Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|89
Gene name
LocationContig_1:221103..222645
Strand-
Gene length (bp)1542
Transcript length (bp)1395
Coding sequence length (bp)1395
Protein length (aa) 465

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 44 63 19
2 76 98 22
3 131 153 22
4 166 188 22
5 212 234 22
6 247 269 22
7 284 306 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|89
MDGLKGLNWTLIDEMANALTPEERAQGVWRIRNASKITMSDFKVAIGILFGIASLAFAGRLAIRLISRRRMLLDD
VLLIISYLSLTASTAIFYKRAWITYLVMALMRSDMVASLIASQQIADVFIQMNWSFSYITFLWTAIFMEKLCYLA
FFHTLLRCMPRGILRYYWVSVIFTIVAWIYMVLQQLITCPYFGASSTKCFPKLPISDSVLSFTFWTGPILDAITD
IAIISIPIIVVGKSQMSLATKIGYCVFLCLSLFMLACSITRAAGTYYQNSLDTPWQVFWLHAEACVGVLMASITV
YRSVLVGTHTSPQGFLLFMNKLAKLREQPKEHPESKPLTVRGRFGRFLLSKIPNAAFTGLYTMFGMGNNADGLTT
GTNLTTQGAESGYHDYLRGLEPRDRTRAPDAPCASGTTVSTAESNTRKPSKQPSPPGSLTAAILRFLLPRSQMPI
LQHRSIGTGREAGL*
Coding >OphauB2|89
ATGGACGGTTTGAAAGGATTGAATTGGACTTTAATCGACGAAATGGCTAATGCTCTGACACCCGAAGAAAGAGCT
CAGGGAGTGTGGAGAATTCGCAATGCGAGTAAAATCACCATGTCGGACTTCAAGGTTGCGATTGGTATTCTTTTT
GGCATTGCATCGCTGGCCTTTGCTGGTCGCCTTGCTATCCGGCTCATCTCTCGCCGGCGAATGCTACTGGATGAT
GTGTTACTCATCATTAGCTACCTATCACTCACTGCATCAACAGCGATATTTTACAAACGAGCCTGGATTACTTAC
CTTGTAATGGCCTTGATGAGGTCTGACATGGTGGCGTCTCTCATCGCCTCGCAGCAAATTGCCGACGTATTCATC
CAAATGAACTGGTCCTTTTCTTACATTACCTTTCTATGGACAGCCATCTTTATGGAAAAGCTTTGCTACTTGGCC
TTTTTCCACACACTCCTTCGCTGTATGCCAAGAGGCATCTTGCGATACTACTGGGTCTCCGTCATCTTTACCATA
GTTGCTTGGATCTACATGGTGCTGCAGCAGCTCATCACCTGTCCCTACTTTGGAGCTTCTTCAACTAAATGCTTT
CCAAAACTTCCTATATCGGACTCGGTTCTATCTTTTACGTTCTGGACCGGTCCGATTCTTGATGCTATAACAGAC
ATTGCAATCATCTCCATACCCATTATTGTGGTTGGCAAATCGCAAATGTCCCTGGCTACAAAAATCGGATATTGC
GTCTTTTTATGCCTCTCGCTCTTCATGCTTGCTTGCTCCATCACACGCGCAGCAGGCACCTATTACCAAAACTCG
CTGGACACGCCGTGGCAGGTATTTTGGCTACATGCTGAGGCCTGTGTAGGCGTGTTGATGGCATCTATTACCGTC
TATCGATCTGTCCTAGTCGGTACACATACCTCTCCTCAAGGCTTCTTGCTGTTTATGAACAAGCTCGCCAAGTTG
CGCGAGCAACCCAAGGAGCACCCGGAAAGCAAACCACTTACTGTGCGCGGGCGTTTTGGCCGTTTTCTCCTTTCC
AAAATCCCAAACGCCGCATTTACAGGGCTATACACCATGTTTGGCATGGGCAACAACGCAGATGGCCTAACAACA
GGCACCAACTTGACCACGCAGGGCGCAGAGTCGGGCTATCATGACTACCTTCGAGGCTTGGAACCAAGAGACCGG
ACGCGAGCTCCAGATGCTCCATGTGCTTCAGGTACAACCGTTAGTACTGCCGAGAGTAACACACGGAAGCCGTCG
AAGCAGCCATCTCCCCCCGGGAGCTTGACCGCCGCGATCCTTCGCTTTTTACTCCCCCGGTCGCAGATGCCTATC
TTGCAACACAGGTCGATTGGCACAGGAAGAGAAGCTGGTCTTTGA
Transcript >OphauB2|89
ATGGACGGTTTGAAAGGATTGAATTGGACTTTAATCGACGAAATGGCTAATGCTCTGACACCCGAAGAAAGAGCT
CAGGGAGTGTGGAGAATTCGCAATGCGAGTAAAATCACCATGTCGGACTTCAAGGTTGCGATTGGTATTCTTTTT
GGCATTGCATCGCTGGCCTTTGCTGGTCGCCTTGCTATCCGGCTCATCTCTCGCCGGCGAATGCTACTGGATGAT
GTGTTACTCATCATTAGCTACCTATCACTCACTGCATCAACAGCGATATTTTACAAACGAGCCTGGATTACTTAC
CTTGTAATGGCCTTGATGAGGTCTGACATGGTGGCGTCTCTCATCGCCTCGCAGCAAATTGCCGACGTATTCATC
CAAATGAACTGGTCCTTTTCTTACATTACCTTTCTATGGACAGCCATCTTTATGGAAAAGCTTTGCTACTTGGCC
TTTTTCCACACACTCCTTCGCTGTATGCCAAGAGGCATCTTGCGATACTACTGGGTCTCCGTCATCTTTACCATA
GTTGCTTGGATCTACATGGTGCTGCAGCAGCTCATCACCTGTCCCTACTTTGGAGCTTCTTCAACTAAATGCTTT
CCAAAACTTCCTATATCGGACTCGGTTCTATCTTTTACGTTCTGGACCGGTCCGATTCTTGATGCTATAACAGAC
ATTGCAATCATCTCCATACCCATTATTGTGGTTGGCAAATCGCAAATGTCCCTGGCTACAAAAATCGGATATTGC
GTCTTTTTATGCCTCTCGCTCTTCATGCTTGCTTGCTCCATCACACGCGCAGCAGGCACCTATTACCAAAACTCG
CTGGACACGCCGTGGCAGGTATTTTGGCTACATGCTGAGGCCTGTGTAGGCGTGTTGATGGCATCTATTACCGTC
TATCGATCTGTCCTAGTCGGTACACATACCTCTCCTCAAGGCTTCTTGCTGTTTATGAACAAGCTCGCCAAGTTG
CGCGAGCAACCCAAGGAGCACCCGGAAAGCAAACCACTTACTGTGCGCGGGCGTTTTGGCCGTTTTCTCCTTTCC
AAAATCCCAAACGCCGCATTTACAGGGCTATACACCATGTTTGGCATGGGCAACAACGCAGATGGCCTAACAACA
GGCACCAACTTGACCACGCAGGGCGCAGAGTCGGGCTATCATGACTACCTTCGAGGCTTGGAACCAAGAGACCGG
ACGCGAGCTCCAGATGCTCCATGTGCTTCAGGTACAACCGTTAGTACTGCCGAGAGTAACACACGGAAGCCGTCG
AAGCAGCCATCTCCCCCCGGGAGCTTGACCGCCGCGATCCTTCGCTTTTTACTCCCCCGGTCGCAGATGCCTATC
TTGCAACACAGGTCGATTGGCACAGGAAGAGAAGCTGGTCTTTGA
Gene >OphauB2|89
ATGGACGGTTTGAAAGGATTGAATTGGACTTTAATCGACGAAATGGCTAATGCTCTGACACCCGAAGAAAGAGCT
CAGGGAGTGTGGAGAATTCGCAATGCGAGTAAAATCACCATGTCGGACTTCAAGGTTGCGATTGGTATTCTTTTT
GGCATTGCATCGCTGGCCTTTGCTGGTCGCCTTGCTATCCGGCTCATCTCTCGCCGGCGAATGCTACTGGATGAT
GTGTTACTCATCATTAGCTACCTATCACTCACTGCATCAACAGCGATATTTTACAAACGAGCCTGGATTACTTAC
CTTGTAATGGCCTTGATGAGGTCTGACATGGTGGCGTCTCTCATCGCCTCGCAGCAAATTGCCGACGTATTCATC
CAAATGAACTGGTCCTTTTCTTACATTACCTTTCTATGGACAGCCATCTTTATGGAAAAGCTTTGCTACTTGGCC
TTTTTCCACACACTCCTTCGCTGTATGCCAAGAGGCATCTTGCGATACTACTGGGTCTCCGTCATCTTTACCATA
GTTGCTTGGATCTACATGGTGCTGCAGCAGCTCATCACCTGTCCCTACTTTGGAGCTTCTTCAAGTATAAAGTTG
CATGCCGCGCCGCATATTTCAATGACGCTAATACAGGGCCCTGTTTAGCTAAATGCTTTCCAAAACTTCCTATAT
CGGACTCGGTTCTATCTTTTACGTTCTGGACCGGTCCGATTCTTGATGCTATAACAGACATTGCAAGTAAGCAAG
GAAACCACCCTCCTTGTTTGGTCCTGCAAAGCCCAGACGTGACGGTTCCACATTTATCTGACGGCATTTGTATTA
ATAGTCATCTCCATACCCATTATTGTGGTTGGCAAATCGCAAATGTCCCTGGCTACAAAAATCGGATATTGCGTC
TTTTTATGCCTCTCGCTCTTCATGCTTGCTTGCTCCATCACACGCGCAGCAGGCACCTATTACCAAAACTCGCTG
GACACGCCGTGGCAGGTATTTTGGCTACATGCTGAGGCCTGTGTAGGCGTGTTGATGGCATCTATTACCGTCTAT
CGATCTGTCCTAGTCGGTACACATACCTCTCCTCAAGGCTTCTTGCTGTTTATGAACAAGCTCGCCAAGTTGCGC
GAGCAACCCAAGGAGCACCCGGAAAGCAAACCACTTACTGTGCGCGGGCGTTTTGGCCGTTTTCTCCTTTCCAAA
ATCCCAAACGCCGCATTTACAGGGCTATACACCATGTTTGGCATGGGCAACAACGCAGATGGCCTAACAACAGGC
ACCAACTTGACCACGCAGGGCGCAGAGTCGGGCTATCATGACTACCTTCGAGGCTTGGAACCAAGAGACCGGACG
CGAGCTCCAGATGCTCCATGTGCTTCAGGTACAACCGTTAGTACTGCCGAGAGTAACACACGGAAGCCGTCGAAG
CAGCCATCTCCCCCCGGGAGCTTGACCGCCGCGATCCTTCGCTTTTTACTCCCCCGGTCGCAGATGCCTATCTTG
CAACACAGGTCGATTGGCACAGGAAGAGAAGCTGGTCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail