Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|934
Gene name
LocationContig_12:230760..232231
Strand+
Gene length (bp)1471
Transcript length (bp)1275
Coding sequence length (bp)1275
Protein length (aa) 425

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04146 YTH YT521-B-like domain 1.1E-21 206 282
PF04146 YTH YT521-B-like domain 9.4E-11 287 341

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0DA50|C3H45_ORYSJ Zinc finger CCCH domain-containing protein 45 OS=Oryza sativa subsp. japonica GN=Os06g0677700 PE=3 SV=1 198 328 1.0E-20
sp|A9LNK9|CPSF_ARATH 30-kDa cleavage and polyadenylation specificity factor 30 OS=Arabidopsis thaliana GN=CPSF30 PE=1 SV=1 206 341 2.0E-20
sp|Q9QY02|YTDC1_RAT YTH domain-containing protein 1 OS=Rattus norvegicus GN=Ythdc1 PE=1 SV=2 203 341 1.0E-19
sp|Q96MU7|YTDC1_HUMAN YTH domain-containing protein 1 OS=Homo sapiens GN=YTHDC1 PE=1 SV=3 203 341 1.0E-19
sp|E9Q5K9|YTDC1_MOUSE YTH domain-containing protein 1 OS=Mus musculus GN=Ythdc1 PE=1 SV=2 203 341 2.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0DA50|C3H45_ORYSJ Zinc finger CCCH domain-containing protein 45 OS=Oryza sativa subsp. japonica GN=Os06g0677700 PE=3 SV=1 198 328 1.0E-20
sp|A9LNK9|CPSF_ARATH 30-kDa cleavage and polyadenylation specificity factor 30 OS=Arabidopsis thaliana GN=CPSF30 PE=1 SV=1 206 341 2.0E-20
sp|Q9QY02|YTDC1_RAT YTH domain-containing protein 1 OS=Rattus norvegicus GN=Ythdc1 PE=1 SV=2 203 341 1.0E-19
sp|Q96MU7|YTDC1_HUMAN YTH domain-containing protein 1 OS=Homo sapiens GN=YTHDC1 PE=1 SV=3 203 341 1.0E-19
sp|E9Q5K9|YTDC1_MOUSE YTH domain-containing protein 1 OS=Mus musculus GN=Ythdc1 PE=1 SV=2 203 341 2.0E-19
sp|Q5R746|YTDC2_PONAB YTH domain-containing protein 2 OS=Pongo abelii GN=YTHDC2 PE=2 SV=1 207 340 1.0E-16
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 207 340 7.0E-16
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 207 328 2.0E-15
sp|Q9BYJ9|YTHD1_HUMAN YTH domain-containing family protein 1 OS=Homo sapiens GN=YTHDF1 PE=1 SV=1 203 342 4.0E-09
sp|P59326|YTHD1_MOUSE YTH domain-containing family protein 1 OS=Mus musculus GN=Ythdf1 PE=1 SV=1 203 342 8.0E-09
sp|Q8BYK6|YTHD3_MOUSE YTH domain-containing family protein 3 OS=Mus musculus GN=Ythdf3 PE=1 SV=2 203 342 2.0E-08
sp|Q5RFL8|YTHD3_PONAB YTH domain-containing family protein 3 OS=Pongo abelii GN=YTHDF3 PE=2 SV=1 203 342 2.0E-08
sp|Q7Z739|YTHD3_HUMAN YTH domain-containing family protein 3 OS=Homo sapiens GN=YTHDF3 PE=1 SV=1 203 342 2.0E-08
sp|Q0VCZ3|YTHD2_BOVIN YTH domain-containing family protein 2 OS=Bos taurus GN=YTHDF2 PE=2 SV=1 203 342 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|934
MYPSSPADADANVAPNAAKANDAAVTADNIRTSLLNKLFKVDPDIQLWLKYSGYFNLARREFTLDKLRKLEALED
ERSELLLELGTPVSAVAAHKDEAIISVATKLPNMPSVPAAGDKLKQAEDGAPSVIPCKRSAVPEPFPAAPRSPPP
TRQSAANVPLTASSSSAPNSTCVTPQVATSTVPQVAPVASTTSPSTSQGPARLKDSRFFLVKCSNTANIYMSQRD
GMWVTQAKNEALFAKAFKECESVILFFSINKSRYFQGFARMTSLPDAKLEKPDWIKRINLTAVTEPFTVEWMNQS
DTSFDDVGDLRNSLNDYRSVVVGRDGQEYPVECARKMMAIMSQTTQKQPPVLRPIVAKSNAKHSYIWRSPTKAAP
KSLKADRGDPVDRADRLNWRPRPSESSSSDDMQREGTNPPNLIDFQGQL*
Coding >OphauB2|934
ATGTATCCCTCTAGCCCAGCTGATGCCGACGCAAATGTTGCCCCCAATGCTGCCAAGGCCAACGATGCAGCAGTT
ACAGCCGACAACATCAGAACCAGTCTCCTCAACAAGCTTTTCAAGGTGGATCCCGATATTCAACTATGGCTCAAA
TACTCGGGATACTTCAACTTGGCCAGGCGCGAGTTTACTCTCGATAAACTACGCAAACTTGAGGCTCTCGAAGAT
GAGCGCTCCGAGCTTCTTCTTGAACTTGGAACCCCTGTCAGCGCCGTCGCTGCCCATAAAGATGAGGCAATCATT
TCTGTGGCAACCAAGCTTCCCAACATGCCAAGCGTACCTGCCGCGGGGGACAAGTTGAAGCAAGCAGAAGATGGC
GCACCTTCTGTTATACCTTGCAAACGATCTGCTGTCCCGGAGCCATTTCCCGCTGCTCCTCGTTCTCCACCGCCT
ACTCGTCAATCTGCTGCTAACGTCCCTCTGACAGCATCATCTTCGAGTGCTCCAAACAGCACTTGTGTAACCCCT
CAAGTAGCTACCTCTACGGTCCCTCAGGTAGCTCCTGTAGCCAGCACCACCTCTCCATCTACTTCTCAGGGACCA
GCCCGTCTTAAAGATTCTCGCTTCTTTCTAGTCAAATGTTCCAACACGGCAAACATCTACATGTCCCAGAGAGAC
GGCATGTGGGTTACACAGGCCAAGAACGAAGCACTGTTTGCAAAGGCTTTTAAGGAATGTGAAAGCGTCATACTG
TTCTTCTCTATCAATAAATCACGCTACTTTCAGGGATTTGCCCGCATGACATCACTTCCAGATGCCAAGCTCGAG
AAGCCTGACTGGATCAAACGTATCAATTTGACAGCTGTAACCGAGCCCTTTACAGTCGAGTGGATGAATCAGTCA
GACACGAGTTTTGACGACGTGGGCGACTTGCGCAATTCTCTCAACGACTACCGCTCCGTTGTTGTTGGCAGAGAC
GGTCAAGAATACCCTGTCGAATGCGCTCGAAAGATGATGGCCATCATGAGCCAGACGACCCAGAAGCAGCCTCCT
GTTCTAAGGCCCATCGTCGCAAAGAGCAACGCAAAACACTCATATATATGGAGATCGCCTACCAAGGCTGCACCT
AAGTCGCTCAAGGCCGACCGCGGTGATCCAGTTGATCGAGCGGACCGATTAAACTGGCGCCCCCGGCCGAGCGAG
TCGTCCAGCTCGGATGACATGCAGCGCGAGGGCACAAACCCGCCGAATCTCATTGACTTTCAGGGTCAGTTGTAG
Transcript >OphauB2|934
ATGTATCCCTCTAGCCCAGCTGATGCCGACGCAAATGTTGCCCCCAATGCTGCCAAGGCCAACGATGCAGCAGTT
ACAGCCGACAACATCAGAACCAGTCTCCTCAACAAGCTTTTCAAGGTGGATCCCGATATTCAACTATGGCTCAAA
TACTCGGGATACTTCAACTTGGCCAGGCGCGAGTTTACTCTCGATAAACTACGCAAACTTGAGGCTCTCGAAGAT
GAGCGCTCCGAGCTTCTTCTTGAACTTGGAACCCCTGTCAGCGCCGTCGCTGCCCATAAAGATGAGGCAATCATT
TCTGTGGCAACCAAGCTTCCCAACATGCCAAGCGTACCTGCCGCGGGGGACAAGTTGAAGCAAGCAGAAGATGGC
GCACCTTCTGTTATACCTTGCAAACGATCTGCTGTCCCGGAGCCATTTCCCGCTGCTCCTCGTTCTCCACCGCCT
ACTCGTCAATCTGCTGCTAACGTCCCTCTGACAGCATCATCTTCGAGTGCTCCAAACAGCACTTGTGTAACCCCT
CAAGTAGCTACCTCTACGGTCCCTCAGGTAGCTCCTGTAGCCAGCACCACCTCTCCATCTACTTCTCAGGGACCA
GCCCGTCTTAAAGATTCTCGCTTCTTTCTAGTCAAATGTTCCAACACGGCAAACATCTACATGTCCCAGAGAGAC
GGCATGTGGGTTACACAGGCCAAGAACGAAGCACTGTTTGCAAAGGCTTTTAAGGAATGTGAAAGCGTCATACTG
TTCTTCTCTATCAATAAATCACGCTACTTTCAGGGATTTGCCCGCATGACATCACTTCCAGATGCCAAGCTCGAG
AAGCCTGACTGGATCAAACGTATCAATTTGACAGCTGTAACCGAGCCCTTTACAGTCGAGTGGATGAATCAGTCA
GACACGAGTTTTGACGACGTGGGCGACTTGCGCAATTCTCTCAACGACTACCGCTCCGTTGTTGTTGGCAGAGAC
GGTCAAGAATACCCTGTCGAATGCGCTCGAAAGATGATGGCCATCATGAGCCAGACGACCCAGAAGCAGCCTCCT
GTTCTAAGGCCCATCGTCGCAAAGAGCAACGCAAAACACTCATATATATGGAGATCGCCTACCAAGGCTGCACCT
AAGTCGCTCAAGGCCGACCGCGGTGATCCAGTTGATCGAGCGGACCGATTAAACTGGCGCCCCCGGCCGAGCGAG
TCGTCCAGCTCGGATGACATGCAGCGCGAGGGCACAAACCCGCCGAATCTCATTGACTTTCAGGGTCAGTTGTAG
Gene >OphauB2|934
ATGTATCCCTCTAGCCCAGCTGATGCCGACGCAAATGTTGCCCCCAATGCTGCCAAGGCCAACGATGCAGCAGTT
ACAGCCGACAACATCAGAACCAGTCTCCTCAACAAGCTTTTCAAGGTGGATCCCGATATTCAACTATGGCTCAAA
TACTCGGGATACTTCAACTTGGCCAGGCGCGAGTTTACTCTCGATAAACTACGCAAACTTGAGGCTCTCGAAGAT
GAGCGCTCCGAGCTTCTTCTTGAACTTGGAACCCCTGTCAGCGCCGTCGCTGCCCATAAAGATGAGGCAATCATT
TCTGTGGCAACCAAGCTTCCCAACATGCCAAGCGTACCTGCCGCGGGGGACAAGTTGAAGCAAGCAGAAGATGGC
GCACCTTCTGTTATACCTTGCAAACGATCTGCTGTCCCGGAGCCATTTCCCGCTGCTCCTCGTTCTCCACCGCCT
ACTCGTCAATCTGCTGCTAACGTCCCTCTGACAGCATCATCTTCGAGTGCTCCAAACAGCACTTGTGTAACCCCT
CAAGTAGCTACCTCTACGGTCCCTCAGGTAGCTCCTGTAGCCAGCACCACCTCTCCATCTACTTCTCAGGGACCA
GCCCGTCTTAAAGGTGATGTTTCGTGCCCTTCAATCAAGATGGTTTTCGGGTGCTCATCTGTATCAGATTCTCGC
TTCTTTCTAGTCAAATGTTCCAACACGGCAAACATCTACATGTCCCAGAGAGACGTAAGTCGCCTGAGATGCATC
TTACACTCACCGCCAAGGTCTGACTAGTGCTTTAGGGCATGTGGGTTACACAGGCCAAGAACGAAGCACTGTTTG
CAAAGGCTTTTAAGGAATGTGAAAGCGTCATACTGTTCTTCTCTATCAATAAATCACGCTACTTTCAGGGATTTG
TGAGTAGCCGTCGCCTTGACCTGGGACGCTTTGCAAACGAACCTTTTGTGGAAATGTATAGCTATGACTGACGCA
TCGTATATAGGCCCGCATGACATCACTTCCAGATGCCAAGCTCGAGAAGCCTGACTGGATCAAACGTATCAATTT
GACAGCTGTAACCGAGCCCTTTACAGTCGAGTGGATGAATCAGTCAGACACGAGTTTTGACGACGTGGGCGACTT
GCGCAATTCTCTCAACGACTACCGCTCCGTTGTTGTTGGCAGAGACGGTCAAGAATACCCTGTCGAATGCGCTCG
AAAGATGATGGCCATCATGAGCCAGACGACCCAGAAGCAGCCTCCTGTTCTAAGGCCCATCGTCGCAAAGAGCAA
CGCAAAACACTCATATATATGGAGATCGCCTACCAAGGCTGCACCTAAGTCGCTCAAGGCCGACCGCGGTGATCC
AGTTGATCGAGCGGACCGATTAAACTGGCGCCCCCGGCCGAGCGAGTCGTCCAGCTCGGATGACATGCAGCGCGA
GGGCACAAACCCGCCGAATCTCATTGACTTTCAGGGTCAGTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail