Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|888
Gene name
LocationContig_12:101867..103889
Strand-
Gene length (bp)2022
Transcript length (bp)1920
Coding sequence length (bp)1920
Protein length (aa) 640

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11626 Rap1_C TRF2-interacting telomeric protein/Rap1 - C terminal domain 7.5E-21 534 633
PF08914 Myb_DNA-bind_2 Rap1 Myb domain 2.8E-15 113 167
PF16589 BRCT_2 BRCT domain, a BRCA1 C-terminus domain 5.6E-09 16 91

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|888
MASSPSLEDSGASQGAQIFDGLSFWVSNQVPMRKSILDNITDNGGQVVKLENQADYRIADHAKKNAPPASLSWNF
IVDSVKYGCVQLTDHYSIGPDPDAPRPAGSHGAARKLRVGYSREDDAALARWVVANNVGPLMGNHMYKDFEKENS
RHTWQSWRNRFKTKLQPMGWEAIERLAGTRPPPNDSVHDAARQDNKAFSPSSASKRNDDAHEKHFWKEFEIYVDV
CEVEIEPHHSIERKTISLWQLYRAVETQAALVGEVDWFRVATELGYRVTPNSTVPRRLQSCYDANLAEFCDSMHA
QTPQEDEEGGEAPGYKAGQVADRGTSHQELPQQSPAQEASDQDESESEAFGTPLPGRASPSTKKRALDFGSARET
INQAKRRQRYGPEAEIPSTPDEIIGLGRRPSVEATPSSRGASQQQRLVEDTDGSIALTRSLTKQNTGDVTPSQQL
QRENWAVSPIPLRLDLAPRSGQGEAGVERQASPSQHVHNEAPRPSLRDTTPAGYGPSPPKVAKPMKQGSPQKDQL
ESIEDWVEHYQSLGYTHDVVVQGLRRTTMKPGGLATLVMERISKGEGVPSHYAGIWTDDDDESLWLADHYEAREE
AGVTKMAKRAAKEMRRLLRKHGRQGIDLRRRFLDAQSNM*
Coding >OphauB2|888
ATGGCCTCTTCTCCTTCTCTCGAAGACAGTGGCGCAAGCCAAGGTGCCCAAATATTCGACGGCCTAAGTTTCTGG
GTTTCTAACCAAGTGCCCATGCGCAAAAGCATTCTGGACAACATCACAGACAATGGCGGCCAAGTGGTCAAACTA
GAAAACCAAGCCGACTATCGCATTGCCGACCACGCAAAGAAGAACGCTCCCCCGGCCTCCCTCTCGTGGAACTTC
ATCGTCGACTCGGTCAAGTACGGGTGCGTACAGCTGACGGACCACTACTCCATCGGCCCAGACCCCGATGCTCCC
AGGCCGGCAGGCTCACATGGTGCAGCGAGGAAGCTGAGGGTTGGATACAGCCGTGAGGATGATGCTGCTTTGGCT
CGCTGGGTGGTGGCCAATAATGTTGGTCCGCTCATGGGCAACCACATGTATAAAGACTTTGAGAAGGAGAACTCA
AGACATACATGGCAGTCATGGCGCAATCGATTCAAGACGAAACTGCAGCCAATGGGTTGGGAAGCCATTGAAAGA
CTTGCAGGCACGAGACCGCCACCCAACGACAGCGTGCATGATGCAGCCAGACAGGATAACAAGGCTTTCAGCCCA
TCTTCTGCATCAAAACGAAACGATGACGCCCACGAGAAGCATTTCTGGAAGGAATTTGAAATCTACGTCGATGTA
TGCGAGGTGGAGATTGAACCACACCATAGCATCGAACGCAAGACGATAAGCCTCTGGCAGCTCTACCGCGCTGTT
GAGACACAGGCTGCCCTTGTTGGGGAAGTGGATTGGTTTCGGGTAGCAACCGAGCTTGGATATCGTGTTACACCC
AATTCCACTGTTCCTCGCCGGTTACAGAGTTGCTACGATGCCAATCTTGCAGAGTTTTGCGACTCGATGCATGCA
CAAACGCCTCAAGAGGACGAGGAGGGTGGAGAAGCACCAGGTTACAAAGCAGGTCAAGTAGCAGACCGGGGGACA
TCACATCAGGAGCTACCACAACAATCACCAGCTCAAGAAGCATCAGACCAAGATGAAAGCGAATCCGAGGCCTTT
GGTACGCCGTTACCTGGTCGAGCGTCACCAAGTACTAAGAAGCGCGCTCTTGACTTTGGCTCGGCAAGAGAGACT
ATTAATCAGGCCAAACGGCGGCAAAGATATGGCCCAGAAGCTGAAATTCCTTCGACACCAGACGAAATCATTGGA
CTCGGGCGCCGCCCGTCAGTGGAAGCCACGCCATCCTCTAGAGGGGCGAGTCAGCAACAACGCCTTGTAGAGGAC
ACAGATGGGAGCATTGCTTTGACTCGCTCCTTGACAAAGCAGAACACGGGGGACGTGACGCCATCTCAACAATTG
CAACGTGAAAACTGGGCCGTAAGCCCGATACCGCTTCGGCTGGATCTTGCACCTCGCAGCGGGCAAGGAGAGGCC
GGTGTGGAGAGGCAAGCCTCCCCATCACAGCATGTGCATAACGAGGCTCCAAGGCCAAGTTTGAGGGATACAACA
CCAGCTGGATATGGCCCATCACCGCCAAAAGTCGCCAAGCCCATGAAGCAAGGCTCACCGCAAAAAGATCAACTC
GAAAGCATCGAGGATTGGGTGGAGCACTATCAGTCGCTTGGCTATACGCACGACGTTGTAGTTCAGGGGCTGAGA
CGAACGACGATGAAGCCCGGCGGGCTGGCAACCTTGGTCATGGAGCGCATCAGCAAGGGCGAGGGCGTGCCGTCT
CATTACGCGGGCATTTGGACCGACGATGACGACGAGAGTTTGTGGCTGGCGGATCATTACGAGGCCAGGGAGGAG
GCGGGTGTGACCAAGATGGCCAAGAGGGCGGCAAAGGAGATGCGACGGCTGCTGCGCAAGCACGGTCGCCAAGGT
ATTGATTTGAGAAGACGTTTCTTGGATGCACAGAGCAACATGTAG
Transcript >OphauB2|888
ATGGCCTCTTCTCCTTCTCTCGAAGACAGTGGCGCAAGCCAAGGTGCCCAAATATTCGACGGCCTAAGTTTCTGG
GTTTCTAACCAAGTGCCCATGCGCAAAAGCATTCTGGACAACATCACAGACAATGGCGGCCAAGTGGTCAAACTA
GAAAACCAAGCCGACTATCGCATTGCCGACCACGCAAAGAAGAACGCTCCCCCGGCCTCCCTCTCGTGGAACTTC
ATCGTCGACTCGGTCAAGTACGGGTGCGTACAGCTGACGGACCACTACTCCATCGGCCCAGACCCCGATGCTCCC
AGGCCGGCAGGCTCACATGGTGCAGCGAGGAAGCTGAGGGTTGGATACAGCCGTGAGGATGATGCTGCTTTGGCT
CGCTGGGTGGTGGCCAATAATGTTGGTCCGCTCATGGGCAACCACATGTATAAAGACTTTGAGAAGGAGAACTCA
AGACATACATGGCAGTCATGGCGCAATCGATTCAAGACGAAACTGCAGCCAATGGGTTGGGAAGCCATTGAAAGA
CTTGCAGGCACGAGACCGCCACCCAACGACAGCGTGCATGATGCAGCCAGACAGGATAACAAGGCTTTCAGCCCA
TCTTCTGCATCAAAACGAAACGATGACGCCCACGAGAAGCATTTCTGGAAGGAATTTGAAATCTACGTCGATGTA
TGCGAGGTGGAGATTGAACCACACCATAGCATCGAACGCAAGACGATAAGCCTCTGGCAGCTCTACCGCGCTGTT
GAGACACAGGCTGCCCTTGTTGGGGAAGTGGATTGGTTTCGGGTAGCAACCGAGCTTGGATATCGTGTTACACCC
AATTCCACTGTTCCTCGCCGGTTACAGAGTTGCTACGATGCCAATCTTGCAGAGTTTTGCGACTCGATGCATGCA
CAAACGCCTCAAGAGGACGAGGAGGGTGGAGAAGCACCAGGTTACAAAGCAGGTCAAGTAGCAGACCGGGGGACA
TCACATCAGGAGCTACCACAACAATCACCAGCTCAAGAAGCATCAGACCAAGATGAAAGCGAATCCGAGGCCTTT
GGTACGCCGTTACCTGGTCGAGCGTCACCAAGTACTAAGAAGCGCGCTCTTGACTTTGGCTCGGCAAGAGAGACT
ATTAATCAGGCCAAACGGCGGCAAAGATATGGCCCAGAAGCTGAAATTCCTTCGACACCAGACGAAATCATTGGA
CTCGGGCGCCGCCCGTCAGTGGAAGCCACGCCATCCTCTAGAGGGGCGAGTCAGCAACAACGCCTTGTAGAGGAC
ACAGATGGGAGCATTGCTTTGACTCGCTCCTTGACAAAGCAGAACACGGGGGACGTGACGCCATCTCAACAATTG
CAACGTGAAAACTGGGCCGTAAGCCCGATACCGCTTCGGCTGGATCTTGCACCTCGCAGCGGGCAAGGAGAGGCC
GGTGTGGAGAGGCAAGCCTCCCCATCACAGCATGTGCATAACGAGGCTCCAAGGCCAAGTTTGAGGGATACAACA
CCAGCTGGATATGGCCCATCACCGCCAAAAGTCGCCAAGCCCATGAAGCAAGGCTCACCGCAAAAAGATCAACTC
GAAAGCATCGAGGATTGGGTGGAGCACTATCAGTCGCTTGGCTATACGCACGACGTTGTAGTTCAGGGGCTGAGA
CGAACGACGATGAAGCCCGGCGGGCTGGCAACCTTGGTCATGGAGCGCATCAGCAAGGGCGAGGGCGTGCCGTCT
CATTACGCGGGCATTTGGACCGACGATGACGACGAGAGTTTGTGGCTGGCGGATCATTACGAGGCCAGGGAGGAG
GCGGGTGTGACCAAGATGGCCAAGAGGGCGGCAAAGGAGATGCGACGGCTGCTGCGCAAGCACGGTCGCCAAGGT
ATTGATTTGAGAAGACGTTTCTTGGATGCACAGAGCAACATGTAG
Gene >OphauB2|888
ATGGCCTCTTCTCCTTCTCTCGAAGACAGTGGCGCAAGCCAAGGTGCCCAAATATTCGACGGCCTAAGTTTCTGG
GTTTCTAACCAAGTGCCCATGCGCAAAAGCATTCTGGACAACATCACAGCAAGTTGCGCAGTCTGCTACCTTCCA
AACCTATACTAACAATCGACAAGGACAATGGCGGCCAAGTGGTCAAACTAGAAAACCAAGCCGACTATCGCATTG
CCGACCACGCAAAGAAGAACGCTCCCCCGGCCTCCCTCTCGTGGAACTTCATCGTCGACTCGGTCAAGTACGGGT
GCGTACAGCTGACGGACCACTACTCCATCGGCCCAGACCCCGATGCTCCCAGGCCGGCAGGCTCACATGGTGCAG
CGAGGAAGCTGAGGGTTGGATACAGCCGTGAGGATGATGCTGCTTTGGCTCGCTGGGTGGTGGCCAATAATGTTG
GTCCGCTCATGGGCAACCACATGTATAAAGACTTTGAGAAGGAGGTGAGTTGCTTCCTTCTGCGCTTGACTCGAC
CACCTGCTAACGCTTCTCAAGAACTCAAGACATACATGGCAGTCATGGCGCAATCGATTCAAGACGAAACTGCAG
CCAATGGGTTGGGAAGCCATTGAAAGACTTGCAGGCACGAGACCGCCACCCAACGACAGCGTGCATGATGCAGCC
AGACAGGATAACAAGGCTTTCAGCCCATCTTCTGCATCAAAACGAAACGATGACGCCCACGAGAAGCATTTCTGG
AAGGAATTTGAAATCTACGTCGATGTATGCGAGGTGGAGATTGAACCACACCATAGCATCGAACGCAAGACGATA
AGCCTCTGGCAGCTCTACCGCGCTGTTGAGACACAGGCTGCCCTTGTTGGGGAAGTGGATTGGTTTCGGGTAGCA
ACCGAGCTTGGATATCGTGTTACACCCAATTCCACTGTTCCTCGCCGGTTACAGAGTTGCTACGATGCCAATCTT
GCAGAGTTTTGCGACTCGATGCATGCACAAACGCCTCAAGAGGACGAGGAGGGTGGAGAAGCACCAGGTTACAAA
GCAGGTCAAGTAGCAGACCGGGGGACATCACATCAGGAGCTACCACAACAATCACCAGCTCAAGAAGCATCAGAC
CAAGATGAAAGCGAATCCGAGGCCTTTGGTACGCCGTTACCTGGTCGAGCGTCACCAAGTACTAAGAAGCGCGCT
CTTGACTTTGGCTCGGCAAGAGAGACTATTAATCAGGCCAAACGGCGGCAAAGATATGGCCCAGAAGCTGAAATT
CCTTCGACACCAGACGAAATCATTGGACTCGGGCGCCGCCCGTCAGTGGAAGCCACGCCATCCTCTAGAGGGGCG
AGTCAGCAACAACGCCTTGTAGAGGACACAGATGGGAGCATTGCTTTGACTCGCTCCTTGACAAAGCAGAACACG
GGGGACGTGACGCCATCTCAACAATTGCAACGTGAAAACTGGGCCGTAAGCCCGATACCGCTTCGGCTGGATCTT
GCACCTCGCAGCGGGCAAGGAGAGGCCGGTGTGGAGAGGCAAGCCTCCCCATCACAGCATGTGCATAACGAGGCT
CCAAGGCCAAGTTTGAGGGATACAACACCAGCTGGATATGGCCCATCACCGCCAAAAGTCGCCAAGCCCATGAAG
CAAGGCTCACCGCAAAAAGATCAACTCGAAAGCATCGAGGATTGGGTGGAGCACTATCAGTCGCTTGGCTATACG
CACGACGTTGTAGTTCAGGGGCTGAGACGAACGACGATGAAGCCCGGCGGGCTGGCAACCTTGGTCATGGAGCGC
ATCAGCAAGGGCGAGGGCGTGCCGTCTCATTACGCGGGCATTTGGACCGACGATGACGACGAGAGTTTGTGGCTG
GCGGATCATTACGAGGCCAGGGAGGAGGCGGGTGTGACCAAGATGGCCAAGAGGGCGGCAAAGGAGATGCGACGG
CTGCTGCGCAAGCACGGTCGCCAAGGTATTGATTTGAGAAGACGTTTCTTGGATGCACAGAGCAACATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail