTCTATCGCGAGGGCGACGAGACGTCATCG
CTCAAGGCGCGGGAGCAGACGACGGAGCAATCGACCAAGGACGAGGGCAGCACTCTGTGCATTCCTGCCGTGCCC
GTCTATATGTCACCTGGAGACGTCATGGGCTTCATAGGGGAGCGGTGGATGGGCGAGATAAGCCACTGTCGAATG
GTCATGACTTCGAGGATGAATCGCTATCTTGTTCTGGTGCGCTTCCGCGACGCTAAGCGAGCCAAGCAATGGAAG
AGCGAGTTTGACGGCAAAGTCTTCAACGCCGTCGAGCCCTTACTTTGTCACGTTGTCTTTGTCAAGTCCATCACA
TTCGAGACGCCGACGCACTCGCAGCGGCTCGAGCAGTCAGCTCCCTCTGGCTCGGCGTCTGTGTCAAACACCATG
AAGCCCTTTCCCCCGCCCACGGCCAACCTCATCGAGCTGCCGACATGTCCTGTTTGTCTGGAAAGAATGGACGAT
ACCAATGGGCTCATGACGATTCCCTGCTCTCACGTCTTTCACTGTAGCTGTCTGCGCAGCTGGAAGGGCAGTGGT
TGCCCTGTATGTCGATTCACTAATACTGCCGAGGGCGCCACGTTGAACCCCAACAATCCATACTCACAGCCCTTT
GGCTCGCCCATCTCCAACCTTTGCAGCGTGTGTGACTGTATAGATGATTTATGGATTTGCCTGATTTGTGGCTAC
CTGGGCTGCGGCCGCTACAAGGGCGGGCATGCCAAAGACCACTGGAAGGAGACAGCACACAGCTTCGCACTAGAA
CTAGACACGCAGCACGTCTGGGACTACGCAGGCGACATGTGGGTACACCGGCTGATACGCGACAAGGGCGACGGC
AAAGTGGTGGAGTTTCCTGGACGAAGCAGTGGACAAGAAGCAGCCGATCAAGATGTGGTGCCGCGAGCCAAAGTG
GACAACATGGGGCTCGAGTATATGCAGCTGCTTACGAGCCAACTCGAGACGCAACGCGTCTACTATGAAGACATG
ATAAAGAAGGCAGTTGACAAGGCGGCCAAGGCATCGGCAGTGGCAGAGAGCAGTGCAGCCGAGTCAGCCTCCGCA
GCGGAGCGCTTATCGGAGCTCGAGAGCAAGCATGAAGTGCTGAACCGGGAAACTCTTCCGCAACTGGAGCGGGAG
CTGGAGCGGGAGCGACGGCGAAGCATCAAGGCGGAGACGCTGGCGCGCAATTTGGGAAAATCGCTACAAGAGGAG
AAGGGAATGAACCAAGGGCTTGTGGAACGCATCCAGCATCTGACAGACCAAAGCGAGGCGCTGCGTAAACAGGTT
GAGGCGCTCAAGGCCGAAGGCGTTGAGCTGCGGGAAACAAACCGGGATTTGTCCATGTTCATCTCTGGCCAAGAA
AAGCTGCGTGAGCTGGAGCAAGGGGGCGAGCTGCAAGAGGGTGAGATTGCCGAGGGCAGCATCAGCCTTGCCGAG
AGAAGCATTCGGAAGCGGCCGAGCAAGAAGAAATAA
Transcript >OphauB2|949
ATGCCTTCGTATTTTTATCACGTCAAATTCGAACTATATCCTTGGCCAGACTCACATACAAGCGCAGTGGATAAT
ACGAGGCGACGAGACGACATCTGGAACCCGCCGGCGGGTGCCAGCGTTTTTGACAAGTTACCCTCGCATGCGCGA
TCAGCGCAACGGCGCGCAAGAAGCGACAGCGCCTCTGGTTCATGTCACACAGCGGCGGGAGGGGTGCGAGATTGG
CGATTTGGCCGCGTGAGCATCGAGACGGCCGATCCGACAAGCTCGGACGGCAGCATGCCGAACGAGACAGTCAAG
GAAGCGTCGTCAGCGGCGCCGGCTCTGGGGCCCTCGTTTGGCGGTGCAGGCACAGCCACAAAGGCCGAATACCTG
CCACTAGAAACCAGGAACACGGAGCTGGGATGGGGAGTGGTGCATTTCTATCGCGAGGGCGACGAGACGTCATCG
CTCAAGGCGCGGGAGCAGACGACGGAGCAATCGACCAAGGACGAGGGCAGCACTCTGTGCATTCCTGCCGTGCCC
GTCTATATGTCACCTGGAGACGTCATGGGCTTCATAGGGGAGCGGTGGATGGGCGAGATAAGCCACTGTCGAATG
GTCATGACTTCGAGGATGAATCGCTATCTTGTTCTGGTGCGCTTCCGCGACGCTAAGCGAGCCAAGCAATGGAAG
AGCGAGTTTGACGGCAAAGTCTTCAACGCCGTCGAGCCCTTACTTTGTCACGTTGTCTTTGTCAAGTCCATCACA
TTCGAGACGCCGACGCACTCGCAGCGGCTCGAGCAGTCAGCTCCCTCTGGCTCGGCGTCTGTGTCAAACACCATG
AAGCCCTTTCCCCCGCCCACGGCCAACCTCATCGAGCTGCCGACATGTCCTGTTTGTCTGGAAAGAATGGACGAT
ACCAATGGGCTCATGACGATTCCCTGCTCTCACGTCTTTCACTGTAGCTGTCTGCGCAGCTGGAAGGGCAGTGGT
TGCCCTGTATGTCGATTCACTAATACTGCCGAGGGCGCCACGTTGAACCCCAACAATCCATACTCACAGCCCTTT
GGCTCGCCCATCTCCAACCTTTGCAGCGTGTGTGACTGTATAGATGATTTATGGATTTGCCTGATTTGTGGCTAC
CTGGGCTGCGGCCGCTACAAGGGCGGGCATGCCAAAGACCACTGGAAGGAGACAGCACACAGCTTCGCACTAGAA
CTAGACACGCAGCACGTCTGGGACTACGCAGGCGACATGTGGGTACACCGGCTGATACGCGACAAGGGCGACGGC
AAAGTGGTGGAGTTTCCTGGACGAAGCAGTGGACAAGAAGCAGCCGATCAAGATGTGGTGCCGCGAGCCAAAGTG
GACAACATGGGGCTCGAGTATATGCAGCTGCTTACGAGCCAACTCGAGACGCAACGCGTCTACTATGAAGACATG
ATAAAGAAGGCAGTTGACAAGGCGGCCAAGGCATCGGCAGTGGCAGAGAGCAGTGCAGCCGAGTCAGCCTCCGCA
GCGGAGCGCTTATCGGAGCTCGAGAGCAAGCATGAAGTGCTGAACCGGGAAACTCTTCCGCAACTGGAGCGGGAG
CTGGAGCGGGAGCGACGGCGAAGCATCAAGGCGGAGACGCTGGCGCGCAATTTGGGAAAATCGCTACAAGAGGAG
AAGGGAATGAACCAAGGGCTTGTGGAACGCATCCAGCATCTGACAGACCAAAGCGAGGCGCTGCGTAAACAGGTT
GAGGCGCTCAAGGCCGAAGGCGTTGAGCTGCGGGAAACAAACCGGGATTTGTCCATGTTCATCTCTGGCCAAGAA
AAGCTGCGTGAGCTGGAGCAAGGGGGCGAGCTGCAAGAGGGTGAGATTGCCGAGGGCAGCATCAGCCTTGCCGAG
AGAAGCATTCGGAAGCGGCCGAGCAAGAAGAAATAA
Gene >OphauB2|949
ATGCCTTCGTATTTTTATCACGTCAAATTCGAACTATATCCTTGGCCAGACTCACATACAAGCGCAGTGGATAAT
ACGAGGCGACGAGACGACATCTGGAACCCGCCGGCGGGTGCCAGCGTTTTTGACAAGTTACCCTCGCATGCGCGA
TCAGCGCAACGGCGCGCAAGAAGCGACAGCGCCTCTGGTTCATGTCACACAGCGGCGGGAGGGGTGCGAGATTGG
CGATTTGGCCGCGTGAGCATCGAGACGGCCGATCCGACAAGCTCGGACGGCAGCATGCCGAACGAGACAGTCAAG
GAAGCGTCGTCAGCGGCGCCGGCTCTGGGGCCCTCGTTTGGCGGTGCAGGCACAGCCACAAAGGCCGAATACCTG
CCACTAGAAACCAGGAACACGGAGCTGGGATGGGGAGTGGTGCATTTCTATCGCGAGGGCGACGAGACGTCATCG
CTCAAGGCGCGGGAGCAGACGACGGAGCAATCGACCAAGGACGAGGGCAGCACTCTGTGCATTCCTGCCGTGCCC
GTCTATATGTCACCTGGAGACGTCATGGGCTTCATAGGGGAGCGGTGGATGGGCGAGATAAGCCACTGTCGAATG
GTCATGACTTCGAGGATGAATCGCTATCTTGTTCTGGTGCGCTTCCGCGACGCTAAGCGAGCCAAGCAATGGAAG
AGCGAGTTTGACGGCAAAGTCTTCAACGCCGTCGAGGTGAGTCACCCACCACGACTGGCTCGTGTCTTGTGGCTT
CTAACAGGAGCGTCGGGCCAGCCCTTACTTTGTCACGTTGTCTTTGTCAAGTCCATCACATTCGAGACGCCGACG
CACTCGCAGCGGCTCGAGCAGTCAGCTCCCTCTGGCTCGGCGTCTGTGTCAAACACCATGAAGCCCTTTCCCCCG
CCCACGGCCAACCTCATCGAGCTGCCGACATGTCCTGTTTGTCTGGAAAGAATGGACGATACCAATGGGCTCATG
ACGATTCCCTGCTCTCACGTCTTTCACTGTAGCTGTCTGCGCAGCTGGAAGGGCAGTGGTTGCCCTGTATGTCGA
TTCACTAATACTGCCGAGGGCGCCACGTTGAACCCCAACAATCCATACTCACAGCCCTTTGGCTCGCCCATCTCC
AACCTTTGCAGCGTGTGTGACTGTATAGATGATTTATGGATTTGCCTGATTTGTGGCTACCTGGGCTGCGGCCGC
TACAAGGGCGGGCATGCCAAAGACCACTGGAAGGAGACAGCACACAGCTTCGCACTAGAACTAGACACGCAGCAC
GTCTGGGACTACGCAGGCGACATGTGGGTACACCGGCTGATACGCGACAAGGGCGACGGCAAAGTGGTGGAGTTT
CCTGGACGAAGCAGTGGACAAGAAGCAGCCGATCAAGATGTGGTGCCGCGAGCCAAAGTGGACAACATGGGGCTC
GAGTATATGCAGCTGCTTACGAGCCAACTCGAGACGCAACGCGTCTACTATGAAGACATGATAAAGAAGGCAGTT
GACAAGGCGGCCAAGGCATCGGCAGTGGCAGAGAGCAGTGCAGCCGAGTCAGCCTCCGCAGCGGAGCGCTTATCG
GAGCTCGAGAGCAAGCATGAAGTGCTGAACCGGGAAACTCTTCCGCAACTGGAGCGGGAGCTGGAGCGGGAGCGA
CGGCGAAGCATCAAGGCGGAGACGCTGGCGCGCAATTTGGGAAAATCGCTACAAGAGGAGAAGGGAATGAACCAA
GGGCTTGTGGAACGCATCCAGCATCTGACAGACCAAAGCGAGGCGCTGCGTAAACAGGTTGAGGCGCTCAAGGCC
GAAGGCGTTGAGCTGCGGGAAACAAACCGGGATTTGTCCATGTTCATCTCTGGCCAAGAAAAGCTGCGTGAGCTG
GAGCAAGGGGGCGAGCTGCAAGAGGGTGAGATTGCCGAGGGCAGCATCAGCCTTGCCGAGAGAAGCATTCGGAAG
CGGCCGAGCAAGAAGAAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail