Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|912
Gene name
LocationContig_12:181315..185011
Strand-
Gene length (bp)3696
Transcript length (bp)3453
Coding sequence length (bp)3453
Protein length (aa) 1151

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.1E-61 230 479
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 4.6E-36 229 480
PF02149 KA1 Kinase associated domain 1 1.4E-21 1107 1150

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P22987|KIN1_SCHPO Protein kinase kin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kin1 PE=1 SV=3 225 1150 1.0E-166
sp|P13185|KIN1_YEAST Serine/threonine protein kinase KIN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN1 PE=1 SV=3 184 615 3.0E-107
sp|O59697|PPK25_SCHPO Serine/threonine-protein kinase ppk25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk25 PE=1 SV=1 223 482 9.0E-81
sp|Q8SW31|KIN1_ENCCU Probable serine/threonine-protein kinase KIN1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=KIN1 PE=3 SV=1 225 497 8.0E-72
sp|B7XHR6|KIN1_ENTBH Probable serine/threonine-protein kinase KIN1 homolog OS=Enterocytozoon bieneusi (strain H348) GN=KIN1 PE=3 SV=1 225 497 2.0E-71
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P22987|KIN1_SCHPO Protein kinase kin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kin1 PE=1 SV=3 225 1150 1.0E-166
sp|P13185|KIN1_YEAST Serine/threonine protein kinase KIN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN1 PE=1 SV=3 184 615 3.0E-107
sp|O59697|PPK25_SCHPO Serine/threonine-protein kinase ppk25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk25 PE=1 SV=1 223 482 9.0E-81
sp|Q8SW31|KIN1_ENCCU Probable serine/threonine-protein kinase KIN1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=KIN1 PE=3 SV=1 225 497 8.0E-72
sp|B7XHR6|KIN1_ENTBH Probable serine/threonine-protein kinase KIN1 homolog OS=Enterocytozoon bieneusi (strain H348) GN=KIN1 PE=3 SV=1 225 497 2.0E-71
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 225 540 6.0E-67
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 225 540 1.0E-66
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 225 540 1.0E-66
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 225 540 2.0E-66
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 123 506 2.0E-66
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 225 540 2.0E-66
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 199 540 5.0E-66
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 225 540 8.0E-66
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 201 540 1.0E-65
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 197 479 2.0E-65
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 225 540 2.0E-65
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 225 540 4.0E-65
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 195 540 6.0E-65
sp|Q54DF2|MRKA_DICDI Probable serine/threonine-protein kinase MARK-A OS=Dictyostelium discoideum GN=mrkA PE=3 SV=1 225 480 1.0E-63
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 225 540 4.0E-63
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 225 540 5.0E-63
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 225 531 2.0E-62
sp|Q8BRK8|AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus GN=Prkaa2 PE=1 SV=3 222 506 4.0E-62
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 229 479 4.0E-62
sp|P54646|AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens GN=PRKAA2 PE=1 SV=2 222 506 4.0E-62
sp|Q09137|AAPK2_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus GN=Prkaa2 PE=1 SV=1 222 506 4.0E-62
sp|Q5RD00|AAPK2_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Pongo abelii GN=PRKAA2 PE=2 SV=1 222 506 4.0E-62
sp|O94168|SNF1_CANTR Carbon catabolite-derepressing protein kinase OS=Candida tropicalis GN=SNF1 PE=3 SV=1 225 492 4.0E-62
sp|Q28948|AAPK2_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Sus scrofa GN=PRKAA2 PE=2 SV=2 222 506 5.0E-62
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 225 492 3.0E-61
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 220 522 3.0E-61
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 222 479 6.0E-61
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 225 479 6.0E-61
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 222 479 7.0E-61
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 225 522 1.0E-60
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 222 479 3.0E-60
sp|O74536|SNF1_SCHPO SNF1-like protein kinase ssp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp2 PE=1 SV=1 225 536 5.0E-60
sp|P06782|SNF1_YEAST Carbon catabolite-derepressing protein kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF1 PE=1 SV=1 225 492 4.0E-59
sp|Q00372|SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF1 PE=3 SV=2 225 479 7.0E-59
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 225 482 1.0E-58
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 229 510 2.0E-58
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 229 510 4.0E-58
sp|Q9R1U5|SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus GN=Sik1 PE=1 SV=1 221 479 5.0E-58
sp|Q54YF2|AMPKA_DICDI 5'-AMP-activated serine/threonine-protein kinase catalytic subunit alpha OS=Dictyostelium discoideum GN=snfA PE=2 SV=1 225 479 6.0E-58
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 221 479 6.0E-58
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 231 558 2.0E-57
sp|Q9H0K1|SIK2_HUMAN Serine/threonine-protein kinase SIK2 OS=Homo sapiens GN=SIK2 PE=1 SV=1 221 513 2.0E-57
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 221 479 3.0E-57
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 229 512 4.0E-57
sp|Q8CFH6|SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus GN=Sik2 PE=1 SV=1 221 513 5.0E-57
sp|Q9IA88|SIK2_CHICK Serine/threonine-protein kinase SIK2 OS=Gallus gallus GN=SIK2 PE=2 SV=1 221 479 7.0E-57
sp|Q8IWQ3|BRSK2_HUMAN Serine/threonine-protein kinase BRSK2 OS=Homo sapiens GN=BRSK2 PE=1 SV=3 200 540 2.0E-56
sp|Q02723|RKIN1_SECCE Carbon catabolite-derepressing protein kinase OS=Secale cereale GN=RKIN1 PE=2 SV=1 227 479 2.0E-56
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 225 493 2.0E-56
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 225 493 3.0E-56
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 231 484 3.0E-56
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 225 493 4.0E-56
sp|Q69Z98|BRSK2_MOUSE Serine/threonine-protein kinase BRSK2 OS=Mus musculus GN=Brsk2 PE=1 SV=2 225 540 4.0E-56
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 229 512 4.0E-56
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 224 492 6.0E-56
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 225 486 9.0E-56
sp|D3ZML2|BRSK2_RAT Serine/threonine-protein kinase BRSK2 OS=Rattus norvegicus GN=Brsk2 PE=1 SV=1 225 540 1.0E-55
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 222 486 3.0E-55
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 231 483 4.0E-55
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 231 483 4.0E-55
sp|Q5REX1|SIK2_PONAB Serine/threonine-protein kinase SIK2 OS=Pongo abelii GN=SIK2 PE=2 SV=1 221 513 8.0E-55
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 225 486 1.0E-54
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 226 553 2.0E-54
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 216 486 2.0E-54
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 217 486 3.0E-54
sp|P34244|HSL1_YEAST Probable serine/threonine-protein kinase HSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSL1 PE=1 SV=2 190 491 3.0E-54
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 226 553 4.0E-54
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 216 486 7.0E-54
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 231 483 1.0E-53
sp|Q09136|AAPK1_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragments) OS=Sus scrofa GN=PRKAA1 PE=1 SV=2 222 479 2.0E-53
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 225 525 5.0E-53
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 176 481 7.0E-53
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 225 483 3.0E-52
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 225 483 5.0E-52
sp|P45894|AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans GN=aak-1 PE=2 SV=2 225 479 1.0E-51
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 223 483 2.0E-51
sp|Q54MV2|MRKB_DICDI Probable serine/threonine-protein kinase MARK-B OS=Dictyostelium discoideum GN=mrkB PE=3 SV=1 195 488 2.0E-51
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 213 502 2.0E-51
sp|O13945|PPK9_SCHPO Protein kinase domain-containing protein ppk9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk9 PE=3 SV=1 222 494 2.0E-51
sp|Q5JLD8|CIPK8_ORYSJ CBL-interacting protein kinase 8 OS=Oryza sativa subsp. japonica GN=CIPK8 PE=2 SV=1 225 506 3.0E-51
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 225 492 5.0E-51
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 226 503 6.0E-51
sp|Q9QYZ4|SMOK1_MOUSE Sperm motility kinase 1 OS=Mus musculus GN=Smok1 PE=2 SV=1 231 488 6.0E-51
sp|Q9QYZ6|SMK2A_MOUSE Sperm motility kinase 2A OS=Mus musculus GN=Smok2a PE=2 SV=1 228 514 1.0E-50
sp|Q8RWC9|CIPK1_ARATH CBL-interacting serine/threonine-protein kinase 1 OS=Arabidopsis thaliana GN=CIPK1 PE=1 SV=2 225 475 1.0E-50
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 225 482 1.0E-50
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 205 488 2.0E-50
sp|A8WRV1|KIN29_CAEBR Serine/threonine-protein kinase kin-29 OS=Caenorhabditis briggsae GN=kin-29 PE=3 SV=2 225 479 2.0E-50
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 222 486 2.0E-50
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 225 483 2.0E-50
sp|Q6ERS0|CIPKR_ORYSJ Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1 225 481 3.0E-50
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 209 514 4.0E-50
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 216 493 4.0E-50
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 197 483 5.0E-50
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 226 483 5.0E-50
sp|Q21017|KIN29_CAEEL Serine/threonine-protein kinase kin-29 OS=Caenorhabditis elegans GN=kin-29 PE=1 SV=2 225 479 6.0E-50
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 222 491 6.0E-50
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 225 514 8.0E-50
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 226 484 1.0E-49
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 225 483 2.0E-49
sp|Q9SUL7|CIPK4_ARATH CBL-interacting serine/threonine-protein kinase 4 OS=Arabidopsis thaliana GN=CIPK4 PE=1 SV=1 225 481 3.0E-49
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 229 483 3.0E-49
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 221 481 4.0E-49
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 225 486 4.0E-49
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 224 479 1.0E-48
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 225 524 2.0E-48
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 199 481 4.0E-48
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 222 486 4.0E-48
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 224 479 4.0E-48
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 224 479 5.0E-48
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 229 484 1.0E-47
sp|Q94C40|CIPKH_ARATH CBL-interacting serine/threonine-protein kinase 17 OS=Arabidopsis thaliana GN=CIPK17 PE=1 SV=1 225 490 4.0E-47
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 225 494 6.0E-47
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 226 490 6.0E-47
sp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 24 OS=Oryza sativa subsp. japonica GN=CIPK24 PE=1 SV=1 225 483 7.0E-47
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 221 483 1.0E-46
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 225 483 2.0E-46
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 225 483 4.0E-46
sp|O80902|CIPKM_ARATH CBL-interacting serine/threonine-protein kinase 22 OS=Arabidopsis thaliana GN=CIPK22 PE=2 SV=1 225 484 7.0E-46
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 229 484 1.0E-45
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 231 526 3.0E-45
sp|Q9XIW0|CIPK7_ARATH CBL-interacting serine/threonine-protein kinase 7 OS=Arabidopsis thaliana GN=CIPK7 PE=1 SV=1 204 483 4.0E-45
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 229 483 8.0E-45
sp|Q9HFF4|PPK1_SCHPO Serine/threonine-protein kinase ppk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk1 PE=1 SV=2 183 479 1.0E-44
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 225 483 2.0E-44
sp|Q6Z9F4|CIPK6_ORYSJ CBL-interacting protein kinase 6 OS=Oryza sativa subsp. japonica GN=CIPK6 PE=2 SV=1 225 481 2.0E-44
sp|P07334|CDR1_SCHPO Mitosis inducer protein kinase cdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdr1 PE=1 SV=3 225 479 9.0E-44
sp|A0JLX3|SMK4A_MOUSE Sperm motility kinase 4A OS=Mus musculus GN=Smok4a PE=2 SV=2 231 514 4.0E-43
sp|P87050|CDR2_SCHPO Mitosis inducer protein kinase cdr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdr2 PE=1 SV=1 222 480 1.0E-42
sp|Q03002|FRK1_YEAST Fatty acyl-CoA synthetase and RNA processing-associated kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRK1 PE=1 SV=1 197 479 2.0E-42
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 225 485 3.0E-42
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 225 486 5.0E-42
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 225 485 7.0E-42
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 232 540 7.0E-42
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 225 485 8.0E-42
sp|Q60EY8|CIPKK_ORYSJ CBL-interacting protein kinase 20 OS=Oryza sativa subsp. japonica GN=CIPK20 PE=2 SV=1 229 482 9.0E-42
sp|O65554|CIPK6_ARATH CBL-interacting serine/threonine-protein kinase 6 OS=Arabidopsis thaliana GN=CIPK6 PE=1 SV=1 225 481 1.0E-41
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 229 489 3.0E-41
sp|Q2QYM3|CIPKE_ORYSJ CBL-interacting protein kinase 14 OS=Oryza sativa subsp. japonica GN=CIPK14 PE=2 SV=1 229 509 3.0E-41
sp|Q9LZW4|CIPKE_ARATH CBL-interacting serine/threonine-protein kinase 14 OS=Arabidopsis thaliana GN=CIPK14 PE=1 SV=1 225 484 3.0E-41
sp|Q01919|KIN4_YEAST Serine/threonine-protein kinase KIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN4 PE=1 SV=1 211 479 3.0E-41
sp|Q61241|TSSK1_MOUSE Testis-specific serine/threonine-protein kinase 1 OS=Mus musculus GN=Tssk1b PE=1 SV=2 227 479 5.0E-41
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 232 545 5.0E-41
sp|Q96PF2|TSSK2_HUMAN Testis-specific serine/threonine-protein kinase 2 OS=Homo sapiens GN=TSSK2 PE=1 SV=2 227 479 5.0E-41
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 225 496 6.0E-41
sp|Q7XIW5|CIPKT_ORYSJ CBL-interacting protein kinase 29 OS=Oryza sativa subsp. japonica GN=CIPK29 PE=2 SV=1 225 479 1.0E-40
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 225 481 2.0E-40
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 225 509 2.0E-40
sp|Q3SZW1|TSSK1_BOVIN Testis-specific serine/threonine-protein kinase 1 OS=Bos taurus GN=TSSK1B PE=2 SV=1 227 479 3.0E-40
sp|Q5Z6X0|CIPKP_ORYSJ CBL-interacting protein kinase 25 OS=Oryza sativa subsp. japonica GN=CIPK25 PE=2 SV=1 226 484 3.0E-40
sp|B1WAS2|HUNK_XENTR Hormonally up-regulated neu tumor-associated kinase homolog OS=Xenopus tropicalis GN=hunk PE=2 SV=1 225 494 4.0E-40
sp|A2KF29|SMKTR_MOUSE Sperm motility kinase Tcr mutant form OS=Mus musculus GN=Smoktcr PE=2 SV=1 231 540 4.0E-40
sp|O54863|TSSK2_MOUSE Testis-specific serine/threonine-protein kinase 2 OS=Mus musculus GN=Tssk2 PE=1 SV=2 227 479 4.0E-40
sp|Q8IY84|NIM1_HUMAN Serine/threonine-protein kinase NIM1 OS=Homo sapiens GN=NIM1K PE=1 SV=1 205 479 8.0E-40
sp|Q5XHI9|HUNKA_XENLA Hormonally up-regulated neu tumor-associated kinase homolog A OS=Xenopus laevis GN=hunk-a PE=2 SV=1 225 494 9.0E-40
sp|Q8BHI9|NIM1_MOUSE Serine/threonine-protein kinase NIM1 OS=Mus musculus GN=Nim1k PE=2 SV=1 205 479 2.0E-39
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 210 480 2.0E-39
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 226 466 2.0E-39
sp|Q9SSF8|CDPKU_ARATH Calcium-dependent protein kinase 30 OS=Arabidopsis thaliana GN=CPK30 PE=1 SV=1 224 486 3.0E-39
sp|Q8S9D1|PP395_ARATH Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1 225 483 4.0E-39
sp|Q54VU4|Y8013_DICDI Probable serine/threonine-protein kinase DDB_G0280133 OS=Dictyostelium discoideum GN=DDB_G0280133 PE=3 SV=1 221 481 4.0E-39
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 233 481 4.0E-39
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 233 481 4.0E-39
sp|Q8C0V7|SMKW_MOUSE Putative sperm motility kinase W OS=Mus musculus GN=Stk-ps2 PE=5 SV=2 232 540 6.0E-39
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 229 481 9.0E-39
sp|Q8C0N0|SMKZ_MOUSE Sperm motility kinase Z OS=Mus musculus GN=Gm4922 PE=2 SV=1 287 482 9.0E-39
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 233 481 9.0E-39
sp|Q9BXA7|TSSK1_HUMAN Testis-specific serine/threonine-protein kinase 1 OS=Homo sapiens GN=TSSK1B PE=1 SV=1 227 487 2.0E-38
sp|P34101|FHKC_DICDI Probable serine/threonine-protein kinase fhkC OS=Dictyostelium discoideum GN=fhkC PE=3 SV=2 187 480 2.0E-38
sp|O70150|KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus GN=Pnck PE=1 SV=1 233 480 5.0E-38
sp|Q9QYK9|KCC1B_MOUSE Calcium/calmodulin-dependent protein kinase type 1B OS=Mus musculus GN=Pnck PE=1 SV=1 233 480 6.0E-38
sp|Q6VZ17|HUNKB_XENLA Hormonally up-regulated neu tumor-associated kinase homolog B (Fragment) OS=Xenopus laevis GN=hunk-b PE=2 SV=1 286 509 6.0E-38
sp|Q9C562|CIPKA_ARATH CBL-interacting serine/threonine-protein kinase 10 OS=Arabidopsis thaliana GN=CIPK10 PE=1 SV=1 226 483 7.0E-38
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 229 481 1.0E-37
sp|Q7XQP4|SAPK7_ORYSJ Serine/threonine-protein kinase SAPK7 OS=Oryza sativa subsp. japonica GN=SAPK7 PE=2 SV=2 229 483 1.0E-37
sp|Q9Z265|CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus GN=Chek2 PE=1 SV=1 226 479 1.0E-37
sp|Q6P2M8|KCC1B_HUMAN Calcium/calmodulin-dependent protein kinase type 1B OS=Homo sapiens GN=PNCK PE=2 SV=2 233 480 1.0E-37
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 226 481 2.0E-37
sp|Q75GK4|CIPK7_ORYSJ CBL-interacting protein kinase 7 OS=Oryza sativa subsp. japonica GN=CIPK7 PE=2 SV=1 225 509 2.0E-37
sp|Q6ZI44|SAPK6_ORYSJ Serine/threonine-protein kinase SAPK6 OS=Oryza sativa subsp. japonica GN=SAPK6 PE=2 SV=1 226 483 2.0E-37
sp|Q9D2E1|TSSK3_MOUSE Testis-specific serine/threonine-protein kinase 3 OS=Mus musculus GN=Tssk3 PE=2 SV=1 224 479 3.0E-37
sp|Q9SIQ7|CDPKO_ARATH Calcium-dependent protein kinase 24 OS=Arabidopsis thaliana GN=CPK24 PE=2 SV=1 226 489 3.0E-37
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 229 486 3.0E-37
sp|Q9M9V8|CDPKA_ARATH Calcium-dependent protein kinase 10 OS=Arabidopsis thaliana GN=CPK10 PE=1 SV=1 224 486 4.0E-37
sp|Q3E9C0|CDPKY_ARATH Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1 227 486 5.0E-37
sp|P43292|SRK2G_ARATH Serine/threonine-protein kinase SRK2G OS=Arabidopsis thaliana GN=SRK2G PE=1 SV=2 226 483 6.0E-37
sp|Q5KQF5|CIPKM_ORYSJ CBL-interacting protein kinase 22 OS=Oryza sativa subsp. japonica GN=CIPK22 PE=2 SV=1 225 479 1.0E-36
sp|Q96PN8|TSSK3_HUMAN Testis-specific serine/threonine-protein kinase 3 OS=Homo sapiens GN=TSSK3 PE=1 SV=1 224 479 1.0E-36
sp|Q9M9E9|SRK2C_ARATH Serine/threonine-protein kinase SRK2C OS=Arabidopsis thaliana GN=SRK2C PE=1 SV=1 231 490 1.0E-36
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 232 480 1.0E-36
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 230 479 5.0E-36
sp|O96017|CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens GN=CHEK2 PE=1 SV=1 226 479 6.0E-36
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 227 479 7.0E-36
sp|Q9LYQ8|CIPK2_ARATH CBL-interacting serine/threonine-protein kinase 2 OS=Arabidopsis thaliana GN=CIPK2 PE=1 SV=1 229 483 7.0E-36
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 227 479 8.0E-36
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 227 479 8.0E-36
sp|Q5N942|SAPK4_ORYSJ Serine/threonine-protein kinase SAPK4 OS=Oryza sativa subsp. japonica GN=SAPK4 PE=2 SV=2 231 483 1.0E-35
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 231 479 2.0E-35
sp|Q54SJ5|MYLKC_DICDI Probable myosin light chain kinase DDB_G0282429 OS=Dictyostelium discoideum GN=DDB_G0282429 PE=3 SV=1 227 480 2.0E-35
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 220 486 2.0E-35
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 229 492 3.0E-35
sp|Q940H6|SRK2E_ARATH Serine/threonine-protein kinase SRK2E OS=Arabidopsis thaliana GN=SRK2E PE=1 SV=1 224 488 3.0E-35
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 218 481 3.0E-35
sp|P08414|KCC4_MOUSE Calcium/calmodulin-dependent protein kinase type IV OS=Mus musculus GN=Camk4 PE=1 SV=2 280 480 3.0E-35
sp|P28582|CDPK_DAUCA Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2 225 538 4.0E-35
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 231 479 4.0E-35
sp|P93759|CDPKE_ARATH Calcium-dependent protein kinase 14 OS=Arabidopsis thaliana GN=CPK14 PE=2 SV=1 226 484 4.0E-35
sp|Q75V57|SAPK9_ORYSJ Serine/threonine-protein kinase SAPK9 OS=Oryza sativa subsp. japonica GN=SAPK9 PE=2 SV=1 226 488 5.0E-35
sp|A2YNT8|SAPK2_ORYSI Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. indica GN=SAPK2 PE=2 SV=2 231 483 5.0E-35
sp|Q6NLQ6|CDPKW_ARATH Calcium-dependent protein kinase 32 OS=Arabidopsis thaliana GN=CPK32 PE=1 SV=1 226 486 5.0E-35
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 232 480 6.0E-35
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 225 480 7.0E-35
sp|Q75LR7|SAPK1_ORYSJ Serine/threonine-protein kinase SAPK1 OS=Oryza sativa subsp. japonica GN=SAPK1 PE=1 SV=1 231 483 7.0E-35
sp|Q8W4I7|CDPKD_ARATH Calcium-dependent protein kinase 13 OS=Arabidopsis thaliana GN=CPK13 PE=1 SV=2 181 486 7.0E-35
sp|Q0D4J7|SAPK2_ORYSJ Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. japonica GN=SAPK2 PE=1 SV=1 231 483 7.0E-35
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 229 486 7.0E-35
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 228 479 7.0E-35
sp|Q7XKA8|SAPK5_ORYSJ Serine/threonine-protein kinase SAPK5 OS=Oryza sativa subsp. japonica GN=SAPK5 PE=2 SV=1 231 483 9.0E-35
sp|Q9D411|TSSK4_MOUSE Testis-specific serine/threonine-protein kinase 4 OS=Mus musculus GN=Tssk4 PE=2 SV=1 229 503 1.0E-34
sp|Q9FFP9|SRK2H_ARATH Serine/threonine-protein kinase SRK2H OS=Arabidopsis thaliana GN=SRK2H PE=1 SV=1 226 483 1.0E-34
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 229 479 1.0E-34
sp|P43291|SRK2A_ARATH Serine/threonine-protein kinase SRK2A OS=Arabidopsis thaliana GN=SRK2A PE=1 SV=1 226 483 1.0E-34
sp|P0C5D6|SAPK3_ORYSJ Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. japonica GN=SAPK3 PE=1 SV=1 231 483 1.0E-34
sp|A2ZAB5|SAPK3_ORYSI Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. indica GN=SAPK3 PE=1 SV=2 231 483 1.0E-34
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 221 479 1.0E-34
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 229 486 2.0E-34
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 185 480 2.0E-34
sp|Q02066|AAIP_WHEAT Abscisic acid-inducible protein kinase (Fragment) OS=Triticum aestivum PE=2 SV=1 234 481 2.0E-34
sp|Q39016|CDPKB_ARATH Calcium-dependent protein kinase 11 OS=Arabidopsis thaliana GN=CPK11 PE=1 SV=2 216 480 2.0E-34
sp|Q38869|CDPK4_ARATH Calcium-dependent protein kinase 4 OS=Arabidopsis thaliana GN=CPK4 PE=1 SV=1 227 480 2.0E-34
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 229 479 3.0E-34
sp|Q9VKN7|AURKB_DROME Aurora kinase B OS=Drosophila melanogaster GN=ial PE=1 SV=1 229 483 3.0E-34
sp|Q3Y416|KKCC_CAEEL Calcium/calmodulin-dependent protein kinase kinase OS=Caenorhabditis elegans GN=ckk-1 PE=1 SV=2 213 481 3.0E-34
sp|P13234|KCC4_RAT Calcium/calmodulin-dependent protein kinase type IV OS=Rattus norvegicus GN=Camk4 PE=1 SV=3 280 480 3.0E-34
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 229 479 3.0E-34
sp|Q9C958|SRK2B_ARATH Serine/threonine-protein kinase SRK2B OS=Arabidopsis thaliana GN=SRK2B PE=1 SV=1 226 483 3.0E-34
sp|Q9URY1|PPK16_SCHPO Serine/threonine-protein kinase ppk16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk16 PE=1 SV=1 225 479 4.0E-34
sp|Q38870|CDPK2_ARATH Calcium-dependent protein kinase 2 OS=Arabidopsis thaliana GN=CPK2 PE=1 SV=1 229 513 4.0E-34
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 145 480 4.0E-34
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 229 479 6.0E-34
sp|Q42479|CDPK3_ARATH Calcium-dependent protein kinase 3 OS=Arabidopsis thaliana GN=CPK3 PE=1 SV=1 229 494 6.0E-34
sp|Q42396|CDPKC_ARATH Calcium-dependent protein kinase 12 OS=Arabidopsis thaliana GN=CPK12 PE=1 SV=1 215 480 6.0E-34
sp|P39009|DUN1_YEAST DNA damage response protein kinase DUN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUN1 PE=1 SV=1 226 479 6.0E-34
sp|Q91YS8|KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus GN=Camk1 PE=1 SV=1 233 479 8.0E-34
sp|O88831|KKCC2_RAT Calcium/calmodulin-dependent protein kinase kinase 2 OS=Rattus norvegicus GN=Camkk2 PE=1 SV=1 222 481 9.0E-34
sp|Q16566|KCC4_HUMAN Calcium/calmodulin-dependent protein kinase type IV OS=Homo sapiens GN=CAMK4 PE=1 SV=1 280 480 9.0E-34
sp|B4IT27|DCLK_DROYA Serine/threonine-protein kinase GE16371 OS=Drosophila yakuba GN=GE16371 PE=3 SV=2 227 478 9.0E-34
sp|Q63450|KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus GN=Camk1 PE=1 SV=2 233 479 1.0E-33
sp|Q14012|KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens GN=CAMK1 PE=1 SV=1 233 479 1.0E-33
sp|Q75H77|SAPKA_ORYSJ Serine/threonine-protein kinase SAPK10 OS=Oryza sativa subsp. japonica GN=SAPK10 PE=2 SV=1 226 488 1.0E-33
sp|B4NSS9|DCLK_DROSI Serine/threonine-protein kinase GD17699 OS=Drosophila simulans GN=GD17699 PE=3 SV=1 227 478 1.0E-33
sp|Q8C078|KKCC2_MOUSE Calcium/calmodulin-dependent protein kinase kinase 2 OS=Mus musculus GN=Camkk2 PE=1 SV=2 222 481 1.0E-33
sp|B4IMC3|DCLK_DROSE Serine/threonine-protein kinase GM11705 OS=Drosophila sechellia GN=GM11705 PE=3 SV=1 227 478 1.0E-33
sp|Q06850|CDPK1_ARATH Calcium-dependent protein kinase 1 OS=Arabidopsis thaliana GN=CPK1 PE=1 SV=1 229 513 1.0E-33
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 229 479 1.0E-33
sp|Q9SMQ4|SRK2F_ARATH Serine/threonine-protein kinase SRK2F OS=Arabidopsis thaliana GN=SRK2F PE=1 SV=1 231 482 1.0E-33
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 184 498 1.0E-33
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 224 480 2.0E-33
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 220 479 2.0E-33
sp|Q12152|YP150_YEAST Putative serine/threonine-protein kinase YPL150W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL150W PE=1 SV=1 222 479 2.0E-33
sp|Q9ZSA4|CDPKR_ARATH Calcium-dependent protein kinase 27 OS=Arabidopsis thaliana GN=CPK27 PE=1 SV=3 209 482 2.0E-33
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 227 480 2.0E-33
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 229 538 2.0E-33
sp|Q9Y243|AKT3_HUMAN RAC-gamma serine/threonine-protein kinase OS=Homo sapiens GN=AKT3 PE=1 SV=1 231 503 3.0E-33
sp|Q9WUA6|AKT3_MOUSE RAC-gamma serine/threonine-protein kinase OS=Mus musculus GN=Akt3 PE=1 SV=1 231 503 3.0E-33
sp|Q96RR4|KKCC2_HUMAN Calcium/calmodulin-dependent protein kinase kinase 2 OS=Homo sapiens GN=CAMKK2 PE=1 SV=2 222 481 3.0E-33
sp|Q07832|PLK1_MOUSE Serine/threonine-protein kinase PLK1 OS=Mus musculus GN=Plk1 PE=1 SV=2 187 498 3.0E-33
sp|Q42438|CDPK8_ARATH Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 229 486 3.0E-33
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 210 487 3.0E-33
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 226 479 3.0E-33
sp|P54644|KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum GN=pkbA PE=1 SV=1 229 474 3.0E-33
sp|B3NKK1|DCLK_DROER Serine/threonine-protein kinase GG21441 OS=Drosophila erecta GN=GG21441 PE=3 SV=1 227 478 4.0E-33
sp|Q9LJL9|CAMK2_ARATH CDPK-related kinase 2 OS=Arabidopsis thaliana GN=CRK2 PE=1 SV=1 229 479 4.0E-33
sp|Q63484|AKT3_RAT RAC-gamma serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt3 PE=2 SV=2 231 465 5.0E-33
sp|O08875|DCLK1_RAT Serine/threonine-protein kinase DCLK1 OS=Rattus norvegicus GN=Dclk1 PE=1 SV=1 205 489 5.0E-33
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 227 512 5.0E-33
sp|Q39193|SRK2I_ARATH Serine/threonine-protein kinase SRK2I OS=Arabidopsis thaliana GN=SRK2I PE=1 SV=1 224 488 6.0E-33
sp|O15075|DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens GN=DCLK1 PE=1 SV=2 222 544 6.0E-33
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 233 479 7.0E-33
sp|Q7Y0B9|SAPK8_ORYSJ Serine/threonine-protein kinase SAPK8 OS=Oryza sativa subsp. japonica GN=SAPK8 PE=2 SV=1 224 488 8.0E-33
sp|Q9SCS2|CAMK5_ARATH CDPK-related kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=2 SV=1 224 479 8.0E-33
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 207 479 8.0E-33
sp|O61267|LOK_DROME Ovarian-specific serine/threonine-protein kinase Lok OS=Drosophila melanogaster GN=lok PE=2 SV=1 220 479 9.0E-33
sp|Q7PLI7|DCLK_DROME Serine/threonine-protein kinase CG17528 OS=Drosophila melanogaster GN=CG17528 PE=1 SV=1 227 478 1.0E-32
sp|Q0VD22|STK33_BOVIN Serine/threonine-protein kinase 33 OS=Bos taurus GN=STK33 PE=2 SV=1 227 558 1.0E-32
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 227 482 2.0E-32
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 227 480 2.0E-32
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 229 481 2.0E-32
sp|O14408|KCC1_METAN Calcium/calmodulin-dependent protein kinase OS=Metarhizium anisopliae PE=2 SV=1 226 495 2.0E-32
sp|Q9ZSA2|CDPKL_ARATH Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1 229 539 3.0E-32
sp|Q8INB9|AKT1_DROME RAC serine/threonine-protein kinase OS=Drosophila melanogaster GN=Akt1 PE=1 SV=3 231 479 3.0E-32
sp|Q9JLM8|DCLK1_MOUSE Serine/threonine-protein kinase DCLK1 OS=Mus musculus GN=Dclk1 PE=1 SV=1 222 489 4.0E-32
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 225 481 4.0E-32
sp|Q9SJ61|CDPKP_ARATH Calcium-dependent protein kinase 25 OS=Arabidopsis thaliana GN=CPK25 PE=2 SV=1 229 486 4.0E-32
sp|Q64617|KPCL_RAT Protein kinase C eta type OS=Rattus norvegicus GN=Prkch PE=1 SV=1 231 463 6.0E-32
sp|O62305|KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans GN=unc-43 PE=1 SV=2 286 480 6.0E-32
sp|P23298|KPCL_MOUSE Protein kinase C eta type OS=Mus musculus GN=Prkch PE=1 SV=2 231 463 6.0E-32
sp|Q1PE17|CDPKI_ARATH Calcium-dependent protein kinase 18 OS=Arabidopsis thaliana GN=CPK18 PE=2 SV=1 226 482 6.0E-32
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 229 479 7.0E-32
sp|A8WXF6|KCC2D_CAEBR Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis briggsae GN=unc-43 PE=3 SV=1 283 480 8.0E-32
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 225 479 8.0E-32
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 229 479 1.0E-31
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 217 481 1.0E-31
sp|Q38871|CDPK5_ARATH Calcium-dependent protein kinase 5 OS=Arabidopsis thaliana GN=CPK5 PE=2 SV=1 227 491 1.0E-31
sp|Q10KY3|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threonine-protein kinase 1 OS=Oryza sativa subsp. japonica GN=CAMK1 PE=1 SV=1 224 479 1.0E-31
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 217 481 2.0E-31
sp|P31751|AKT2_HUMAN RAC-beta serine/threonine-protein kinase OS=Homo sapiens GN=AKT2 PE=1 SV=2 231 476 2.0E-31
sp|Q00168|KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain OS=Drosophila melanogaster GN=CaMKII PE=1 SV=1 283 481 2.0E-31
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 162 539 2.0E-31
sp|Q5MPA9|DCLK2_RAT Serine/threonine-protein kinase DCLK2 OS=Rattus norvegicus GN=Dclk2 PE=1 SV=2 226 480 2.0E-31
sp|P24723|KPCL_HUMAN Protein kinase C eta type OS=Homo sapiens GN=PRKCH PE=1 SV=4 231 463 2.0E-31
sp|P47197|AKT2_RAT RAC-beta serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt2 PE=1 SV=1 231 476 2.0E-31
sp|Q9FX86|CAMK8_ARATH CDPK-related kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=2 SV=1 229 479 2.0E-31
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 229 479 2.0E-31
sp|Q39192|SRK2D_ARATH Serine/threonine-protein kinase SRK2D OS=Arabidopsis thaliana GN=SRK2D PE=1 SV=1 224 485 3.0E-31
sp|Q6BVA0|IPL1_DEBHA Spindle assembly checkpoint kinase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IPL1 PE=3 SV=2 229 479 3.0E-31
sp|O77708|KCC2D_RABIT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Oryctolagus cuniculus GN=CAMK2D PE=2 SV=2 216 480 3.0E-31
sp|Q38872|CDPK6_ARATH Calcium-dependent protein kinase 6 OS=Arabidopsis thaliana GN=CPK6 PE=1 SV=1 221 491 4.0E-31
sp|Q9S9V0|CDPKV_ARATH Calcium-dependent protein kinase 31 OS=Arabidopsis thaliana GN=CPK31 PE=2 SV=2 227 482 4.0E-31
sp|D2I3C6|DCLK2_AILME Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca GN=DCLK2 PE=3 SV=1 226 480 4.0E-31
sp|P15791|KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus GN=Camk2d PE=1 SV=1 216 481 4.0E-31
sp|Q60823|AKT2_MOUSE RAC-beta serine/threonine-protein kinase OS=Mus musculus GN=Akt2 PE=1 SV=1 231 476 5.0E-31
sp|Q2HJF7|KCC2D_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Bos taurus GN=CAMK2D PE=2 SV=1 216 481 5.0E-31
sp|Q6IP76|AKT2B_XENLA RAC-beta serine/threonine-protein kinase B OS=Xenopus laevis GN=akt2-b PE=2 SV=1 231 476 5.0E-31
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 224 480 6.0E-31
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 229 479 6.0E-31
sp|O80673|CAMK1_ARATH CDPK-related kinase 1 OS=Arabidopsis thaliana GN=CRK1 PE=1 SV=1 233 480 6.0E-31
sp|A5A7I7|CDPK4_SOLTU Calcium-dependent protein kinase 4 OS=Solanum tuberosum GN=CPK4 PE=2 SV=1 227 491 6.0E-31
sp|Q6PHZ2|KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus GN=Camk2d PE=1 SV=1 216 481 6.0E-31
sp|Q13557|KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens GN=CAMK2D PE=1 SV=3 216 481 6.0E-31
sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK2 PE=1 SV=2 227 480 6.0E-31
sp|Q95266|KCC2D_PIG Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Sus scrofa GN=CAMK2D PE=2 SV=1 216 481 6.0E-31
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 231 463 6.0E-31
sp|Q7ZX15|AKT2A_XENLA RAC-beta serine/threonine-protein kinase A OS=Xenopus laevis GN=akt2-a PE=2 SV=1 231 476 7.0E-31
sp|Q8MJ44|KAPCA_CANLF cAMP-dependent protein kinase catalytic subunit alpha OS=Canis lupus familiaris GN=PRKACA PE=1 SV=3 231 465 7.0E-31
sp|P05132|KAPCA_MOUSE cAMP-dependent protein kinase catalytic subunit alpha OS=Mus musculus GN=Prkaca PE=1 SV=3 231 465 7.0E-31
sp|Q86CS2|ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum GN=atg1 PE=3 SV=1 225 484 8.0E-31
sp|P53350|PLK1_HUMAN Serine/threonine-protein kinase PLK1 OS=Homo sapiens GN=PLK1 PE=1 SV=1 233 498 8.0E-31
sp|Q8GVC7|PKZ1_PHYIN Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans GN=PKZ1 PE=1 SV=1 226 480 9.0E-31
sp|B4GXC2|DCLK_DROPE Serine/threonine-protein kinase GL21140 OS=Drosophila persimilis GN=GL21140 PE=3 SV=1 226 478 9.0E-31
sp|P53684|CDPKB_ORYSJ Calcium-dependent protein kinase isoform 11 OS=Oryza sativa subsp. japonica GN=CPK11 PE=2 SV=2 227 481 9.0E-31
sp|Q5ZKI0|KCC2D_CHICK Calcium/calmodulin-dependent protein kinase type II delta chain OS=Gallus gallus GN=CAMK2D PE=2 SV=1 229 481 9.0E-31
sp|O64812|SRK2J_ARATH Serine/threonine-protein kinase SRK2J OS=Arabidopsis thaliana GN=SRK2J PE=1 SV=1 226 494 9.0E-31
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 229 478 1.0E-30
sp|P36887|KAPCA_PIG cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa GN=PRKACA PE=1 SV=4 231 465 1.0E-30
sp|Q54WJ0|STK11_DICDI Serine/threonine-protein kinase stk11 homolog OS=Dictyostelium discoideum GN=lkb1 PE=3 SV=1 194 509 1.0E-30
sp|B5DK35|DCLK_DROPS Serine/threonine-protein kinase GA29083 OS=Drosophila pseudoobscura pseudoobscura GN=GA29083 PE=3 SV=1 226 478 1.0E-30
sp|P27791|KAPCA_RAT cAMP-dependent protein kinase catalytic subunit alpha OS=Rattus norvegicus GN=Prkaca PE=1 SV=2 231 465 1.0E-30
sp|P53681|CRK_DAUCA CDPK-related protein kinase OS=Daucus carota GN=CRK PE=2 SV=1 226 479 1.0E-30
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 229 479 2.0E-30
sp|P17612|KAPCA_HUMAN cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens GN=PRKACA PE=1 SV=2 231 465 2.0E-30
sp|Q13554|KCC2B_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens GN=CAMK2B PE=1 SV=3 229 481 2.0E-30
sp|A5A7I8|CDPK5_SOLTU Calcium-dependent protein kinase 5 OS=Solanum tuberosum GN=CPK5 PE=2 SV=1 227 491 2.0E-30
sp|Q6PGN3|DCLK2_MOUSE Serine/threonine-protein kinase DCLK2 OS=Mus musculus GN=Dclk2 PE=1 SV=1 207 480 2.0E-30
sp|Q62673|PLK1_RAT Serine/threonine-protein kinase PLK1 OS=Rattus norvegicus GN=Plk1 PE=2 SV=2 226 498 2.0E-30
sp|P25321|KAPCA_CRIGR cAMP-dependent protein kinase catalytic subunit alpha OS=Cricetulus griseus GN=PRKACA PE=1 SV=2 231 465 2.0E-30
sp|O34507|PRKC_BACSU Serine/threonine-protein kinase PrkC OS=Bacillus subtilis (strain 168) GN=prkC PE=1 SV=1 224 448 2.0E-30
sp|P21137|KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans GN=kin-1 PE=1 SV=3 231 465 2.0E-30
sp|Q1PFH8|CDPKJ_ARATH Calcium-dependent protein kinase 19 OS=Arabidopsis thaliana GN=CPK19 PE=2 SV=1 226 482 2.0E-30
sp|Q5RCC4|KCC2A_PONAB Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Pongo abelii GN=CAMK2A PE=2 SV=2 229 480 2.0E-30
sp|Q9UQM7|KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Homo sapiens GN=CAMK2A PE=1 SV=2 229 480 2.0E-30
sp|P11275|KCC2A_RAT Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Rattus norvegicus GN=Camk2a PE=1 SV=1 229 480 2.0E-30
sp|P11798|KCC2A_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus GN=Camk2a PE=1 SV=2 229 480 2.0E-30
sp|Q9MZD9|KAPCA_SHEEP cAMP-dependent protein kinase catalytic subunit alpha OS=Ovis aries GN=PRKACA PE=1 SV=3 231 465 2.0E-30
sp|Q13555|KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens GN=CAMK2G PE=1 SV=3 229 481 2.0E-30
sp|P34885|KPC1B_CAEEL Protein kinase C-like 1B OS=Caenorhabditis elegans GN=pkc-1 PE=2 SV=2 231 463 2.0E-30
sp|Q6DE87|CHK1_XENLA Serine/threonine-protein kinase Chk1 OS=Xenopus laevis GN=chek1 PE=1 SV=2 227 438 2.0E-30
sp|P05131|KAPCB_BOVIN cAMP-dependent protein kinase catalytic subunit beta OS=Bos taurus GN=PRKACB PE=1 SV=2 231 465 3.0E-30
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase catalytic subunit alpha OS=Bos taurus GN=PRKACA PE=1 SV=3 231 465 3.0E-30
sp|D0N4E2|PKZ1_PHYIT Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans (strain T30-4) GN=PKZ1 PE=3 SV=1 226 480 3.0E-30
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 231 456 4.0E-30
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 226 480 4.0E-30
sp|P22694|KAPCB_HUMAN cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens GN=PRKACB PE=1 SV=2 231 465 4.0E-30
sp|Q5HZ38|GRIK2_ARATH Serine/threonine-protein kinase GRIK2 OS=Arabidopsis thaliana GN=GRIK2 PE=1 SV=1 233 480 4.0E-30
sp|Q8N568|DCLK2_HUMAN Serine/threonine-protein kinase DCLK2 OS=Homo sapiens GN=DCLK2 PE=2 SV=4 226 480 4.0E-30
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 231 497 4.0E-30
sp|P49101|CDPK2_MAIZE Calcium-dependent protein kinase 2 OS=Zea mays GN=CPK2 PE=2 SV=1 229 538 4.0E-30
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 229 479 5.0E-30
sp|Q8AYC9|CHK1_CHICK Serine/threonine-protein kinase Chk1 OS=Gallus gallus GN=CHEK1 PE=1 SV=1 227 441 5.0E-30
sp|Q9BYT3|STK33_HUMAN Serine/threonine-protein kinase 33 OS=Homo sapiens GN=STK33 PE=1 SV=1 229 581 5.0E-30
sp|Q925K9|TSSK6_MOUSE Testis-specific serine/threonine-protein kinase 6 OS=Mus musculus GN=Tssk6 PE=2 SV=1 229 474 6.0E-30
sp|Q01314|AKT1_BOVIN RAC-alpha serine/threonine-protein kinase OS=Bos taurus GN=AKT1 PE=1 SV=2 231 476 6.0E-30
sp|P05383|KAPCB_PIG cAMP-dependent protein kinase catalytic subunit beta OS=Sus scrofa GN=PRKACB PE=1 SV=3 231 465 6.0E-30
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 231 465 6.0E-30
sp|Q9ZUZ2|CAMK3_ARATH CDPK-related kinase 3 OS=Arabidopsis thaliana GN=CRK3 PE=1 SV=1 226 479 6.0E-30
sp|Q8C1R0|TSSK5_MOUSE Testis-specific serine/threonine-protein kinase 5 OS=Mus musculus GN=Tssk5 PE=2 SV=2 222 501 7.0E-30
sp|Q923T9|KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus GN=Camk2g PE=1 SV=1 229 481 7.0E-30
sp|P28652|KCC2B_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Mus musculus GN=Camk2b PE=1 SV=2 229 481 7.0E-30
sp|Q9DG02|KCC2D_XENLA Calcium/calmodulin-dependent protein kinase type II delta chain OS=Xenopus laevis GN=camk2d PE=2 SV=1 218 481 7.0E-30
sp|Q8CEE6|PASK_MOUSE PAS domain-containing serine/threonine-protein kinase OS=Mus musculus GN=Pask PE=1 SV=3 233 484 7.0E-30
sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=3 SV=1 226 482 8.0E-30
sp|P08413|KCC2B_RAT Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Rattus norvegicus GN=Camk2b PE=1 SV=1 229 481 8.0E-30
sp|Q9SZM3|CDPKQ_ARATH Calcium-dependent protein kinase 26 OS=Arabidopsis thaliana GN=CPK26 PE=2 SV=1 229 491 8.0E-30
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 202 479 1.0E-29
sp|Q54CY9|MYLKD_DICDI Probable myosin light chain kinase DDB_G0292624 OS=Dictyostelium discoideum GN=DDB_G0292624 PE=3 SV=1 225 487 1.0E-29
sp|P31749|AKT1_HUMAN RAC-alpha serine/threonine-protein kinase OS=Homo sapiens GN=AKT1 PE=1 SV=2 231 476 1.0E-29
sp|Q8VBY2|KKCC1_MOUSE Calcium/calmodulin-dependent protein kinase kinase 1 OS=Mus musculus GN=Camkk1 PE=1 SV=1 209 481 1.0E-29
sp|P31325|PHKG2_RAT Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Rattus norvegicus GN=Phkg2 PE=1 SV=1 249 492 1.0E-29
sp|P97756|KKCC1_RAT Calcium/calmodulin-dependent protein kinase kinase 1 OS=Rattus norvegicus GN=Camkk1 PE=1 SV=1 209 481 1.0E-29
sp|Q6DGS3|KC2D2_DANRE Calcium/calmodulin-dependent protein kinase type II delta 2 chain OS=Danio rerio GN=camk2d2 PE=2 SV=2 229 481 2.0E-29
sp|P11730|KCC2G_RAT Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Rattus norvegicus GN=Camk2g PE=1 SV=1 229 481 2.0E-29
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 225 480 2.0E-29
sp|Q98TY9|AKT1_XENLA RAC-alpha serine/threonine-protein kinase OS=Xenopus laevis GN=akt1 PE=2 SV=1 231 479 2.0E-29
sp|P53682|CDPK1_ORYSJ Calcium-dependent protein kinase isoform 1 OS=Oryza sativa subsp. japonica GN=SPK PE=2 SV=2 227 489 2.0E-29
sp|P28583|CDPK_SOYBN Calcium-dependent protein kinase SK5 OS=Glycine max PE=1 SV=1 229 513 2.0E-29
sp|Q54PB4|MYLKE_DICDI Probable myosin light chain kinase DDB_G0284661 OS=Dictyostelium discoideum GN=DDB_G0284661 PE=3 SV=1 229 479 2.0E-29
sp|P15735|PHKG2_HUMAN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens GN=PHKG2 PE=1 SV=1 271 492 2.0E-29
sp|Q93V58|GRIK1_ARATH Serine/threonine-protein kinase GRIK1 OS=Arabidopsis thaliana GN=GRIK1 PE=1 SV=1 231 490 2.0E-29
sp|Q9BXA6|TSSK6_HUMAN Testis-specific serine/threonine-protein kinase 6 OS=Homo sapiens GN=TSSK6 PE=1 SV=1 229 474 3.0E-29
sp|Q6SA08|TSSK4_HUMAN Testis-specific serine/threonine-protein kinase 4 OS=Homo sapiens GN=TSSK4 PE=1 SV=1 229 481 3.0E-29
sp|Q9M101|CDPKN_ARATH Calcium-dependent protein kinase 23 OS=Arabidopsis thaliana GN=CPK23 PE=1 SV=1 246 539 4.0E-29
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 229 481 4.0E-29
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 229 479 4.0E-29
sp|Q3MHJ9|KCC2B_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Bos taurus GN=CAMK2B PE=2 SV=1 229 481 4.0E-29
sp|P16911|KDC1_DROME Protein kinase DC1 OS=Drosophila melanogaster GN=Pka-C2 PE=2 SV=1 222 474 4.0E-29
sp|Q9LET1|CAMK7_ARATH CDPK-related kinase 7 OS=Arabidopsis thaliana GN=CRK7 PE=1 SV=1 233 480 4.0E-29
sp|Q8N5S9|KKCC1_HUMAN Calcium/calmodulin-dependent protein kinase kinase 1 OS=Homo sapiens GN=CAMKK1 PE=1 SV=2 222 495 4.0E-29
sp|Q17941|AKT1_CAEEL Serine/threonine-protein kinase akt-1 OS=Caenorhabditis elegans GN=akt-1 PE=1 SV=2 231 505 4.0E-29
sp|P50526|SSP1_SCHPO Serine/threonine-protein kinase ssp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp1 PE=1 SV=1 231 496 5.0E-29
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 231 499 5.0E-29
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 227 479 5.0E-29
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 226 479 5.0E-29
sp|P83099|KPC4_DROME Putative protein kinase C delta type homolog OS=Drosophila melanogaster GN=Pkcdelta PE=2 SV=3 232 463 5.0E-29
sp|P31750|AKT1_MOUSE RAC-alpha serine/threonine-protein kinase OS=Mus musculus GN=Akt1 PE=1 SV=2 231 476 5.0E-29
sp|P47196|AKT1_RAT RAC-alpha serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt1 PE=1 SV=1 231 476 5.0E-29
sp|Q16975|KPC2_APLCA Calcium-independent protein kinase C OS=Aplysia californica GN=PRKC2 PE=1 SV=1 231 463 5.0E-29
sp|P04409|KPCA_BOVIN Protein kinase C alpha type OS=Bos taurus GN=PRKCA PE=1 SV=3 232 463 5.0E-29
sp|P31748|AKT_MLVAT AKT kinase-transforming protein OS=AKT8 murine leukemia virus GN=V-AKT PE=1 SV=1 231 476 6.0E-29
sp|O75676|KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens GN=RPS6KA4 PE=1 SV=1 229 479 6.0E-29
sp|Q9FKW4|CDPKS_ARATH Calcium-dependent protein kinase 28 OS=Arabidopsis thaliana GN=CPK28 PE=1 SV=1 227 485 6.0E-29
sp|P12688|YPK1_YEAST Serine/threonine-protein kinase YPK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK1 PE=1 SV=2 229 481 7.0E-29
sp|P68182|KAPCB_RAT cAMP-dependent protein kinase catalytic subunit beta OS=Rattus norvegicus GN=Prkacb PE=1 SV=2 231 465 7.0E-29
sp|P68181|KAPCB_MOUSE cAMP-dependent protein kinase catalytic subunit beta OS=Mus musculus GN=Prkacb PE=1 SV=2 231 465 7.0E-29
sp|P68180|KAPCB_CRIGR cAMP-dependent protein kinase catalytic subunit beta OS=Cricetulus griseus GN=PRKACB PE=2 SV=2 231 465 7.0E-29
sp|O14757|CHK1_HUMAN Serine/threonine-protein kinase Chk1 OS=Homo sapiens GN=CHEK1 PE=1 SV=2 227 438 7.0E-29
sp|P20444|KPCA_MOUSE Protein kinase C alpha type OS=Mus musculus GN=Prkca PE=1 SV=3 232 463 7.0E-29
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 209 463 7.0E-29
sp|P12370|KAPC_DROME cAMP-dependent protein kinase catalytic subunit OS=Drosophila melanogaster GN=Pka-C1 PE=1 SV=3 231 465 7.0E-29
sp|P05696|KPCA_RAT Protein kinase C alpha type OS=Rattus norvegicus GN=Prkca PE=1 SV=3 232 463 8.0E-29
sp|P17252|KPCA_HUMAN Protein kinase C alpha type OS=Homo sapiens GN=PRKCA PE=1 SV=4 232 463 8.0E-29
sp|Q2TA25|PLK1_BOVIN Serine/threonine-protein kinase PLK1 OS=Bos taurus GN=PLK1 PE=2 SV=2 233 498 9.0E-29
sp|Q23023|UNC51_CAEEL Serine/threonine-protein kinase unc-51 OS=Caenorhabditis elegans GN=unc-51 PE=1 SV=1 233 497 9.0E-29
sp|Q91ZN7|CHK1_RAT Serine/threonine-protein kinase Chk1 OS=Rattus norvegicus GN=Chek1 PE=2 SV=1 227 438 1.0E-28
sp|A8XW88|KAPC1_CAEBR cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis briggsae GN=kin-1 PE=1 SV=1 231 465 1.0E-28
sp|P05130|KPC1_DROME Protein kinase C, brain isozyme OS=Drosophila melanogaster GN=Pkc53E PE=2 SV=2 231 466 1.0E-28
sp|F1M7Y5|KPCI_RAT Protein kinase C iota type OS=Rattus norvegicus GN=Prkci PE=1 SV=1 184 438 1.0E-28
sp|Q6DEH3|KC2D1_DANRE Calcium/calmodulin-dependent protein kinase type II delta 1 chain OS=Danio rerio GN=camk2d1 PE=2 SV=2 218 481 1.0E-28
sp|Q6PHR2|ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens GN=ULK3 PE=1 SV=2 227 479 1.0E-28
sp|Q9DB30|PHKG2_MOUSE Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Mus musculus GN=Phkg2 PE=2 SV=2 249 492 1.0E-28
sp|P10102|KPCA_RABIT Protein kinase C alpha type OS=Oryctolagus cuniculus GN=PRKCA PE=2 SV=3 232 463 1.0E-28
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 231 480 1.0E-28
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 229 481 2.0E-28
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 231 479 2.0E-28
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 185 460 2.0E-28
sp|Q9R011|PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus GN=Plk3 PE=1 SV=2 216 498 2.0E-28
sp|Q0V7M1|KPSH1_BOVIN Serine/threonine-protein kinase H1 OS=Bos taurus GN=PSKH1 PE=2 SV=1 184 480 2.0E-28
sp|Q6GLY8|SGK1B_XENLA Serine/threonine-protein kinase Sgk1-B OS=Xenopus laevis GN=sgk1-b PE=2 SV=1 231 449 2.0E-28
sp|O35280|CHK1_MOUSE Serine/threonine-protein kinase Chk1 OS=Mus musculus GN=Chek1 PE=1 SV=2 227 438 2.0E-28
sp|Q04759|KPCT_HUMAN Protein kinase C theta type OS=Homo sapiens GN=PRKCQ PE=1 SV=3 208 465 2.0E-28
sp|P13678|KPC3_DROME Protein kinase C OS=Drosophila melanogaster GN=Pkc98E PE=2 SV=1 231 481 2.0E-28
sp|Q2KJ16|PHKG2_BOVIN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Bos taurus GN=PHKG2 PE=2 SV=1 232 492 2.0E-28
sp|Q16816|PHKG1_HUMAN Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Homo sapiens GN=PHKG1 PE=2 SV=3 280 479 2.0E-28
sp|P16054|KPCE_MOUSE Protein kinase C epsilon type OS=Mus musculus GN=Prkce PE=1 SV=1 231 463 2.0E-28
sp|P11799|MYLK_CHICK Myosin light chain kinase, smooth muscle OS=Gallus gallus GN=Mylk PE=1 SV=2 275 481 2.0E-28
sp|Q02156|KPCE_HUMAN Protein kinase C epsilon type OS=Homo sapiens GN=PRKCE PE=1 SV=1 231 463 2.0E-28
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 216 483 2.0E-28
sp|O61661|CHK1_DROME Serine/threonine-protein kinase grp OS=Drosophila melanogaster GN=grp PE=1 SV=2 227 483 2.0E-28
sp|Q9FIM9|CAMK4_ARATH CDPK-related kinase 4 OS=Arabidopsis thaliana GN=CRK4 PE=2 SV=1 225 479 3.0E-28
sp|P10830|KPCE_RABIT Protein kinase C epsilon type OS=Oryctolagus cuniculus GN=PRKCE PE=2 SV=1 231 463 3.0E-28
sp|Q8SRL5|IPL1_ENCCU Probable spindle assembly checkpoint kinase homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=IPL1 PE=3 SV=1 229 481 3.0E-28
sp|Q9XTG7|AKT2_CAEEL Serine/threonine-protein kinase akt-2 OS=Caenorhabditis elegans GN=akt-2 PE=1 SV=1 231 507 3.0E-28
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 226 479 3.0E-28
sp|P40376|KAPB_SCHPO cAMP-dependent protein kinase catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pka1 PE=1 SV=1 231 461 3.0E-28
sp|Q3U3Q1|ULK3_MOUSE Serine/threonine-protein kinase ULK3 OS=Mus musculus GN=Ulk3 PE=2 SV=1 220 479 3.0E-28
sp|Q96RG2|PASK_HUMAN PAS domain-containing serine/threonine-protein kinase OS=Homo sapiens GN=PASK PE=1 SV=3 233 484 4.0E-28
sp|Q62074|KPCI_MOUSE Protein kinase C iota type OS=Mus musculus GN=Prkci PE=1 SV=3 194 438 4.0E-28
sp|Q5R4K9|KPCI_PONAB Protein kinase C iota type OS=Pongo abelii GN=PRKCI PE=2 SV=2 229 438 4.0E-28
sp|Q9UIK4|DAPK2_HUMAN Death-associated protein kinase 2 OS=Homo sapiens GN=DAPK2 PE=1 SV=1 229 489 4.0E-28
sp|P41743|KPCI_HUMAN Protein kinase C iota type OS=Homo sapiens GN=PRKCI PE=1 SV=2 229 438 4.0E-28
sp|Q9SPK4|PPCK1_ARATH Phosphoenolpyruvate carboxylase kinase 1 OS=Arabidopsis thaliana GN=PPCK1 PE=1 SV=1 213 479 4.0E-28
sp|D3ZHP7|ULK3_RAT Serine/threonine-protein kinase ULK3 OS=Rattus norvegicus GN=Ulk3 PE=1 SV=1 220 479 5.0E-28
sp|P07934|PHKG1_MOUSE Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Mus musculus GN=Phkg1 PE=1 SV=3 279 479 5.0E-28
sp|P11801|KPSH1_HUMAN Serine/threonine-protein kinase H1 OS=Homo sapiens GN=PSKH1 PE=1 SV=4 190 480 5.0E-28
sp|Q7SY24|KPCB_DANRE Protein kinase C beta type OS=Danio rerio GN=prkcbb PE=2 SV=1 232 463 5.0E-28
sp|P13286|PHKG1_RAT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Rattus norvegicus GN=Phkg1 PE=2 SV=2 279 479 5.0E-28
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 231 499 5.0E-28
sp|P38991|IPL1_YEAST Spindle assembly checkpoint kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IPL1 PE=1 SV=1 286 481 6.0E-28
sp|Q64702|PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus GN=Plk4 PE=1 SV=2 229 482 6.0E-28
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 218 487 6.0E-28
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 231 499 6.0E-28
sp|Q5BKK4|SGK1_XENTR Serine/threonine-protein kinase Sgk1 OS=Xenopus tropicalis GN=sgk1 PE=2 SV=1 231 449 6.0E-28
sp|Q6GPN6|SGK1A_XENLA Serine/threonine-protein kinase Sgk1-A OS=Xenopus laevis GN=sgk1-a PE=2 SV=1 231 449 7.0E-28
sp|P18961|YPK2_YEAST Serine/threonine-protein kinase YPK2/YKR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK2 PE=1 SV=1 229 479 7.0E-28
sp|Q9H4B4|PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens GN=PLK3 PE=1 SV=2 218 498 7.0E-28
sp|B2GUY1|PLK4_RAT Serine/threonine-protein kinase PLK4 OS=Rattus norvegicus GN=Plk4 PE=2 SV=1 229 482 7.0E-28
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 232 482 8.0E-21
sp|P13185|KIN1_YEAST Serine/threonine protein kinase KIN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN1 PE=1 SV=3 894 1150 1.0E-20
sp|O75676|KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens GN=RPS6KA4 PE=1 SV=1 232 482 3.0E-20
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0006807 nitrogen compound metabolic process No
GO:0036211 protein modification process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0032553 ribonucleotide binding No
GO:0016301 kinase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0043170 macromolecule metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:0030554 adenyl nucleotide binding No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0043412 macromolecule modification No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0016310 phosphorylation No
GO:0043168 anion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|912
MTTTASPGAPADYSSRAGPSRSYSASAAPARSSHSQSRAPPAASAGVSSAHHPSLPLSAAATTSTTSSNHNHNHH
HQHQSSATLHRHQRRRSSSSSRPIQDVLPQHDYETSHLASYSKRSISRERDRERIRDHERDGDRHRNRDRERPPT
ATRSADSSSRPPRRRSSTRSNHHHHNHYYDSCSMPPAAVPSNGPPHTATVSHTVQDAPQQHKQTRSRTTIPTQSG
KWILGKTIGAGSMGKVKLARKEDGTEQVACKIVPRGSTDDGHQSRADKERADQSKEIRTAREAAIVTLLNHPHIC
GMRDVVRTNYHWYMLFEYVNGGQMLDYIISHGKLKEKQARKFSRQIASALDYCHRNSIVHRDLKIENILISKTGD
IKIIDFGLSNLFSPRGHLKTFCGSLYFAAPELLQARAYTGPEVDVWSFGIVLYVLVCGKVPFDDQSMPALHAKIK
KGLVDYPTWLSSDPKQRATMQEVMNHPWMTKGFNGPPDNYLPAREPLSHPLDSEAILAMHGFNFGTPENIKSQLT
KIIESEEYQQSIKTYQKEREMPQLHRDAEKRRGFGFDFYKRRNSGNSRDTLSGPSSEALQLGSDPLYAFSPLLSI
YYLVKEKQEREHGEMSQHATAVASPRDRDKEKAAAVMADVISEPAPPQAAYTNSAAFEMPGEKPTGGRTRPRART
HGEDDAPDTSRLAPHHHQAPFHGAPPVPPPPPPETRADHLQKKEGTAAGLLRRFSTRKRRDPDRLEKDRSHPPTV
QIHSPAEASPVTPKKSFSIRRGRQNQDSTAPVIRSAGSQPQHSELLSPPVSASDTRDHRRSGLGRSTSVNSADIR
RPRGGVGRVVKDTVPAMPVTSGSDQSVTTREMPALAVQQQHQQQHQQQQQQQQQTSQRGLTQSRSINLRAKSLGH
ARRESIQRRRLRKEGSSQEADVPEETDMDQEQDQEQCGTSVERLDSSDLAKPVYLKGLFSVSTTSGKSVPAIRTD
IKRVLRQLNVDYVEIRGGFSCRHAPSIDLHKVQDPAGSPTAQMPGHRRRFSFGGLMRGDERDRDDFERDRSVLQP
TTPRTPGRHERERGDRDRSYSNSETSIDSIPRRTATLRRVPGETSTQVQSDLGGSMVLEFEIFIVKVPLLSLHGI
QFKRMTGNTWQYKNMADQILRELRL*
Coding >OphauB2|912
ATGACAACCACGGCGTCCCCAGGAGCACCGGCAGATTACTCGTCTCGAGCGGGCCCATCCCGGTCCTACTCAGCA
TCAGCAGCACCAGCACGCTCCTCCCACTCTCAATCTCGGGCCCCTCCCGCTGCGTCTGCGGGCGTCTCTTCAGCC
CATCATCCGTCGCTGCCTCTTTCCGCCGCAGCCACGACTTCGACCACGTCGTCCAACCACAATCACAACCACCAC
CATCAGCATCAATCGTCAGCCACTCTGCACCGCCATCAGCGTCGACGCAGTTCGTCTTCGTCTCGCCCTATTCAA
GACGTGCTTCCTCAACATGATTACGAAACGTCGCATCTAGCCTCGTATTCAAAGCGCAGCATCAGCCGAGAGAGG
GATCGTGAACGCATTCGCGACCACGAACGCGACGGTGACCGCCATCGCAATCGCGACCGCGAACGTCCCCCGACC
GCAACAAGGAGTGCTGACTCGTCGTCGCGCCCGCCACGTCGCCGCAGCAGTACACGTTCTAATCATCACCACCAT
AATCACTATTACGACTCTTGTAGCATGCCCCCCGCCGCTGTGCCCAGCAATGGGCCTCCGCACACGGCTACTGTC
TCTCATACAGTCCAAGATGCACCTCAGCAGCACAAGCAGACACGGTCGCGTACTACTATTCCCACTCAGTCTGGA
AAATGGATCCTTGGCAAGACTATAGGTGCCGGCAGCATGGGCAAGGTCAAGCTGGCTCGCAAAGAGGACGGCACG
GAACAGGTTGCGTGTAAAATCGTTCCCCGTGGCTCGACCGATGACGGCCATCAAAGCCGCGCCGACAAGGAGCGC
GCCGATCAATCCAAGGAGATTCGCACTGCTCGCGAGGCCGCAATCGTCACTCTCCTCAACCACCCCCACATTTGC
GGAATGCGCGATGTGGTGCGCACAAATTATCATTGGTACATGCTTTTTGAGTATGTCAACGGCGGCCAGATGCTC
GATTACATCATTTCACACGGCAAGCTTAAGGAGAAGCAAGCCCGCAAGTTTAGTCGTCAGATAGCATCGGCTCTC
GATTACTGCCATCGCAACAGCATCGTTCACAGAGATCTCAAAATTGAAAACATTCTCATCAGCAAGACTGGCGAT
ATCAAAATCATTGACTTTGGCCTTAGCAATCTCTTTTCTCCTCGCGGGCACCTCAAGACTTTTTGCGGCAGTCTG
TACTTTGCCGCCCCTGAGCTTCTACAGGCCAGGGCTTACACAGGCCCCGAAGTTGATGTATGGAGTTTTGGCATT
GTTCTATACGTCCTCGTTTGTGGTAAGGTGCCATTCGATGACCAGAGCATGCCAGCTCTCCACGCAAAAATCAAA
AAAGGCCTCGTCGACTATCCCACATGGCTCTCGAGCGACCCTAAGCAACGGGCCACCATGCAAGAAGTCATGAAT
CACCCCTGGATGACCAAGGGCTTCAATGGCCCGCCTGATAACTATCTCCCCGCTCGCGAGCCCTTGTCGCATCCG
TTAGATTCAGAAGCGATTCTTGCCATGCATGGCTTCAATTTTGGCACTCCCGAAAATATCAAGTCTCAATTGACT
AAGATCATCGAGTCCGAAGAGTACCAGCAATCCATCAAGACATACCAGAAGGAGCGAGAGATGCCACAGCTTCAT
AGGGACGCGGAGAAGCGGCGAGGCTTTGGCTTCGATTTTTACAAACGTCGCAACTCGGGCAACAGTCGCGATACT
CTATCAGGTCCGAGCTCGGAGGCCTTGCAACTGGGATCCGACCCGCTTTACGCCTTTAGTCCTCTTTTATCCATA
TACTATCTAGTCAAGGAGAAGCAGGAACGCGAACATGGCGAAATGTCGCAACATGCTACTGCCGTGGCATCACCG
CGTGACAGAGATAAGGAAAAGGCAGCGGCCGTCATGGCCGACGTCATATCTGAGCCAGCACCACCTCAAGCTGCC
TACACCAATTCGGCTGCTTTTGAAATGCCAGGAGAAAAGCCGACGGGTGGCCGAACAAGACCGCGGGCTCGCACA
CACGGCGAAGATGACGCTCCAGACACATCTAGACTTGCTCCACACCATCATCAAGCTCCATTTCATGGCGCGCCG
CCTGTGCCACCGCCTCCTCCTCCCGAAACCAGGGCAGATCATCTTCAGAAGAAAGAAGGCACGGCAGCAGGTCTG
CTTCGCCGGTTCAGCACACGCAAGCGGAGGGATCCAGATCGCCTAGAGAAGGACCGGTCTCACCCGCCCACGGTG
CAGATTCACTCTCCCGCAGAAGCGTCGCCAGTCACTCCGAAGAAGAGCTTCAGTATCCGTCGTGGCCGACAAAAT
CAGGACAGTACCGCGCCAGTAATACGTTCGGCCGGTAGCCAGCCACAGCATAGTGAATTACTCAGCCCACCGGTA
TCCGCTAGTGATACGCGGGACCATAGGAGATCAGGTCTCGGCCGGTCGACAAGCGTTAACTCTGCTGATATTCGT
CGACCGCGTGGAGGTGTAGGCCGTGTCGTCAAGGACACTGTACCAGCAATGCCGGTGACGAGCGGCTCCGATCAG
TCCGTCACAACAAGAGAAATGCCAGCTCTTGCTGTACAGCAGCAACATCAGCAGCAACATCAGCAACAGCAGCAA
CAGCAGCAACAGACTTCTCAAAGAGGTCTGACGCAGTCCAGATCGATTAACTTGAGAGCCAAGTCTCTGGGACAC
GCTCGCCGGGAGAGTATCCAACGTCGGCGACTTAGGAAAGAGGGGAGTTCACAGGAAGCTGATGTTCCAGAAGAG
ACGGACATGGACCAGGAGCAGGATCAGGAGCAATGCGGCACGTCAGTTGAGCGACTTGACAGCTCAGACCTAGCA
AAGCCGGTATATCTCAAAGGGCTGTTTAGCGTGTCCACCACGTCGGGAAAGTCTGTACCAGCAATCCGGACCGAC
ATCAAACGAGTGCTGCGTCAGCTTAATGTGGACTATGTTGAGATTAGGGGCGGCTTTAGCTGCAGGCATGCGCCC
AGCATTGACTTGCACAAAGTACAGGACCCAGCTGGAAGTCCAACGGCGCAAATGCCCGGCCATCGACGGCGGTTC
AGCTTCGGGGGGCTCATGCGAGGCGACGAACGCGACAGAGATGATTTTGAGCGCGATCGATCCGTGCTGCAGCCC
ACGACGCCTCGGACTCCAGGTCGTCACGAGAGGGAGCGCGGAGATCGGGATCGCAGCTACTCCAACTCGGAGACG
TCGATAGATAGCATTCCACGACGCACAGCAACGCTGCGGCGGGTGCCTGGGGAGACGAGCACACAGGTACAGAGC
GACCTTGGGGGCAGCATGGTGCTTGAATTTGAGATTTTCATCGTCAAAGTTCCATTGCTTTCGCTGCATGGAATT
CAATTCAAGAGGATGACGGGCAATACATGGCAGTACAAAAACATGGCGGATCAAATCCTTCGAGAGCTCAGGCTA
TAG
Transcript >OphauB2|912
ATGACAACCACGGCGTCCCCAGGAGCACCGGCAGATTACTCGTCTCGAGCGGGCCCATCCCGGTCCTACTCAGCA
TCAGCAGCACCAGCACGCTCCTCCCACTCTCAATCTCGGGCCCCTCCCGCTGCGTCTGCGGGCGTCTCTTCAGCC
CATCATCCGTCGCTGCCTCTTTCCGCCGCAGCCACGACTTCGACCACGTCGTCCAACCACAATCACAACCACCAC
CATCAGCATCAATCGTCAGCCACTCTGCACCGCCATCAGCGTCGACGCAGTTCGTCTTCGTCTCGCCCTATTCAA
GACGTGCTTCCTCAACATGATTACGAAACGTCGCATCTAGCCTCGTATTCAAAGCGCAGCATCAGCCGAGAGAGG
GATCGTGAACGCATTCGCGACCACGAACGCGACGGTGACCGCCATCGCAATCGCGACCGCGAACGTCCCCCGACC
GCAACAAGGAGTGCTGACTCGTCGTCGCGCCCGCCACGTCGCCGCAGCAGTACACGTTCTAATCATCACCACCAT
AATCACTATTACGACTCTTGTAGCATGCCCCCCGCCGCTGTGCCCAGCAATGGGCCTCCGCACACGGCTACTGTC
TCTCATACAGTCCAAGATGCACCTCAGCAGCACAAGCAGACACGGTCGCGTACTACTATTCCCACTCAGTCTGGA
AAATGGATCCTTGGCAAGACTATAGGTGCCGGCAGCATGGGCAAGGTCAAGCTGGCTCGCAAAGAGGACGGCACG
GAACAGGTTGCGTGTAAAATCGTTCCCCGTGGCTCGACCGATGACGGCCATCAAAGCCGCGCCGACAAGGAGCGC
GCCGATCAATCCAAGGAGATTCGCACTGCTCGCGAGGCCGCAATCGTCACTCTCCTCAACCACCCCCACATTTGC
GGAATGCGCGATGTGGTGCGCACAAATTATCATTGGTACATGCTTTTTGAGTATGTCAACGGCGGCCAGATGCTC
GATTACATCATTTCACACGGCAAGCTTAAGGAGAAGCAAGCCCGCAAGTTTAGTCGTCAGATAGCATCGGCTCTC
GATTACTGCCATCGCAACAGCATCGTTCACAGAGATCTCAAAATTGAAAACATTCTCATCAGCAAGACTGGCGAT
ATCAAAATCATTGACTTTGGCCTTAGCAATCTCTTTTCTCCTCGCGGGCACCTCAAGACTTTTTGCGGCAGTCTG
TACTTTGCCGCCCCTGAGCTTCTACAGGCCAGGGCTTACACAGGCCCCGAAGTTGATGTATGGAGTTTTGGCATT
GTTCTATACGTCCTCGTTTGTGGTAAGGTGCCATTCGATGACCAGAGCATGCCAGCTCTCCACGCAAAAATCAAA
AAAGGCCTCGTCGACTATCCCACATGGCTCTCGAGCGACCCTAAGCAACGGGCCACCATGCAAGAAGTCATGAAT
CACCCCTGGATGACCAAGGGCTTCAATGGCCCGCCTGATAACTATCTCCCCGCTCGCGAGCCCTTGTCGCATCCG
TTAGATTCAGAAGCGATTCTTGCCATGCATGGCTTCAATTTTGGCACTCCCGAAAATATCAAGTCTCAATTGACT
AAGATCATCGAGTCCGAAGAGTACCAGCAATCCATCAAGACATACCAGAAGGAGCGAGAGATGCCACAGCTTCAT
AGGGACGCGGAGAAGCGGCGAGGCTTTGGCTTCGATTTTTACAAACGTCGCAACTCGGGCAACAGTCGCGATACT
CTATCAGGTCCGAGCTCGGAGGCCTTGCAACTGGGATCCGACCCGCTTTACGCCTTTAGTCCTCTTTTATCCATA
TACTATCTAGTCAAGGAGAAGCAGGAACGCGAACATGGCGAAATGTCGCAACATGCTACTGCCGTGGCATCACCG
CGTGACAGAGATAAGGAAAAGGCAGCGGCCGTCATGGCCGACGTCATATCTGAGCCAGCACCACCTCAAGCTGCC
TACACCAATTCGGCTGCTTTTGAAATGCCAGGAGAAAAGCCGACGGGTGGCCGAACAAGACCGCGGGCTCGCACA
CACGGCGAAGATGACGCTCCAGACACATCTAGACTTGCTCCACACCATCATCAAGCTCCATTTCATGGCGCGCCG
CCTGTGCCACCGCCTCCTCCTCCCGAAACCAGGGCAGATCATCTTCAGAAGAAAGAAGGCACGGCAGCAGGTCTG
CTTCGCCGGTTCAGCACACGCAAGCGGAGGGATCCAGATCGCCTAGAGAAGGACCGGTCTCACCCGCCCACGGTG
CAGATTCACTCTCCCGCAGAAGCGTCGCCAGTCACTCCGAAGAAGAGCTTCAGTATCCGTCGTGGCCGACAAAAT
CAGGACAGTACCGCGCCAGTAATACGTTCGGCCGGTAGCCAGCCACAGCATAGTGAATTACTCAGCCCACCGGTA
TCCGCTAGTGATACGCGGGACCATAGGAGATCAGGTCTCGGCCGGTCGACAAGCGTTAACTCTGCTGATATTCGT
CGACCGCGTGGAGGTGTAGGCCGTGTCGTCAAGGACACTGTACCAGCAATGCCGGTGACGAGCGGCTCCGATCAG
TCCGTCACAACAAGAGAAATGCCAGCTCTTGCTGTACAGCAGCAACATCAGCAGCAACATCAGCAACAGCAGCAA
CAGCAGCAACAGACTTCTCAAAGAGGTCTGACGCAGTCCAGATCGATTAACTTGAGAGCCAAGTCTCTGGGACAC
GCTCGCCGGGAGAGTATCCAACGTCGGCGACTTAGGAAAGAGGGGAGTTCACAGGAAGCTGATGTTCCAGAAGAG
ACGGACATGGACCAGGAGCAGGATCAGGAGCAATGCGGCACGTCAGTTGAGCGACTTGACAGCTCAGACCTAGCA
AAGCCGGTATATCTCAAAGGGCTGTTTAGCGTGTCCACCACGTCGGGAAAGTCTGTACCAGCAATCCGGACCGAC
ATCAAACGAGTGCTGCGTCAGCTTAATGTGGACTATGTTGAGATTAGGGGCGGCTTTAGCTGCAGGCATGCGCCC
AGCATTGACTTGCACAAAGTACAGGACCCAGCTGGAAGTCCAACGGCGCAAATGCCCGGCCATCGACGGCGGTTC
AGCTTCGGGGGGCTCATGCGAGGCGACGAACGCGACAGAGATGATTTTGAGCGCGATCGATCCGTGCTGCAGCCC
ACGACGCCTCGGACTCCAGGTCGTCACGAGAGGGAGCGCGGAGATCGGGATCGCAGCTACTCCAACTCGGAGACG
TCGATAGATAGCATTCCACGACGCACAGCAACGCTGCGGCGGGTGCCTGGGGAGACGAGCACACAGGTACAGAGC
GACCTTGGGGGCAGCATGGTGCTTGAATTTGAGATTTTCATCGTCAAAGTTCCATTGCTTTCGCTGCATGGAATT
CAATTCAAGAGGATGACGGGCAATACATGGCAGTACAAAAACATGGCGGATCAAATCCTTCGAGAGCTCAGGCTA
TAG
Gene >OphauB2|912
ATGACAACCACGGCGTCCCCAGGAGCACCGGCAGATTACTCGTCTCGAGCGGGCCCATCCCGGTCCTACTCAGCA
TCAGCAGCACCAGCACGCTCCTCCCACTCTCAATCTCGGGCCCCTCCCGCTGCGTCTGCGGGCGTCTCTTCAGCC
CATCATCCGTCGCTGCCTCTTTCCGCCGCAGCCACGACTTCGACCACGTCGTCCAACCACAATCACAACCACCAC
CATCAGCATCAATCGTCAGCCACTCTGCACCGCCATCAGCGTCGACGCAGTTCGTCTTCGTCTCGCCCTATTCAA
GACGTGCTTCCTCAACATGATTACGAAACGTCGCATCTAGCCTCGTATTCAAAGCGCAGCATCAGCCGAGAGAGG
GATCGTGAACGCATTCGCGACCACGAACGCGACGGTGACCGCCATCGCAATCGCGACCGCGAACGTCCCCCGACC
GCAACAAGGAGTGCTGACTCGTCGTCGCGCCCGCCACGTCGCCGCAGCAGTACACGTTCTAATCATCACCACCAT
AATCACTATTACGACTCTTGTAGCATGCCCCCCGCCGCTGTGCCCAGCAATGGGCCTCCGCACACGGCTACTGTC
TCTCATACAGTCCAAGATGCACCTCAGCAGCACAAGCAGACACGGTCGCGTACTACTATTCCCACTCAGTCTGGA
AAATGGATCCTTGGCAAGACTATAGGTGCCGGCAGCATGGGCAAGGTCAAGCTGGCTCGCAAAGAGGACGGCACG
GAACAGGTTGGTCAATTCCTTGGCTTTTTGCCACTATCCTGGCCTAACCCTACGAATTTGTGCTTACGCTGCGCC
CCCTTTCTTCCCCCCCGCTCGTACTAGGTTGCGTGTAAAATCGTTCCCCGTGGCTCGACCGATGACGGCCATCAA
AGCCGCGCCGACAAGGAGCGCGCCGATCAATCCAAGGAGATTCGCACTGCTCGCGAGGCCGCAATCGTCACTCTC
CTCAACCACCCCCACATTTGCGGAATGCGCGATGTGGTGCGCACAAATTATCATTGGTACATGCTTTTTGAGTAT
GTCAACGGCGGCCAGATGCTCGATTACATCATTTCACACGGCAAGCTTAAGGAGAAGCAAGCCCGCAAGTTTAGT
CGTCAGATAGCATCGGCTCTCGATTACTGCCATCGCAACAGCATCGTTCACAGAGATCTCAAAATTGAAAACATT
CTCATCAGCAAGACTGGCGATATCAAAATCATTGACTTTGGCCTTAGCAATCTCTTTTCTCCTCGCGGGCACCTC
AAGACTTTTTGCGGCAGTCTGTACTTTGCCGCCCCTGAGCTTCTACAGGCCAGGGCTTACACAGGCCCCGAAGTT
GATGTATGGAGTTTTGGCATTGTTCTATACGTCCTCGTTTGTGGTAAGGTGCCATTCGATGACCAGAGCATGCCA
GCTCTCCACGCAAAAATCAAAAAAGGCCTCGTCGACTATCCCACATGGCTCTCGAGCGGTATGCAATCTTGCTCC
CTCCACTCGTTCTCGTGCTACCCATGTAGCCTCTTCTCCCTCAACCTCGTCAATCAATAAAGGAAGATGAGCTAA
TCATACCTGCTACAATAAGAATGCAAACACCTCATGTCGCGAATGCTAGTGACAGACCCTAAGCAACGGGCCACC
ATGCAAGAAGTCATGAATCACCCCTGGATGACCAAGGGCTTCAATGGCCCGCCTGATAACTATCTCCCCGCTCGC
GAGCCCTTGTCGCATCCGTTAGATTCAGAAGCGATTCTTGCCATGCATGGCTTCAATTTTGGCACTCCCGAAAAT
ATCAAGTCTCAATTGACTAAGATCATCGAGTCCGAAGAGTACCAGCAATCCATCAAGACATACCAGAAGGAGCGA
GAGATGCCACAGCTTCATAGGGACGCGGAGAAGCGGCGAGGCTTTGGCTTCGATTTTTACAAACGTCGCAACTCG
GGCAACAGTCGCGATACTCTATCAGGTCCGAGCTCGGAGGCCTTGCAACTGGGATCCGACCCGCTTTACGCCTTT
AGTCCTCTTTTATCCATATACTATCTAGTCAAGGAGAAGCAGGAACGCGAACATGGCGAAATGTCGCAACATGCT
ACTGCCGTGGCATCACCGCGTGACAGAGATAAGGAAAAGGCAGCGGCCGTCATGGCCGACGTCATATCTGAGCCA
GCACCACCTCAAGCTGCCTACACCAATTCGGCTGCTTTTGAAATGCCAGGAGAAAAGCCGACGGGTGGCCGAACA
AGACCGCGGGCTCGCACACACGGCGAAGATGACGCTCCAGACACATCTAGACTTGCTCCACACCATCATCAAGCT
CCATTTCATGGCGCGCCGCCTGTGCCACCGCCTCCTCCTCCCGAAACCAGGGCAGATCATCTTCAGAAGAAAGAA
GGCACGGCAGCAGGTCTGCTTCGCCGGTTCAGCACACGCAAGCGGAGGGATCCAGATCGCCTAGAGAAGGACCGG
TCTCACCCGCCCACGGTGCAGATTCACTCTCCCGCAGAAGCGTCGCCAGTCACTCCGAAGAAGAGCTTCAGTATC
CGTCGTGGCCGACAAAATCAGGACAGTACCGCGCCAGTAATACGTTCGGCCGGTAGCCAGCCACAGCATAGTGAA
TTACTCAGCCCACCGGTATCCGCTAGTGATACGCGGGACCATAGGAGATCAGGTCTCGGCCGGTCGACAAGCGTT
AACTCTGCTGATATTCGTCGACCGCGTGGAGGTGTAGGCCGTGTCGTCAAGGACACTGTACCAGCAATGCCGGTG
ACGAGCGGCTCCGATCAGTCCGTCACAACAAGAGAAATGCCAGCTCTTGCTGTACAGCAGCAACATCAGCAGCAA
CATCAGCAACAGCAGCAACAGCAGCAACAGACTTCTCAAAGAGGTCTGACGCAGTCCAGATCGATTAACTTGAGA
GCCAAGTCTCTGGGACACGCTCGCCGGGAGAGTATCCAACGTCGGCGACTTAGGAAAGAGGGGAGTTCACAGGAA
GCTGATGTTCCAGAAGAGACGGACATGGACCAGGAGCAGGATCAGGAGCAATGCGGCACGTCAGTTGAGCGACTT
GACAGCTCAGACCTAGCAAAGCCGGTATATCTCAAAGGGCTGTTTAGCGTGTCCACCACGTCGGGAAAGTCTGTA
CCAGCAATCCGGACCGACATCAAACGAGTGCTGCGTCAGCTTAATGTGGACTATGTTGAGATTAGGGGCGGCTTT
AGCTGCAGGCATGCGCCCAGCATTGACTTGCACAAAGTACAGGACCCAGCTGGAAGTCCAACGGCGCAAATGCCC
GGCCATCGACGGCGGTTCAGCTTCGGGGGGCTCATGCGAGGCGACGAACGCGACAGAGATGATTTTGAGCGCGAT
CGATCCGTGCTGCAGCCCACGACGCCTCGGACTCCAGGTCGTCACGAGAGGGAGCGCGGAGATCGGGATCGCAGC
TACTCCAACTCGGAGACGTCGATAGATAGCATTCCACGACGCACAGCAACGCTGCGGCGGGTGCCTGGGGAGACG
AGCACACAGGTACAGAGCGACCTTGGGGGCAGCATGGTGCTTGAATTTGAGATTTTCATCGTCAAAGTTCCATTG
CTTTCGCTGCATGGAATTCAATTCAAGAGGATGACGGGCAATACATGGCAGTACAAAAACATGGCGGATCAAATC
CTTCGAGAGCTCAGGCTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail