Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|907
Gene name
LocationContig_12:167159..168219
Strand+
Gene length (bp)1060
Transcript length (bp)933
Coding sequence length (bp)933
Protein length (aa) 311

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06966 DUF1295 Protein of unknown function (DUF1295) 9.7E-33 79 237
PF06966 DUF1295 Protein of unknown function (DUF1295) 1.2E-05 259 302

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 44 66 22
3 88 110 22
4 130 152 22
5 162 184 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|907
MLDLLRLTSFRSPLLRTLVPSVAAAFALQACVAVPSVAAQSERFYDVSGSATVLAVGALSLYLPALRARAAGEPV
QLAFWHMWRWWSLRQVLVTGLAAVWTLRLGSYLFARILAHGHDSRFDSLRSRPPAFFAAFMAQAAWVSAMLAPVI
ALNAVPPSVAPALLVSDVLGLALWAAGFGLEVAADAQKSKWAQAKRRKEHDQDFLSSGLFAWCRFPNYLGEITLW
SGIATIAAGALAQRPVQRALGFPSGPRGILATTALSFFSPVFSAYLITQVSGVPLTEQIYDERYGHRKDYKQWRH
NTPRLLPKIF*
Coding >OphauB2|907
ATGCTTGACCTCTTGCGCCTAACCAGCTTCCGCTCCCCGCTGCTGCGCACACTGGTGCCCTCTGTGGCCGCAGCT
TTTGCACTGCAAGCCTGCGTGGCGGTGCCCTCAGTGGCGGCGCAGTCGGAGCGCTTCTACGATGTATCGGGCTCG
GCAACGGTGCTGGCAGTCGGGGCGCTGAGCCTATATCTTCCAGCGCTGCGGGCGCGCGCGGCCGGCGAGCCGGTG
CAGCTGGCTTTCTGGCACATGTGGCGGTGGTGGAGCTTGAGACAGGTGCTTGTGACGGGCCTGGCGGCTGTGTGG
ACCTTGCGCCTTGGCTCATATCTCTTTGCCCGCATCCTCGCCCACGGCCACGACTCGCGCTTCGACTCGCTGCGC
TCTCGCCCGCCCGCCTTTTTCGCCGCCTTTATGGCCCAAGCCGCCTGGGTCTCGGCCATGCTGGCGCCCGTCATT
GCCCTCAACGCCGTGCCGCCCAGCGTCGCCCCCGCCCTCCTCGTGTCAGACGTGCTTGGCCTGGCCCTCTGGGCA
GCTGGCTTTGGGCTTGAAGTTGCTGCCGATGCGCAAAAGAGCAAATGGGCCCAGGCAAAGAGGCGCAAGGAGCAT
GACCAAGACTTTTTGTCGAGCGGCTTGTTTGCTTGGTGTCGCTTCCCAAACTACCTGGGCGAAATCACCCTTTGG
TCCGGTATTGCCACCATTGCCGCCGGCGCCCTCGCCCAGCGCCCTGTCCAGCGCGCCCTTGGCTTCCCCAGCGGC
CCACGCGGCATTCTAGCCACTACGGCTCTCTCCTTTTTCAGCCCAGTCTTTTCCGCCTACCTCATTACTCAAGTC
TCTGGAGTCCCGCTAACTGAGCAGATATATGATGAGCGCTACGGTCATCGCAAGGACTATAAGCAATGGCGACAT
AATACGCCTCGGCTATTGCCCAAGATTTTCTGA
Transcript >OphauB2|907
ATGCTTGACCTCTTGCGCCTAACCAGCTTCCGCTCCCCGCTGCTGCGCACACTGGTGCCCTCTGTGGCCGCAGCT
TTTGCACTGCAAGCCTGCGTGGCGGTGCCCTCAGTGGCGGCGCAGTCGGAGCGCTTCTACGATGTATCGGGCTCG
GCAACGGTGCTGGCAGTCGGGGCGCTGAGCCTATATCTTCCAGCGCTGCGGGCGCGCGCGGCCGGCGAGCCGGTG
CAGCTGGCTTTCTGGCACATGTGGCGGTGGTGGAGCTTGAGACAGGTGCTTGTGACGGGCCTGGCGGCTGTGTGG
ACCTTGCGCCTTGGCTCATATCTCTTTGCCCGCATCCTCGCCCACGGCCACGACTCGCGCTTCGACTCGCTGCGC
TCTCGCCCGCCCGCCTTTTTCGCCGCCTTTATGGCCCAAGCCGCCTGGGTCTCGGCCATGCTGGCGCCCGTCATT
GCCCTCAACGCCGTGCCGCCCAGCGTCGCCCCCGCCCTCCTCGTGTCAGACGTGCTTGGCCTGGCCCTCTGGGCA
GCTGGCTTTGGGCTTGAAGTTGCTGCCGATGCGCAAAAGAGCAAATGGGCCCAGGCAAAGAGGCGCAAGGAGCAT
GACCAAGACTTTTTGTCGAGCGGCTTGTTTGCTTGGTGTCGCTTCCCAAACTACCTGGGCGAAATCACCCTTTGG
TCCGGTATTGCCACCATTGCCGCCGGCGCCCTCGCCCAGCGCCCTGTCCAGCGCGCCCTTGGCTTCCCCAGCGGC
CCACGCGGCATTCTAGCCACTACGGCTCTCTCCTTTTTCAGCCCAGTCTTTTCCGCCTACCTCATTACTCAAGTC
TCTGGAGTCCCGCTAACTGAGCAGATATATGATGAGCGCTACGGTCATCGCAAGGACTATAAGCAATGGCGACAT
AATACGCCTCGGCTATTGCCCAAGATTTTCTGA
Gene >OphauB2|907
ATGCTTGACCTCTTGCGCCTAACCAGCTTCCGCTCCCCGCTGCTGCGCACACTGGTGCCCTCTGTGGCCGCAGCT
TTTGCACTGCAAGCCTGCGTGGCGGTGCCCTCAGTGGCGGCGCAGTCGGAGCGCTTCTACGATGTATCGGGCTCG
GCAACGGTGCTGGCAGTCGGGGCGCTGAGCCTATATCTTCCAGCGCTGCGGGCGCGCGCGGCCGGCGAGCCGGTG
CAGCTGGCTTTCTGGCACATGTGGCGGTGGTGGAGCTTGAGACAGGTGCTTGTGACGGGCCTGGCGGCTGTGTGG
ACCTTGCGCCGTAAGTCGTCTGCATTGTGCCTCTTGGCCCATCAAACACACCCGTCTTGACCTTGGCCAGTTGGC
TCATATCTCTTTGCCCGCATCCTCGCCCACGGCCACGACTCGCGCTTCGACTCGCTGCGCTCTCGCCCGCCCGCC
TTTTTCGCCGCCTTTATGGCCCAAGCCGCCTGGGTCTCGGCCATGCTGGCGCCCGTCATTGCCCTCAACGCCGTG
CCGCCCAGCGTCGCCCCCGCCCTCCTCGTGTCAGACGTGCTTGGCCTGGCCCTCTGGGCAGCTGGCTTTGGGCTT
GAAGTTGCTGCCGATGCGCAAAAGAGCAAATGGGCCCAGGCAAAGAGGCGCAAGGAGCATGACCAAGACTTTTTG
TCGAGCGGCTTGTTTGCTTGGTGGTGCGTCTGCTTCTCTTCCTTAGTCTTGGCCTGGCCATTTCTCTGCCATTGG
CTGACTTGGACCCAGTCGCTTCCCAAACTACCTGGGCGAAATCACCCTTTGGTCCGGTATTGCCACCATTGCCGC
CGGCGCCCTCGCCCAGCGCCCTGTCCAGCGCGCCCTTGGCTTCCCCAGCGGCCCACGCGGCATTCTAGCCACTAC
GGCTCTCTCCTTTTTCAGCCCAGTCTTTTCCGCCTACCTCATTACTCAAGTCTCTGGAGTCCCGCTAACTGAGCA
GATATATGATGAGCGCTACGGTCATCGCAAGGACTATAAGCAATGGCGACATAATACGCCTCGGCTATTGCCCAA
GATTTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail