Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|939
Gene name
LocationContig_12:243537..245972
Strand+
Gene length (bp)2435
Transcript length (bp)2199
Coding sequence length (bp)2199
Protein length (aa) 733

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00790 VHS VHS domain 8.2E-41 9 146
PF01363 FYVE FYVE zinc finger 2.5E-14 171 227
PF02809 UIM Ubiquitin interaction motif 1.0E-03 267 280
PF02809 UIM Ubiquitin interaction motif 2.7E-02 311 327

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2GS33|VPS27_CHAGB Vacuolar protein sorting-associated protein 27 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=VPS27 PE=3 SV=2 1 732 0.0E+00
sp|A4QTV1|VPS27_MAGO7 Vacuolar protein sorting-associated protein 27 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=VPS27 PE=3 SV=1 1 732 0.0E+00
sp|Q0U4Z8|VPS27_PHANO Vacuolar protein sorting-associated protein 27 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=VPS27 PE=3 SV=1 1 550 0.0E+00
sp|Q0CJV3|VPS27_ASPTN Vacuolar protein sorting-associated protein 27 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=vps27 PE=3 SV=1 1 490 0.0E+00
sp|Q5BBK9|VPS27_EMENI Vacuolar protein sorting-associated protein 27 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=vps27 PE=3 SV=1 1 513 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2GS33|VPS27_CHAGB Vacuolar protein sorting-associated protein 27 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=VPS27 PE=3 SV=2 1 732 0.0E+00
sp|A4QTV1|VPS27_MAGO7 Vacuolar protein sorting-associated protein 27 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=VPS27 PE=3 SV=1 1 732 0.0E+00
sp|Q0U4Z8|VPS27_PHANO Vacuolar protein sorting-associated protein 27 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=VPS27 PE=3 SV=1 1 550 0.0E+00
sp|Q0CJV3|VPS27_ASPTN Vacuolar protein sorting-associated protein 27 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=vps27 PE=3 SV=1 1 490 0.0E+00
sp|Q5BBK9|VPS27_EMENI Vacuolar protein sorting-associated protein 27 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=vps27 PE=3 SV=1 1 513 0.0E+00
sp|A1DFP5|VPS27_NEOFI Vacuolar protein sorting-associated protein 27 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=vps27 PE=3 SV=1 1 657 0.0E+00
sp|A1CEK1|VPS27_ASPCL Vacuolar protein sorting-associated protein 27 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=vps27 PE=3 SV=1 1 490 0.0E+00
sp|Q4WHN8|VPS27_ASPFU Vacuolar protein sorting-associated protein 27 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=vps27 PE=3 SV=1 1 490 0.0E+00
sp|A2QWA2|VPS27_ASPNC Vacuolar protein sorting-associated protein 27 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=vps27 PE=3 SV=1 1 490 0.0E+00
sp|Q6CFT4|VPS27_YARLI Vacuolar protein sorting-associated protein 27 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=VPS27 PE=3 SV=1 2 514 2.0E-137
sp|O13821|VPS27_SCHPO Vacuolar protein sorting-associated protein 27 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sst4 PE=3 SV=1 1 453 1.0E-116
sp|Q4P7Q1|VPS27_USTMA Vacuolar protein sorting-associated protein 27 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=VPS27 PE=3 SV=1 1 448 9.0E-86
sp|Q6BSD6|VPS27_DEBHA Vacuolar protein sorting-associated protein 27 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=VPS27 PE=3 SV=2 2 637 2.0E-81
sp|P0CS26|VPS27_CRYNJ Vacuolar protein sorting-associated protein 27 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=VPS27 PE=3 SV=1 2 443 3.0E-81
sp|P0CS27|VPS27_CRYNB Vacuolar protein sorting-associated protein 27 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=VPS27 PE=3 SV=1 2 443 3.0E-81
sp|Q6CL17|VPS27_KLULA Vacuolar protein sorting-associated protein 27 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=VPS27 PE=3 SV=1 7 478 1.0E-77
sp|Q6FQJ1|VPS27_CANGA Vacuolar protein sorting-associated protein 27 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=VPS27 PE=3 SV=1 5 456 2.0E-77
sp|Q755J9|VPS27_ASHGO Vacuolar protein sorting-associated protein 27 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VPS27 PE=3 SV=1 11 456 4.0E-77
sp|P40343|VPS27_YEAST Vacuolar protein sorting-associated protein 27 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS27 PE=1 SV=3 5 500 8.0E-76
sp|A3LX75|VPS27_PICST Vacuolar protein sorting-associated protein 27 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=VPS27 PE=3 SV=2 2 493 8.0E-68
sp|Q5ABD9|VPS27_CANAL Vacuolar protein sorting-associated protein 27 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VPS27 PE=3 SV=1 2 470 4.0E-64
sp|Q99LI8|HGS_MOUSE Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Mus musculus GN=Hgs PE=1 SV=2 13 288 3.0E-42
sp|Q9JJ50|HGS_RAT Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Rattus norvegicus GN=Hgs PE=1 SV=1 13 288 7.0E-42
sp|O14964|HGS_HUMAN Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens GN=HGS PE=1 SV=1 13 288 8.0E-42
sp|Q0V8S0|HGS_BOVIN Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Bos taurus GN=HGS PE=2 SV=1 13 288 2.0E-41
sp|Q960X8|HRS_DROME Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Drosophila melanogaster GN=Hrs PE=1 SV=1 11 227 3.0E-40
sp|O12940|TOM1_CHICK Target of Myb protein 1 OS=Gallus gallus GN=TOM1 PE=2 SV=2 10 150 3.0E-21
sp|O88746|TOM1_MOUSE Target of Myb protein 1 OS=Mus musculus GN=Tom1 PE=1 SV=1 11 150 4.0E-21
sp|O60784|TOM1_HUMAN Target of Myb protein 1 OS=Homo sapiens GN=TOM1 PE=1 SV=2 11 150 7.0E-21
sp|Q68FJ8|TM1L2_XENLA TOM1-like protein 2 OS=Xenopus laevis GN=tom1l2 PE=2 SV=1 17 150 5.0E-20
sp|Q5SRX1|TM1L2_MOUSE TOM1-like protein 2 OS=Mus musculus GN=Tom1l2 PE=1 SV=1 17 150 2.0E-19
sp|Q6ZVM7|TM1L2_HUMAN TOM1-like protein 2 OS=Homo sapiens GN=TOM1L2 PE=1 SV=1 17 150 3.0E-19
sp|P87157|YB0G_SCHPO Probable ADP-ribosylation factor-binding protein C25H2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC25H2.16c PE=1 SV=1 27 150 4.0E-17
sp|P0CR79|HSE1_CRYNB Class E vacuolar protein-sorting machinery protein HSE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HSE1 PE=3 SV=1 7 149 1.0E-15
sp|Q92783|STAM1_HUMAN Signal transducing adapter molecule 1 OS=Homo sapiens GN=STAM PE=1 SV=3 9 150 1.0E-15
sp|P70297|STAM1_MOUSE Signal transducing adapter molecule 1 OS=Mus musculus GN=Stam PE=1 SV=3 9 150 1.0E-15
sp|P0CR78|HSE1_CRYNJ Class E vacuolar protein-sorting machinery protein HSE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HSE1 PE=3 SV=1 7 149 2.0E-15
sp|Q10410|YD85_SCHPO Probable ADP-ribosylation factor-binding protein C1F3.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F3.05 PE=3 SV=1 13 150 1.0E-14
sp|Q06336|GGA1_YEAST ADP-ribosylation factor-binding protein GGA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GGA1 PE=1 SV=1 8 150 3.0E-14
sp|Q923U0|TM1L1_MOUSE TOM1-like protein 1 OS=Mus musculus GN=Tom1l1 PE=1 SV=1 17 151 5.0E-14
sp|Q2GT05|HSE1_CHAGB Class E vacuolar protein-sorting machinery protein HSE1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HSE1 PE=3 SV=1 5 161 6.0E-14
sp|F1LM81|TM1L1_RAT TOM1-like protein 1 OS=Rattus norvegicus GN=Tom1l1 PE=1 SV=1 11 151 2.0E-13
sp|O75674|TM1L1_HUMAN TOM1-like protein 1 OS=Homo sapiens GN=TOM1L1 PE=1 SV=2 17 151 2.0E-13
sp|Q7S6J4|HSE1_NEUCR Class E vacuolar protein-sorting machinery protein hse1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hse1 PE=3 SV=1 5 144 3.0E-13
sp|A4RF61|HSE1_MAGO7 Class E vacuolar protein-sorting machinery protein HSE1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HSE1 PE=3 SV=2 5 161 1.0E-12
sp|P38817|GGA2_YEAST ADP-ribosylation factor-binding protein GGA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GGA2 PE=1 SV=1 13 150 5.0E-12
sp|O75886|STAM2_HUMAN Signal transducing adapter molecule 2 OS=Homo sapiens GN=STAM2 PE=1 SV=1 13 151 6.0E-12
sp|Q17AN2|LST2_AEDAE Lateral signaling target protein 2 homolog OS=Aedes aegypti GN=AAEL005241 PE=3 SV=1 164 229 2.0E-11
sp|O88811|STAM2_MOUSE Signal transducing adapter molecule 2 OS=Mus musculus GN=Stam2 PE=1 SV=1 13 150 2.0E-11
sp|Q5BBL4|HSE1_EMENI Class E vacuolar protein-sorting machinery protein hse1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hse1 PE=3 SV=1 11 143 2.0E-11
sp|A1DFN5|HSE1_NEOFI Class E vacuolar protein-sorting machinery protein hse1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hse1 PE=3 SV=1 11 143 3.0E-11
sp|Q0CJU8|HSE1_ASPTN Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hse1 PE=3 SV=1 11 143 3.0E-11
sp|O93436|STAM2_CHICK Signal transducing adapter molecule 2 OS=Gallus gallus GN=STAM2 PE=1 SV=1 8 158 3.0E-11
sp|A2QW93|HSE1_ASPNC Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=hse1 PE=3 SV=1 11 143 3.0E-11
sp|B0WAQ0|LST2_CULQU Lateral signaling target protein 2 homolog OS=Culex quinquefasciatus GN=CPIJ004116 PE=3 SV=1 164 229 5.0E-11
sp|Q5XHY7|STAM2_RAT Signal transducing adapter molecule 2 OS=Rattus norvegicus GN=Stam2 PE=2 SV=1 13 150 6.0E-11
sp|A1CEK6|HSE1_ASPCL Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hse1 PE=3 SV=1 11 143 7.0E-11
sp|B4NFJ7|LST2_DROWI Lateral signaling target protein 2 homolog OS=Drosophila willistoni GN=GK22512 PE=3 SV=1 164 226 9.0E-11
sp|B3P851|LST2_DROER Lateral signaling target protein 2 homolog OS=Drosophila erecta GN=GG12136 PE=3 SV=1 154 231 2.0E-10
sp|B4PRU6|LST2_DROYA Lateral signaling target protein 2 homolog OS=Drosophila yakuba GN=GE10583 PE=3 SV=1 154 231 2.0E-10
sp|Q9VB70|LST2_DROME Lateral signaling target protein 2 homolog OS=Drosophila melanogaster GN=CG6051 PE=1 SV=3 154 231 2.0E-10
sp|B4IC49|LST2_DROSE Lateral signaling target protein 2 homolog OS=Drosophila sechellia GN=GM10129 PE=3 SV=1 154 231 2.0E-10
sp|Q9P2R3|ANFY1_HUMAN Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 159 231 4.0E-10
sp|Q810B6|ANFY1_MOUSE Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 159 231 4.0E-10
sp|Q0P4S0|LST2_XENTR Lateral signaling target protein 2 homolog OS=Xenopus tropicalis GN=zfyve28 PE=2 SV=1 165 224 4.0E-10
sp|B4K982|LST2_DROMO Lateral signaling target protein 2 homolog OS=Drosophila mojavensis GN=GI24295 PE=3 SV=1 164 226 5.0E-10
sp|Q6ZPK7|LST2_MOUSE Lateral signaling target protein 2 homolog OS=Mus musculus GN=Zfyve28 PE=1 SV=2 161 224 5.0E-10
sp|B4M140|LST2_DROVI Lateral signaling target protein 2 homolog OS=Drosophila virilis GN=GJ23073 PE=3 SV=1 164 226 5.0E-10
sp|Q7QAJ2|LST2_ANOGA Lateral signaling target protein 2 homolog OS=Anopheles gambiae GN=AGAP003678 PE=3 SV=6 165 229 6.0E-10
sp|Q54GH3|TOM1_DICDI Target of Myb protein 1 OS=Dictyostelium discoideum GN=tom1 PE=1 SV=1 13 165 7.0E-10
sp|A0JMD2|LST2_DANRE Lateral signaling target protein 2 homolog OS=Danio rerio GN=zfyve28 PE=2 SV=1 165 224 7.0E-10
sp|Q9HCC9|LST2_HUMAN Lateral signaling target protein 2 homolog OS=Homo sapiens GN=ZFYVE28 PE=1 SV=3 161 224 7.0E-10
sp|Q4P5J4|HSE1_USTMA Class E vacuolar protein-sorting machinery protein HSE1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HSE1 PE=3 SV=1 8 143 1.0E-09
sp|B4JHI7|LST2_DROGR Lateral signaling target protein 2 homolog OS=Drosophila grimshawi GN=GH18624 PE=3 SV=1 164 226 1.0E-09
sp|Q9TZD0|LST2_CAEEL Lateral signaling target protein 2 OS=Caenorhabditis elegans GN=lst-2 PE=2 SV=2 168 234 1.0E-09
sp|Q05B78|ZFY21_BOVIN Zinc finger FYVE domain-containing protein 21 OS=Bos taurus GN=ZFYVE21 PE=2 SV=1 166 223 1.0E-09
sp|Q8IZQ1|WDFY3_HUMAN WD repeat and FYVE domain-containing protein 3 OS=Homo sapiens GN=WDFY3 PE=1 SV=2 163 227 2.0E-09
sp|Q1E878|HSE1_COCIM Class E vacuolar protein-sorting machinery protein HSE1 OS=Coccidioides immitis (strain RS) GN=HSE1 PE=3 SV=1 11 143 2.0E-09
sp|Q6VNB8|WDFY3_MOUSE WD repeat and FYVE domain-containing protein 3 OS=Mus musculus GN=Wdfy3 PE=1 SV=1 163 227 2.0E-09
sp|B4G2G5|LST2_DROPE Lateral signaling target protein 2 homolog OS=Drosophila persimilis GN=GL23610 PE=3 SV=1 174 226 3.0E-09
sp|Q0U6X7|HSE1_PHANO Class E vacuolar protein-sorting machinery protein HSE1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HSE1 PE=3 SV=1 13 143 4.0E-09
sp|A8XJZ8|LST2_CAEBR Lateral signaling target protein 2 OS=Caenorhabditis briggsae GN=lst-2 PE=3 SV=1 168 225 5.0E-09
sp|Q15075|EEA1_HUMAN Early endosome antigen 1 OS=Homo sapiens GN=EEA1 PE=1 SV=2 170 229 7.0E-09
sp|Q8BL66|EEA1_MOUSE Early endosome antigen 1 OS=Mus musculus GN=Eea1 PE=1 SV=2 170 229 7.0E-09
sp|B3MT31|LST2_DROAN Lateral signaling target protein 2 homolog OS=Drosophila ananassae GN=GF22946 PE=3 SV=1 174 231 7.0E-09
sp|O74749|HSE1_SCHPO Class E vacuolar protein-sorting machinery protein hse1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hse1 PE=3 SV=1 44 144 9.0E-09
sp|A8QCE4|LST2_BRUMA Lateral signaling target protein 2 homolog OS=Brugia malayi GN=Bm1_49520 PE=3 SV=1 168 224 1.0E-08
sp|Q96T51|RUFY1_HUMAN RUN and FYVE domain-containing protein 1 OS=Homo sapiens GN=RUFY1 PE=1 SV=2 168 227 2.0E-08
sp|Q8BUB4|WDFY2_MOUSE WD repeat and FYVE domain-containing protein 2 OS=Mus musculus GN=Wdfy2 PE=1 SV=2 166 228 2.0E-08
sp|Q96P53|WDFY2_HUMAN WD repeat and FYVE domain-containing protein 2 OS=Homo sapiens GN=WDFY2 PE=1 SV=2 166 228 3.0E-08
sp|Q8BIJ7|RUFY1_MOUSE RUN and FYVE domain-containing protein 1 OS=Mus musculus GN=Rufy1 PE=1 SV=1 168 227 3.0E-08
sp|Q8VCM3|ZFY21_MOUSE Zinc finger FYVE domain-containing protein 21 OS=Mus musculus GN=Zfyve21 PE=1 SV=2 166 218 4.0E-08
sp|Q9BQ24|ZFY21_HUMAN Zinc finger FYVE domain-containing protein 21 OS=Homo sapiens GN=ZFYVE21 PE=1 SV=1 166 218 1.0E-07
sp|Q5UR69|YL615_MIMIV Putative phosphatidylinositol kinase L615 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L615 PE=3 SV=1 153 230 1.0E-07
sp|Q8R4C2|RUFY2_MOUSE RUN and FYVE domain-containing protein 2 OS=Mus musculus GN=Rufy2 PE=1 SV=2 168 230 1.0E-07
sp|D3ZVP7|ZFY21_RAT Zinc finger FYVE domain-containing protein 21 OS=Rattus norvegicus GN=Zfyve21 PE=3 SV=1 166 218 2.0E-07
sp|Q68FU1|PKHF1_RAT Pleckstrin homology domain-containing family F member 1 OS=Rattus norvegicus GN=Plekhf1 PE=2 SV=1 133 234 2.0E-07
sp|Q5R5R4|RUFY2_PONAB RUN and FYVE domain-containing protein 2 OS=Pongo abelii GN=RUFY2 PE=2 SV=1 174 230 2.0E-07
sp|Q6ZV73|FGD6_HUMAN FYVE, RhoGEF and PH domain-containing protein 6 OS=Homo sapiens GN=FGD6 PE=1 SV=2 163 227 2.0E-07
sp|Q8WXA3|RUFY2_HUMAN RUN and FYVE domain-containing protein 2 OS=Homo sapiens GN=RUFY2 PE=1 SV=2 174 228 2.0E-07
sp|Q6C2N2|HSE1_YARLI Class E vacuolar protein-sorting machinery protein HSE1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HSE1 PE=3 SV=1 4 145 4.0E-07
sp|Q54LD5|ADCD_DICDI Arrestin domain-containing protein D OS=Dictyostelium discoideum GN=adcD PE=3 SV=1 166 248 5.0E-07
sp|Q3TB82|PKHF1_MOUSE Pleckstrin homology domain-containing family F member 1 OS=Mus musculus GN=Plekhf1 PE=2 SV=1 133 234 5.0E-07
sp|Q96S99|PKHF1_HUMAN Pleckstrin homology domain-containing family F member 1 OS=Homo sapiens GN=PLEKHF1 PE=1 SV=3 111 227 5.0E-07
sp|Q8K296|MTMR3_MOUSE Myotubularin-related protein 3 OS=Mus musculus GN=Mtmr3 PE=1 SV=2 174 227 6.0E-07
sp|Q5PQT2|MTMR3_RAT Myotubularin-related protein 3 OS=Rattus norvegicus GN=Mtmr3 PE=1 SV=1 174 227 7.0E-07
sp|Q13615|MTMR3_HUMAN Myotubularin-related protein 3 OS=Homo sapiens GN=MTMR3 PE=1 SV=3 174 227 7.0E-07
sp|Q5ZLY5|PKHF2_CHICK Pleckstrin homology domain-containing family F member 2 OS=Gallus gallus GN=PLEKHF2 PE=2 SV=1 168 228 8.0E-07
sp|Q7ZUV1|PKHF2_DANRE Pleckstrin homology domain-containing family F member 2 OS=Danio rerio GN=plekhf2 PE=2 SV=1 168 228 1.0E-06
sp|Q91WB4|PKHF2_MOUSE Pleckstrin homology domain-containing family F member 2 OS=Mus musculus GN=Plekhf2 PE=1 SV=1 168 228 1.0E-06
sp|Q9H8W4|PKHF2_HUMAN Pleckstrin homology domain-containing family F member 2 OS=Homo sapiens GN=PLEKHF2 PE=1 SV=1 168 229 1.0E-06
sp|Q8IWB7|WDFY1_HUMAN WD repeat and FYVE domain-containing protein 1 OS=Homo sapiens GN=WDFY1 PE=1 SV=1 166 271 1.0E-06
sp|Q2KIY3|WDFY1_BOVIN WD repeat and FYVE domain-containing protein 1 OS=Bos taurus GN=WDFY1 PE=2 SV=1 166 271 1.0E-06
sp|E9Q4P1|WDFY1_MOUSE WD repeat and FYVE domain-containing protein 1 OS=Mus musculus GN=Wdfy1 PE=1 SV=1 166 271 1.0E-06
sp|Q9NZ52|GGA3_HUMAN ADP-ribosylation factor-binding protein GGA3 OS=Homo sapiens GN=GGA3 PE=1 SV=1 12 148 2.0E-06
sp|Q54CH1|ADCA_DICDI Arrestin domain-containing protein A OS=Dictyostelium discoideum GN=adcA PE=1 SV=1 174 239 2.0E-06
sp|Q5RFL4|ZFYV1_PONAB Zinc finger FYVE domain-containing protein 1 OS=Pongo abelii GN=ZFYVE1 PE=2 SV=1 161 231 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0035091 phosphatidylinositol binding Yes
GO:0043130 ubiquitin binding Yes
GO:0005515 protein binding No
GO:0003674 molecular_function No
GO:0005543 phospholipid binding No
GO:0005488 binding No
GO:0032182 ubiquitin-like protein binding No
GO:0008289 lipid binding No
GO:0043167 ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|939
MMNWWSSSANSALDEQIERATSSSLEDIALNLEISDVIRSKTVVPKEAMRSLKRRIGHKNPNTQLSALNLTDTCV
KNGGSHFLAEIASREFMDNLVSLLQAVGPAAVNAEVKSKILELVQSWAGAAEGRHDLSYIGDVYKTLQREGYLFP
PRVSVASSMLDSSAPPEWIDSDVCMRCRTAFTFTNRKHHCRNCGSCFDQQCSSKTIALPHLGIHSPVRVDDGCYA
KLTGKGQKEVNASLDRSPTYPHKTRSTSAMQPRNARVDDGFDEDLKKALAMSLEEVKNASSTRGYVEPSVTEGNK
SHTDGSKQAEEEDADLKAAIAASLADMEEQKQQHNAALKQQASNAPTGSSISAGFVLPKNDYELTPVEAENINLF
STLVDRLQTQPPGTILREPQIQELYDSIGGLRPKLARTYGETMSKHDTLLDLHAKLSTVVRYYDRMLEERLSKAY
SQQNFGGFNLSPPRQSSGSYPRMASQVQGNAAGAEGFYTGQQPDTTNYQPVPSHHYHQSQPLEHASYRPGPSQQA
HGWQSQDAYQQRPPSVATHRMQSPQQPPVSPTADRQSSYYTNQPQAVHSPGPLAPGAAADSGTSPYPSLPTSVHY
SSTPVSAVSQSTPGQTQGQPLQSSQSLYTAQPSQPPYFAQASQTSYHAPSAQSCLPAQPSQPVQQAPSIQSQQET
YRRQSASYNVASPQVNTQTVKMQPPWAYMGYNQDAFPSVPEDEPVKKPVAEEALIEL*
Coding >OphauB2|939
ATGATGAACTGGTGGTCGTCCTCGGCCAACTCGGCCCTGGACGAGCAGATCGAAAGAGCAACGAGCAGCAGCCTC
GAGGATATTGCGCTCAATCTTGAAATTTCAGACGTCATCCGCTCCAAGACAGTGGTGCCCAAGGAGGCTATGCGA
TCCCTCAAACGACGCATCGGCCATAAGAATCCAAACACACAGCTAAGCGCCCTAAATCTCACCGACACGTGTGTT
AAGAATGGCGGCTCCCACTTCTTGGCCGAGATTGCCTCGCGAGAATTCATGGACAATCTTGTCTCTCTTCTTCAA
GCCGTCGGTCCCGCAGCAGTCAACGCCGAGGTGAAATCCAAGATACTCGAGCTCGTACAGTCTTGGGCTGGTGCT
GCAGAGGGGAGACACGATCTCTCGTACATCGGCGACGTTTACAAGACGCTGCAGCGCGAGGGTTATCTATTTCCA
CCTCGAGTCTCAGTAGCGAGCAGCATGCTTGACAGTAGCGCGCCTCCCGAATGGATCGACTCAGATGTGTGCATG
CGATGCCGCACCGCTTTCACGTTTACGAATAGAAAGCACCACTGCAGAAACTGCGGCAGCTGTTTCGATCAGCAA
TGCTCGAGCAAGACCATCGCACTACCGCATCTTGGCATTCATAGCCCAGTTCGCGTGGATGACGGATGCTATGCT
AAACTTACAGGCAAAGGCCAAAAGGAAGTCAACGCATCACTGGACCGCTCGCCTACATATCCGCACAAGACTCGC
AGCACCTCGGCCATGCAGCCTCGCAATGCCCGTGTCGACGACGGTTTCGACGAGGACCTGAAAAAGGCCCTGGCA
ATGAGTCTCGAAGAAGTAAAAAACGCCTCTTCCACCCGGGGCTATGTTGAGCCGTCAGTTACAGAAGGCAACAAA
TCACACACGGATGGTTCAAAGCAGGCTGAAGAGGAGGACGCAGACCTCAAGGCGGCTATTGCTGCCTCCCTGGCA
GATATGGAAGAGCAGAAGCAGCAGCATAACGCGGCGCTCAAACAGCAGGCCTCTAATGCGCCAACGGGAAGCTCC
ATATCAGCAGGCTTCGTGCTGCCCAAGAATGATTATGAATTAACGCCAGTCGAAGCCGAAAACATCAATCTCTTT
TCAACGCTTGTTGACCGCCTGCAGACTCAGCCGCCGGGTACGATTCTGCGCGAGCCTCAGATTCAAGAGCTCTAC
GATAGCATTGGTGGACTGCGGCCGAAACTGGCTCGCACGTACGGCGAGACTATGAGCAAGCACGATACCCTTTTA
GATCTTCATGCCAAATTATCAACAGTAGTCAGATACTACGACCGCATGCTCGAAGAACGATTATCAAAGGCCTAT
AGCCAGCAAAACTTTGGTGGCTTCAACCTGTCACCGCCACGCCAGTCGTCAGGGTCTTACCCACGGATGGCATCA
CAGGTACAGGGCAATGCTGCTGGTGCCGAGGGCTTTTATACTGGACAACAGCCTGACACGACCAACTATCAGCCA
GTCCCAAGCCATCACTATCATCAATCACAACCGCTCGAGCATGCTTCATATAGACCGGGGCCGAGCCAACAAGCA
CATGGCTGGCAGAGTCAGGATGCATATCAGCAGCGTCCTCCATCTGTCGCGACGCACCGCATGCAAAGCCCGCAG
CAGCCACCTGTCTCGCCGACTGCAGATCGGCAGAGCTCCTACTACACTAACCAGCCTCAGGCCGTCCATTCTCCG
GGCCCTTTGGCGCCTGGTGCTGCAGCAGATTCGGGCACGTCGCCTTATCCAAGCCTTCCAACGTCAGTACATTAT
TCGTCGACGCCTGTTTCTGCCGTGTCGCAGTCAACACCTGGGCAGACGCAGGGACAACCTTTACAGTCTTCGCAG
TCTTTATATACCGCACAGCCTTCTCAGCCACCGTATTTTGCGCAAGCCTCTCAAACATCGTATCACGCACCGTCT
GCTCAATCATGTCTTCCCGCACAACCCTCTCAGCCTGTGCAACAGGCACCGTCGATTCAGAGTCAACAAGAAACT
TACCGGAGACAGTCTGCGTCATATAATGTGGCGAGCCCGCAAGTTAATACGCAGACTGTCAAGATGCAGCCACCG
TGGGCATACATGGGCTACAACCAAGACGCGTTCCCATCGGTCCCGGAGGATGAACCAGTCAAGAAACCGGTGGCA
GAAGAGGCTCTTATTGAGCTATGA
Transcript >OphauB2|939
ATGATGAACTGGTGGTCGTCCTCGGCCAACTCGGCCCTGGACGAGCAGATCGAAAGAGCAACGAGCAGCAGCCTC
GAGGATATTGCGCTCAATCTTGAAATTTCAGACGTCATCCGCTCCAAGACAGTGGTGCCCAAGGAGGCTATGCGA
TCCCTCAAACGACGCATCGGCCATAAGAATCCAAACACACAGCTAAGCGCCCTAAATCTCACCGACACGTGTGTT
AAGAATGGCGGCTCCCACTTCTTGGCCGAGATTGCCTCGCGAGAATTCATGGACAATCTTGTCTCTCTTCTTCAA
GCCGTCGGTCCCGCAGCAGTCAACGCCGAGGTGAAATCCAAGATACTCGAGCTCGTACAGTCTTGGGCTGGTGCT
GCAGAGGGGAGACACGATCTCTCGTACATCGGCGACGTTTACAAGACGCTGCAGCGCGAGGGTTATCTATTTCCA
CCTCGAGTCTCAGTAGCGAGCAGCATGCTTGACAGTAGCGCGCCTCCCGAATGGATCGACTCAGATGTGTGCATG
CGATGCCGCACCGCTTTCACGTTTACGAATAGAAAGCACCACTGCAGAAACTGCGGCAGCTGTTTCGATCAGCAA
TGCTCGAGCAAGACCATCGCACTACCGCATCTTGGCATTCATAGCCCAGTTCGCGTGGATGACGGATGCTATGCT
AAACTTACAGGCAAAGGCCAAAAGGAAGTCAACGCATCACTGGACCGCTCGCCTACATATCCGCACAAGACTCGC
AGCACCTCGGCCATGCAGCCTCGCAATGCCCGTGTCGACGACGGTTTCGACGAGGACCTGAAAAAGGCCCTGGCA
ATGAGTCTCGAAGAAGTAAAAAACGCCTCTTCCACCCGGGGCTATGTTGAGCCGTCAGTTACAGAAGGCAACAAA
TCACACACGGATGGTTCAAAGCAGGCTGAAGAGGAGGACGCAGACCTCAAGGCGGCTATTGCTGCCTCCCTGGCA
GATATGGAAGAGCAGAAGCAGCAGCATAACGCGGCGCTCAAACAGCAGGCCTCTAATGCGCCAACGGGAAGCTCC
ATATCAGCAGGCTTCGTGCTGCCCAAGAATGATTATGAATTAACGCCAGTCGAAGCCGAAAACATCAATCTCTTT
TCAACGCTTGTTGACCGCCTGCAGACTCAGCCGCCGGGTACGATTCTGCGCGAGCCTCAGATTCAAGAGCTCTAC
GATAGCATTGGTGGACTGCGGCCGAAACTGGCTCGCACGTACGGCGAGACTATGAGCAAGCACGATACCCTTTTA
GATCTTCATGCCAAATTATCAACAGTAGTCAGATACTACGACCGCATGCTCGAAGAACGATTATCAAAGGCCTAT
AGCCAGCAAAACTTTGGTGGCTTCAACCTGTCACCGCCACGCCAGTCGTCAGGGTCTTACCCACGGATGGCATCA
CAGGTACAGGGCAATGCTGCTGGTGCCGAGGGCTTTTATACTGGACAACAGCCTGACACGACCAACTATCAGCCA
GTCCCAAGCCATCACTATCATCAATCACAACCGCTCGAGCATGCTTCATATAGACCGGGGCCGAGCCAACAAGCA
CATGGCTGGCAGAGTCAGGATGCATATCAGCAGCGTCCTCCATCTGTCGCGACGCACCGCATGCAAAGCCCGCAG
CAGCCACCTGTCTCGCCGACTGCAGATCGGCAGAGCTCCTACTACACTAACCAGCCTCAGGCCGTCCATTCTCCG
GGCCCTTTGGCGCCTGGTGCTGCAGCAGATTCGGGCACGTCGCCTTATCCAAGCCTTCCAACGTCAGTACATTAT
TCGTCGACGCCTGTTTCTGCCGTGTCGCAGTCAACACCTGGGCAGACGCAGGGACAACCTTTACAGTCTTCGCAG
TCTTTATATACCGCACAGCCTTCTCAGCCACCGTATTTTGCGCAAGCCTCTCAAACATCGTATCACGCACCGTCT
GCTCAATCATGTCTTCCCGCACAACCCTCTCAGCCTGTGCAACAGGCACCGTCGATTCAGAGTCAACAAGAAACT
TACCGGAGACAGTCTGCGTCATATAATGTGGCGAGCCCGCAAGTTAATACGCAGACTGTCAAGATGCAGCCACCG
TGGGCATACATGGGCTACAACCAAGACGCGTTCCCATCGGTCCCGGAGGATGAACCAGTCAAGAAACCGGTGGCA
GAAGAGGCTCTTATTGAGCTATGA
Gene >OphauB2|939
ATGATGAACTGGTGGTCGTCCTCGGCCAACTCGGCCCTGGACGAGCAGATCGAAAGAGCAACGAGCAGCAGCCTG
TAGGCTTCCCTCATCACGTTGCCCATGACTGTGGCTGACTTGCATGTGCAGCGAGGATATTGCGCTCAATCTTGA
AATTTCAGACGTCATCCGCTCCAAGACAGTGGTGCCCAAGGAGGCTATGCGATCCCTCAAACGACGCATCGGCCA
TAAGAATCCAAACACACAGCTAAGCGCCCTAAATGTTTGATATCTTGAGTCTGAGGTTTCAGTCAACAGATTTTC
TCTAATACTTACGATGCAGCTCACCGACACGTGTGTTAAGAATGGCGGCTCCCACTTCTTGGCCGAGATTGCCTC
GCGAGAATTCATGGACAATCTTGTCTCTCTTCTTCAAGCCGTCGGTCCCGCAGCAGTCAACGCCGAGGTGAAATC
CAAGATACTCGAGCTCGTACAGTCTTGGGCTGGTGCTGCAGAGGGGAGACACGATCTCTCGTACATCGGCGACGT
TTACAAGACGCTGCAGCGCGAGGGTTATCTATTTCCACCTCGAGTCTCAGTAGCGAGCAGCATGCTTGACAGTAG
CGCGGTCAGCAACTATCCAGACGAACCCTACCTTGTTGTTCTTGGGAGGAGAGGTTCTGATACTTGTTGTAGCCT
CCCGAATGGATCGACTCAGATGTGTGCATGCGATGCCGCACCGCTTTCACGTTTACGAATAGAAAGCACCACTGC
AGAAACTGCGGCAGCTGTTTCGATCAGCAATGCTCGAGCAAGACCATCGCACTACCGCATCTTGGCATTCATAGC
CCAGTTCGCGTGGATGACGGATGCTATGCTAAACTTACAGGCAAAGGCCAAAAGGAAGTCAACGCATCACTGGAC
CGCTCGCCTACATATCCGCACAAGACTCGCAGCACCTCGGCCATGCAGCCTCGCAATGCCCGTGTCGACGACGGT
TTCGACGAGGACCTGAAAAAGGCCCTGGCAATGAGTCTCGAAGAAGTAAAAAACGCCTCTTCCACCCGGGGCTAT
GTTGAGCCGTCAGTTACAGAAGGCAACAAATCACACACGGATGGTTCAAAGCAGGCTGAAGAGGAGGACGCAGAC
CTCAAGGCGGCTATTGCTGCCTCCCTGGCAGATATGGAAGAGCAGAAGCAGCAGCATAACGCGGCGCTCAAACAG
CAGGCCTCTAATGCGCCAACGGGAAGCTCCATATCAGCAGGCTTCGTGCTGCCCAAGAATGATTATGAATTAACG
CCAGTCGAAGCCGAAAACATCAATCTCTTTTCAACGCTTGTTGACCGCCTGCAGACTCAGCCGCCGGGTACGATT
CTGCGCGAGCCTCAGATTCAAGAGCTCTACGATAGCATTGGTGGACTGCGGCCGAAACTGGCTCGCACGTACGGC
GAGACTATGAGCAAGCACGGTGAGTTAGTCAACGACGATATGGCTCGCACAGCCACTGACGTCGGGACGGTAAAG
ATACCCTTTTAGATCTTCATGCCAAATTATCAACAGTAGTCAGATACTACGACCGCATGCTCGAAGAACGATTAT
CAAAGGCCTATAGCCAGCAAAACTTTGGTGGCTTCAACCTGTCACCGCCACGCCAGTCGTCAGGGTCTTACCCAC
GGATGGCATCACAGGTACAGGGCAATGCTGCTGGTGCCGAGGGCTTTTATACTGGACAACAGCCTGACACGACCA
ACTATCAGCCAGTCCCAAGCCATCACTATCATCAATCACAACCGCTCGAGCATGCTTCATATAGACCGGGGCCGA
GCCAACAAGCACATGGCTGGCAGAGTCAGGATGCATATCAGCAGCGTCCTCCATCTGTCGCGACGCACCGCATGC
AAAGCCCGCAGCAGCCACCTGTCTCGCCGACTGCAGATCGGCAGAGCTCCTACTACACTAACCAGCCTCAGGCCG
TCCATTCTCCGGGCCCTTTGGCGCCTGGTGCTGCAGCAGATTCGGGCACGTCGCCTTATCCAAGCCTTCCAACGT
CAGTACATTATTCGTCGACGCCTGTTTCTGCCGTGTCGCAGTCAACACCTGGGCAGACGCAGGGACAACCTTTAC
AGTCTTCGCAGTCTTTATATACCGCACAGCCTTCTCAGCCACCGTATTTTGCGCAAGCCTCTCAAACATCGTATC
ACGCACCGTCTGCTCAATCATGTCTTCCCGCACAACCCTCTCAGCCTGTGCAACAGGCACCGTCGATTCAGAGTC
AACAAGAAACTTACCGGAGACAGTCTGCGTCATATAATGTGGCGAGCCCGCAAGTTAATACGCAGACTGTCAAGA
TGCAGCCACCGTGGGCATACATGGGCTACAACCAAGACGCGTTCCCATCGGTCCCGGAGGATGAACCAGTCAAGA
AACCGGTGGCAGAAGAGGCTCTTATTGAGCTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail