Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|926
Gene name
LocationContig_12:216510..217884
Strand+
Gene length (bp)1374
Transcript length (bp)1314
Coding sequence length (bp)1314
Protein length (aa) 438

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12706 Lactamase_B_2 Beta-lactamase superfamily domain 1.6E-22 143 300
PF12706 Lactamase_B_2 Beta-lactamase superfamily domain 7.6E-08 327 394
PF13483 Lactamase_B_3 Beta-lactamase superfamily domain 9.0E-10 127 300

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6IQ20|NAPEP_HUMAN N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D OS=Homo sapiens GN=NAPEPLD PE=1 SV=2 7 435 6.0E-64
sp|Q769K2|NAPEP_RAT N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D OS=Rattus norvegicus GN=Napepld PE=1 SV=1 61 435 4.0E-62
sp|Q5RCU3|NAPEP_PONAB N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D OS=Pongo abelii GN=NAPEPLD PE=2 SV=1 7 435 9.0E-62
sp|Q8BH82|NAPEP_MOUSE N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D OS=Mus musculus GN=Napepld PE=1 SV=1 61 435 2.0E-61
sp|Q58CN9|NAPEP_BOVIN N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D OS=Bos taurus GN=NAPEPLD PE=2 SV=1 61 435 3.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6IQ20|NAPEP_HUMAN N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D OS=Homo sapiens GN=NAPEPLD PE=1 SV=2 7 435 6.0E-64
sp|Q769K2|NAPEP_RAT N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D OS=Rattus norvegicus GN=Napepld PE=1 SV=1 61 435 4.0E-62
sp|Q5RCU3|NAPEP_PONAB N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D OS=Pongo abelii GN=NAPEPLD PE=2 SV=1 7 435 9.0E-62
sp|Q8BH82|NAPEP_MOUSE N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D OS=Mus musculus GN=Napepld PE=1 SV=1 61 435 2.0E-61
sp|Q58CN9|NAPEP_BOVIN N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D OS=Bos taurus GN=NAPEPLD PE=2 SV=1 61 435 3.0E-59
sp|P64760|Y930_MYCBO Uncharacterized protein Mb0930 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0930 PE=3 SV=1 82 416 2.0E-43
sp|P9WKP3|Y906_MYCTU Uncharacterized protein Rv0906 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0906 PE=1 SV=1 82 416 2.0E-43
sp|P9WKP2|Y906_MYCTO Uncharacterized protein MT0929 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0929 PE=3 SV=1 82 416 2.0E-43
sp|Q02883|FMP30_YEAST N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMP30 PE=1 SV=1 127 420 2.0E-30
sp|Q1IL12|Y3437_KORVE UPF0173 metal-dependent hydrolase Acid345_3437 OS=Koribacter versatilis (strain Ellin345) GN=Acid345_3437 PE=3 SV=1 124 230 6.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|926
MAWECGSSQTPSCAGHGEQRASSSSWDCWLESATSKSSVTRIAGRSNLPAEAASNPHHIVKGGRVRGFRNPYPSY
SNPIGIRSAMRNIVWPLVRGRIKRPDTSSPGIDVVKPEWLASRRGSDKLRATWLGHACYYVEFPSGLRVLFDPVF
ERHCSPWAMLGPTRYTPAPCSLDDVPIVDAIVISHSHYDHLSHTSVVELQRRHPQAQFLVGLGLEEWFRQCGIDK
VTELDWWEEAELRVEVEVEVRGSPAKTRCLEARIECLPSQHTSGRGLLDRDTTLWCSWAVRSDERSVWFGGDTGY
RAIPPAAAASQSAASQSPASQSPDPDYYTPDLQDLPRCPQFAQIGRLRGPFDLGLVPIGAYSPRVAFSAMHASPA
DAVEIFRDTRCKRAMGIHWGTWALTLEQVGEPPELLKQALELRGMPATGVFDVCAIGESREF*
Coding >OphauB2|926
ATGGCGTGGGAATGTGGCTCGTCTCAGACGCCGTCTTGTGCAGGGCATGGTGAGCAGCGTGCAAGCTCGTCGTCA
TGGGACTGTTGGTTGGAATCAGCGACAAGCAAGTCGAGCGTGACGAGGATTGCCGGGCGGTCCAATCTGCCGGCC
GAGGCAGCGTCGAATCCACACCACATTGTCAAGGGCGGAAGGGTGAGGGGATTTCGAAACCCGTATCCGTCGTAC
TCGAATCCGATTGGCATCAGGTCGGCGATGCGCAACATTGTGTGGCCGCTGGTGCGAGGGCGCATCAAGAGACCC
GACACGTCGTCGCCGGGAATTGACGTGGTCAAGCCCGAGTGGCTGGCGAGCAGAAGGGGCTCGGACAAGCTTCGC
GCAACATGGCTGGGCCACGCGTGCTACTACGTCGAGTTCCCGTCGGGGCTGCGCGTCTTGTTCGACCCCGTCTTT
GAGCGGCACTGCTCGCCCTGGGCCATGCTGGGCCCGACGCGGTACACGCCGGCGCCGTGCTCGCTCGACGACGTG
CCCATTGTGGACGCCATTGTCATTAGCCACAGCCACTACGACCACTTGTCGCACACGTCGGTGGTGGAGCTGCAG
CGGCGCCACCCGCAGGCGCAGTTCTTGGTGGGCCTCGGCTTGGAAGAGTGGTTCCGCCAATGCGGCATCGACAAG
GTGACGGAGCTGGACTGGTGGGAGGAGGCGGAGCTGCGAGTCGAGGTCGAGGTCGAGGTGCGCGGCTCCCCGGCC
AAGACGCGCTGCCTCGAGGCCCGCATCGAGTGTCTGCCCAGCCAACACACGTCGGGGCGCGGGCTGCTGGACCGC
GACACCACGCTGTGGTGCTCGTGGGCTGTGCGCTCAGACGAGCGCTCCGTGTGGTTTGGCGGCGACACGGGCTAC
CGCGCCATTCCGCCCGCCGCTGCCGCCTCGCAGTCTGCCGCCTCGCAGTCTCCCGCCTCGCAGTCTCCCGACCCC
GACTACTACACCCCCGACCTGCAAGACTTGCCGCGCTGCCCCCAGTTTGCCCAGATTGGCCGGCTTCGCGGTCCC
TTTGACTTGGGGCTCGTGCCCATTGGCGCCTACAGCCCCCGCGTCGCCTTTTCTGCAATGCATGCCAGCCCGGCC
GACGCTGTTGAGATCTTCCGCGACACCCGCTGCAAGCGCGCCATGGGCATCCACTGGGGCACCTGGGCCTTGACC
CTCGAGCAAGTTGGCGAGCCACCAGAGCTGCTCAAGCAGGCCTTGGAGCTACGCGGCATGCCCGCCACCGGAGTC
TTTGACGTCTGCGCCATTGGCGAGAGTCGTGAGTTTTAG
Transcript >OphauB2|926
ATGGCGTGGGAATGTGGCTCGTCTCAGACGCCGTCTTGTGCAGGGCATGGTGAGCAGCGTGCAAGCTCGTCGTCA
TGGGACTGTTGGTTGGAATCAGCGACAAGCAAGTCGAGCGTGACGAGGATTGCCGGGCGGTCCAATCTGCCGGCC
GAGGCAGCGTCGAATCCACACCACATTGTCAAGGGCGGAAGGGTGAGGGGATTTCGAAACCCGTATCCGTCGTAC
TCGAATCCGATTGGCATCAGGTCGGCGATGCGCAACATTGTGTGGCCGCTGGTGCGAGGGCGCATCAAGAGACCC
GACACGTCGTCGCCGGGAATTGACGTGGTCAAGCCCGAGTGGCTGGCGAGCAGAAGGGGCTCGGACAAGCTTCGC
GCAACATGGCTGGGCCACGCGTGCTACTACGTCGAGTTCCCGTCGGGGCTGCGCGTCTTGTTCGACCCCGTCTTT
GAGCGGCACTGCTCGCCCTGGGCCATGCTGGGCCCGACGCGGTACACGCCGGCGCCGTGCTCGCTCGACGACGTG
CCCATTGTGGACGCCATTGTCATTAGCCACAGCCACTACGACCACTTGTCGCACACGTCGGTGGTGGAGCTGCAG
CGGCGCCACCCGCAGGCGCAGTTCTTGGTGGGCCTCGGCTTGGAAGAGTGGTTCCGCCAATGCGGCATCGACAAG
GTGACGGAGCTGGACTGGTGGGAGGAGGCGGAGCTGCGAGTCGAGGTCGAGGTCGAGGTGCGCGGCTCCCCGGCC
AAGACGCGCTGCCTCGAGGCCCGCATCGAGTGTCTGCCCAGCCAACACACGTCGGGGCGCGGGCTGCTGGACCGC
GACACCACGCTGTGGTGCTCGTGGGCTGTGCGCTCAGACGAGCGCTCCGTGTGGTTTGGCGGCGACACGGGCTAC
CGCGCCATTCCGCCCGCCGCTGCCGCCTCGCAGTCTGCCGCCTCGCAGTCTCCCGCCTCGCAGTCTCCCGACCCC
GACTACTACACCCCCGACCTGCAAGACTTGCCGCGCTGCCCCCAGTTTGCCCAGATTGGCCGGCTTCGCGGTCCC
TTTGACTTGGGGCTCGTGCCCATTGGCGCCTACAGCCCCCGCGTCGCCTTTTCTGCAATGCATGCCAGCCCGGCC
GACGCTGTTGAGATCTTCCGCGACACCCGCTGCAAGCGCGCCATGGGCATCCACTGGGGCACCTGGGCCTTGACC
CTCGAGCAAGTTGGCGAGCCACCAGAGCTGCTCAAGCAGGCCTTGGAGCTACGCGGCATGCCCGCCACCGGAGTC
TTTGACGTCTGCGCCATTGGCGAGAGTCGTGAGTTTTAG
Gene >OphauB2|926
ATGGCGTGGGAATGTGGCTCGTCTCAGACGCCGTCTTGTGCAGGGCATGGTGAGCAGCGTGCAAGCTCGTCGTCA
TGGGACTGTTGGTTGGAATCAGCGACAAGCAAGTCGAGCGTGACGAGGATTGCCGGGCGGTCCAATCTGCCGGCC
GAGGCAGCGTCGAATCCACACCACATTGTCAAGGGCGGAAGGGTGAGGGGATTTCGAAACCCGTATCCGTCGTAC
TCGAATCCGATTGGCATCAGGTCGGCGATGCGCAACATTGTGTGGTGAGCTGGACAGGCGTCTTGACAGGTGGGC
GTGGGGTTGCTGATGGGGCGGGACAATAGGCCGCTGGTGCGAGGGCGCATCAAGAGACCCGACACGTCGTCGCCG
GGAATTGACGTGGTCAAGCCCGAGTGGCTGGCGAGCAGAAGGGGCTCGGACAAGCTTCGCGCAACATGGCTGGGC
CACGCGTGCTACTACGTCGAGTTCCCGTCGGGGCTGCGCGTCTTGTTCGACCCCGTCTTTGAGCGGCACTGCTCG
CCCTGGGCCATGCTGGGCCCGACGCGGTACACGCCGGCGCCGTGCTCGCTCGACGACGTGCCCATTGTGGACGCC
ATTGTCATTAGCCACAGCCACTACGACCACTTGTCGCACACGTCGGTGGTGGAGCTGCAGCGGCGCCACCCGCAG
GCGCAGTTCTTGGTGGGCCTCGGCTTGGAAGAGTGGTTCCGCCAATGCGGCATCGACAAGGTGACGGAGCTGGAC
TGGTGGGAGGAGGCGGAGCTGCGAGTCGAGGTCGAGGTCGAGGTGCGCGGCTCCCCGGCCAAGACGCGCTGCCTC
GAGGCCCGCATCGAGTGTCTGCCCAGCCAACACACGTCGGGGCGCGGGCTGCTGGACCGCGACACCACGCTGTGG
TGCTCGTGGGCTGTGCGCTCAGACGAGCGCTCCGTGTGGTTTGGCGGCGACACGGGCTACCGCGCCATTCCGCCC
GCCGCTGCCGCCTCGCAGTCTGCCGCCTCGCAGTCTCCCGCCTCGCAGTCTCCCGACCCCGACTACTACACCCCC
GACCTGCAAGACTTGCCGCGCTGCCCCCAGTTTGCCCAGATTGGCCGGCTTCGCGGTCCCTTTGACTTGGGGCTC
GTGCCCATTGGCGCCTACAGCCCCCGCGTCGCCTTTTCTGCAATGCATGCCAGCCCGGCCGACGCTGTTGAGATC
TTCCGCGACACCCGCTGCAAGCGCGCCATGGGCATCCACTGGGGCACCTGGGCCTTGACCCTCGAGCAAGTTGGC
GAGCCACCAGAGCTGCTCAAGCAGGCCTTGGAGCTACGCGGCATGCCCGCCACCGGAGTCTTTGACGTCTGCGCC
ATTGGCGAGAGTCGTGAGTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail