Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|877
Gene name
LocationContig_12:62556..64256
Strand+
Gene length (bp)1700
Transcript length (bp)1488
Coding sequence length (bp)1488
Protein length (aa) 496

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00465 Fe-ADH Iron-containing alcohol dehydrogenase 1.3E-101 75 469
PF13685 Fe-ADH_2 Iron-containing alcohol dehydrogenase 2.9E-12 79 173

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4QQW3|HOT_RAT Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Rattus norvegicus GN=Adhfe1 PE=1 SV=1 10 493 7.0E-165
sp|Q8R0N6|HOT_MOUSE Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Mus musculus GN=Adhfe1 PE=1 SV=2 10 493 5.0E-163
sp|Q6P371|HOT_XENTR Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Xenopus tropicalis GN=adhfe1 PE=2 SV=1 60 493 1.0E-160
sp|Q08B39|HOT_XENLA Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Xenopus laevis GN=adhfe1 PE=2 SV=1 18 493 8.0E-159
sp|A6QP15|HOT_BOVIN Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Bos taurus GN=ADHFE1 PE=2 SV=1 10 493 4.0E-158
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4QQW3|HOT_RAT Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Rattus norvegicus GN=Adhfe1 PE=1 SV=1 10 493 7.0E-165
sp|Q8R0N6|HOT_MOUSE Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Mus musculus GN=Adhfe1 PE=1 SV=2 10 493 5.0E-163
sp|Q6P371|HOT_XENTR Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Xenopus tropicalis GN=adhfe1 PE=2 SV=1 60 493 1.0E-160
sp|Q08B39|HOT_XENLA Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Xenopus laevis GN=adhfe1 PE=2 SV=1 18 493 8.0E-159
sp|A6QP15|HOT_BOVIN Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Bos taurus GN=ADHFE1 PE=2 SV=1 10 493 4.0E-158
sp|Q5RF11|HOT_PONAB Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Pongo abelii GN=ADHFE1 PE=2 SV=1 10 493 2.0E-156
sp|Q8IWW8|HOT_HUMAN Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Homo sapiens GN=ADHFE1 PE=1 SV=1 63 493 8.0E-156
sp|Q17EN4|HOT_AEDAE Probable hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Aedes aegypti GN=AAEL003729 PE=3 SV=1 66 494 4.0E-154
sp|Q7Q547|HOT_ANOGA Probable hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Anopheles gambiae GN=AGAP006646 PE=3 SV=3 14 494 2.0E-153
sp|Q28XT3|HOT_DROPS Probable hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Drosophila pseudoobscura pseudoobscura GN=GA17444 PE=3 SV=2 30 494 3.0E-144
sp|Q9W265|HOT_DROME Probable hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Drosophila melanogaster GN=T3dh PE=2 SV=1 30 493 7.0E-143
sp|A8WTJ7|HOT_CAEBR Probable hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Caenorhabditis briggsae GN=CBG02769 PE=3 SV=1 64 494 1.0E-133
sp|Q54GJ7|HOT_DICDI Probable hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Dictyostelium discoideum GN=adhfe1 PE=3 SV=1 48 494 1.0E-131
sp|Q9U2M4|HOT_CAEEL Probable hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Caenorhabditis elegans GN=Y38F1A.6 PE=3 SV=1 64 494 2.0E-131
sp|P31005|MEDH_BACMT NAD-dependent methanol dehydrogenase OS=Bacillus methanolicus GN=mdh PE=1 SV=3 79 457 3.0E-50
sp|A4IP64|ADH1_GEOTN Long-chain-alcohol dehydrogenase 1 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=adh1 PE=1 SV=1 80 493 2.0E-42
sp|Q59477|DHAT_KLEPN 1,3-propanediol dehydrogenase OS=Klebsiella pneumoniae GN=dhaT PE=1 SV=1 79 450 1.0E-39
sp|P45513|DHAT_CITFR 1,3-propanediol dehydrogenase OS=Citrobacter freundii GN=dhaT PE=3 SV=1 79 450 3.0E-38
sp|P76553|EUTG_ECOLI Ethanolamine utilization protein EutG OS=Escherichia coli (strain K12) GN=eutG PE=3 SV=2 80 410 2.0E-36
sp|P71017|GBSB_BACSU Alcohol dehydrogenase OS=Bacillus subtilis (strain 168) GN=gbsB PE=1 SV=2 77 457 3.0E-35
sp|P41795|EUTG_SALTY Ethanolamine utilization protein EutG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=eutG PE=3 SV=2 80 456 1.0E-34
sp|Q09669|ADH4_SCHPO Alcohol dehydrogenase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=adh4 PE=2 SV=1 53 493 4.0E-34
sp|F8DVL8|ADH2_ZYMMA Alcohol dehydrogenase 2 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1) GN=adhB PE=3 SV=1 78 489 2.0E-33
sp|P0DJA2|ADH2_ZYMMO Alcohol dehydrogenase 2 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=adhB PE=1 SV=1 78 489 3.0E-33
sp|P0A9S2|FUCO_ECO57 Lactaldehyde reductase OS=Escherichia coli O157:H7 GN=fucO PE=3 SV=2 79 457 5.0E-31
sp|P0A9S1|FUCO_ECOLI Lactaldehyde reductase OS=Escherichia coli (strain K12) GN=fucO PE=1 SV=2 79 457 5.0E-31
sp|P37686|ADH2_ECOLI Probable alcohol dehydrogenase OS=Escherichia coli (strain K12) GN=yiaY PE=3 SV=4 72 493 9.0E-31
sp|P13604|ADH1_CLOSA NADPH-dependent butanol dehydrogenase OS=Clostridium saccharobutylicum GN=adh1 PE=3 SV=1 77 490 1.0E-30
sp|P38945|4HDB_CLOK5 NAD-dependent 4-hydroxybutyrate dehydrogenase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=4hbD PE=3 SV=1 108 469 2.0E-30
sp|A6ZTT5|ADH4_YEAS7 Alcohol dehydrogenase 4 OS=Saccharomyces cerevisiae (strain YJM789) GN=ADH4 PE=3 SV=2 79 495 2.0E-28
sp|P10127|ADH4_YEAST Alcohol dehydrogenase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH4 PE=1 SV=3 79 495 3.0E-28
sp|Q04944|ADHA_CLOAB NADH-dependent butanol dehydrogenase A OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=bdhA PE=1 SV=2 75 457 1.0E-26
sp|Q24803|ADH2_ENTHI Aldehyde-alcohol dehydrogenase 2 OS=Entamoeba histolytica GN=ADH2 PE=1 SV=1 90 455 2.0E-26
sp|Q9F282|ADHA_THEET Long-chain primary alcohol dehydrogenase AdhA OS=Thermoanaerobacter ethanolicus GN=adhA PE=1 SV=1 70 493 7.0E-25
sp|P33744|ADHE_CLOAB Aldehyde-alcohol dehydrogenase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=adhE PE=2 SV=3 101 403 7.0E-25
sp|P0A9Q7|ADHE_ECOLI Aldehyde-alcohol dehydrogenase OS=Escherichia coli (strain K12) GN=adhE PE=1 SV=2 95 459 2.0E-24
sp|P0A9Q8|ADHE_ECO57 Aldehyde-alcohol dehydrogenase OS=Escherichia coli O157:H7 GN=adhE PE=3 SV=2 95 459 2.0E-24
sp|Q04945|ADHB_CLOAB NADH-dependent butanol dehydrogenase B OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=bdhB PE=1 SV=1 75 457 4.0E-23
sp|Q9RCG0|MNO_AMYME Methanol:N,N-dimethyl-4-nitrosoaniline oxidoreductase OS=Amycolatopsis methanolica GN=mno PE=1 SV=1 79 413 1.0E-21
sp|C5MRT8|MNO_MYCS8 Methanol:N,N-dimethyl-4-nitrosoaniline oxidoreductase OS=Mycobacterium sp. (strain DSM 3803 / JC1) PE=1 SV=1 79 417 7.0E-20
sp|O05239|YUGJ_BACSU Probable NADH-dependent butanol dehydrogenase 1 OS=Bacillus subtilis (strain 168) GN=yugJ PE=3 SV=1 75 468 2.0E-19
sp|Q53062|MNO_RHOER Methanol:N,N-dimethyl-4-nitrosoaniline oxidoreductase OS=Rhodococcus erythropolis GN=thcE PE=1 SV=2 80 417 2.0E-18
sp|A4ISB9|ADH2_GEOTN Long-chain-alcohol dehydrogenase 2 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=adh2 PE=1 SV=1 75 459 8.0E-17
sp|Q46856|YQHD_ECOLI Alcohol dehydrogenase YqhD OS=Escherichia coli (strain K12) GN=yqhD PE=1 SV=1 96 458 2.0E-16
sp|O05240|YUGK_BACSU Probable NADH-dependent butanol dehydrogenase 2 OS=Bacillus subtilis (strain 168) GN=yugK PE=3 SV=1 75 459 5.0E-16
sp|Q93T12|TFDF_DELAC Maleylacetate reductase OS=Delftia acidovorans GN=tfdF PE=1 SV=2 77 455 2.0E-14
sp|P27101|TCBF_PSESQ Maleylacetate reductase OS=Pseudomonas sp. (strain P51) GN=tcbF PE=3 SV=1 77 455 2.0E-14
sp|P94135|TFDF2_CUPPJ Maleylacetate reductase 2 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tfdFII PE=1 SV=1 63 362 1.0E-12
sp|O30847|CLCE_PSEKB Maleylacetate reductase OS=Pseudomonas knackmussii (strain DSM 6978 / LMG 23759 / B13) GN=clcE PE=3 SV=1 79 459 2.0E-08
sp|O87612|CLCE_PSEAI Maleylacetate reductase OS=Pseudomonas aeruginosa GN=clcE PE=3 SV=1 79 459 3.0E-08
sp|P27137|TFDF1_CUPPJ Maleylacetate reductase 1 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tfdFI PE=3 SV=1 67 405 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|877
MVAPIRVVPSAATRASSLLRTVQFTHPPSCPCHCNPGYHQAPPSIIAHVGQAGRRHFATPLGGQPTEYAFEMAAS
SIRFGPGVTHEIGMDLKNLGARKVAVVTDATVDKLDAMEQVRHGLSRQAISFQVFSNVRVEPKDSSIQDAIDWSR
SHMPDVFVAVGGGSVIDTAKLMNLYAAYPDAPLLDFVNAPLGKGRPVDKPLKPLIAVPTTAGTGSETTGTAIFDL
VSKRAKTGVAHRNLKPTLGICDPINTRTMPAAVKASSGLDVLCHSLESWTAIPYNERTPRPTNPILRPAYQGANP
ISDIFSLHALKSTVKYLPRAIRDPEDFEAQTQMLLASTLAGIGFGNAGVHLCHGMSYPISGQNPGYKHSGYAVST
PIIPHGVSVAVTAPAVFRFTAASNPERHLQAAEAFGVDVSNVKKESAGEVLGEALTKFLAGLGDQPKGLQDLGFK
ADNIDALVDGTIPQERVLMLAPGLSKELQLEKEQLRKLFEESMTH*
Coding >OphauB2|877
ATGGTAGCACCAATCAGAGTCGTTCCCAGTGCCGCCACGCGCGCCTCCAGCCTGCTTCGTACGGTGCAGTTCACC
CATCCGCCATCATGCCCATGCCACTGCAACCCCGGCTACCATCAGGCGCCACCGAGCATCATTGCCCATGTGGGC
CAAGCCGGCCGCCGCCACTTTGCCACGCCTCTTGGAGGCCAGCCCACGGAATACGCCTTTGAAATGGCAGCCTCG
TCCATTCGCTTTGGGCCGGGAGTCACCCACGAGATTGGAATGGACTTGAAGAATCTCGGCGCCCGCAAAGTCGCC
GTCGTTACCGATGCTACCGTCGACAAACTCGACGCAATGGAGCAGGTCCGACACGGGCTATCTCGCCAAGCAATC
AGCTTCCAGGTCTTTTCCAACGTCAGGGTCGAGCCCAAGGACAGCTCCATCCAAGACGCCATTGACTGGTCGCGG
TCACACATGCCCGATGTCTTTGTCGCCGTCGGCGGCGGCTCTGTCATCGACACAGCCAAGCTTATGAACCTCTAT
GCCGCCTATCCCGATGCCCCTCTCCTCGACTTTGTCAATGCGCCTCTGGGCAAGGGCCGTCCGGTCGACAAGCCC
CTCAAGCCCCTCATAGCCGTGCCAACAACGGCTGGCACCGGCAGCGAGACAACCGGCACTGCCATCTTCGACCTC
GTTTCCAAACGCGCAAAGACTGGTGTTGCTCACCGAAACCTCAAACCCACCCTGGGCATCTGCGATCCTATCAAC
ACGAGAACCATGCCCGCAGCAGTCAAGGCTAGCTCTGGTCTCGATGTCCTCTGTCACTCACTCGAGTCTTGGACC
GCCATTCCCTACAACGAGCGCACGCCCCGGCCCACCAACCCCATTCTTCGGCCGGCATATCAGGGCGCCAACCCC
ATCTCCGACATTTTTTCTCTGCACGCGCTCAAAAGCACTGTCAAGTACCTGCCCCGCGCCATTCGTGACCCCGAG
GATTTTGAGGCGCAAACACAAATGCTTCTTGCGTCAACTCTTGCCGGAATCGGCTTTGGTAATGCAGGCGTTCAT
TTATGCCACGGCATGTCTTACCCCATTTCGGGACAAAATCCGGGATACAAGCACTCGGGATACGCTGTTTCAACC
CCCATTATTCCCCACGGAGTCTCTGTTGCCGTCACAGCACCTGCTGTATTCCGCTTCACGGCCGCATCCAACCCG
GAGCGCCACCTACAGGCAGCTGAGGCGTTTGGCGTAGACGTGTCCAATGTGAAAAAGGAGAGTGCGGGTGAAGTC
TTGGGTGAAGCACTGACAAAGTTCCTTGCCGGACTTGGTGACCAGCCCAAGGGGCTCCAAGACCTCGGCTTCAAG
GCAGACAACATCGATGCATTGGTTGATGGCACTATTCCGCAGGAGCGCGTATTAATGCTCGCGCCTGGCCTTTCC
AAGGAGCTGCAGCTAGAGAAGGAACAGTTGCGGAAGCTGTTTGAGGAATCCATGACGCACTAG
Transcript >OphauB2|877
ATGGTAGCACCAATCAGAGTCGTTCCCAGTGCCGCCACGCGCGCCTCCAGCCTGCTTCGTACGGTGCAGTTCACC
CATCCGCCATCATGCCCATGCCACTGCAACCCCGGCTACCATCAGGCGCCACCGAGCATCATTGCCCATGTGGGC
CAAGCCGGCCGCCGCCACTTTGCCACGCCTCTTGGAGGCCAGCCCACGGAATACGCCTTTGAAATGGCAGCCTCG
TCCATTCGCTTTGGGCCGGGAGTCACCCACGAGATTGGAATGGACTTGAAGAATCTCGGCGCCCGCAAAGTCGCC
GTCGTTACCGATGCTACCGTCGACAAACTCGACGCAATGGAGCAGGTCCGACACGGGCTATCTCGCCAAGCAATC
AGCTTCCAGGTCTTTTCCAACGTCAGGGTCGAGCCCAAGGACAGCTCCATCCAAGACGCCATTGACTGGTCGCGG
TCACACATGCCCGATGTCTTTGTCGCCGTCGGCGGCGGCTCTGTCATCGACACAGCCAAGCTTATGAACCTCTAT
GCCGCCTATCCCGATGCCCCTCTCCTCGACTTTGTCAATGCGCCTCTGGGCAAGGGCCGTCCGGTCGACAAGCCC
CTCAAGCCCCTCATAGCCGTGCCAACAACGGCTGGCACCGGCAGCGAGACAACCGGCACTGCCATCTTCGACCTC
GTTTCCAAACGCGCAAAGACTGGTGTTGCTCACCGAAACCTCAAACCCACCCTGGGCATCTGCGATCCTATCAAC
ACGAGAACCATGCCCGCAGCAGTCAAGGCTAGCTCTGGTCTCGATGTCCTCTGTCACTCACTCGAGTCTTGGACC
GCCATTCCCTACAACGAGCGCACGCCCCGGCCCACCAACCCCATTCTTCGGCCGGCATATCAGGGCGCCAACCCC
ATCTCCGACATTTTTTCTCTGCACGCGCTCAAAAGCACTGTCAAGTACCTGCCCCGCGCCATTCGTGACCCCGAG
GATTTTGAGGCGCAAACACAAATGCTTCTTGCGTCAACTCTTGCCGGAATCGGCTTTGGTAATGCAGGCGTTCAT
TTATGCCACGGCATGTCTTACCCCATTTCGGGACAAAATCCGGGATACAAGCACTCGGGATACGCTGTTTCAACC
CCCATTATTCCCCACGGAGTCTCTGTTGCCGTCACAGCACCTGCTGTATTCCGCTTCACGGCCGCATCCAACCCG
GAGCGCCACCTACAGGCAGCTGAGGCGTTTGGCGTAGACGTGTCCAATGTGAAAAAGGAGAGTGCGGGTGAAGTC
TTGGGTGAAGCACTGACAAAGTTCCTTGCCGGACTTGGTGACCAGCCCAAGGGGCTCCAAGACCTCGGCTTCAAG
GCAGACAACATCGATGCATTGGTTGATGGCACTATTCCGCAGGAGCGCGTATTAATGCTCGCGCCTGGCCTTTCC
AAGGAGCTGCAGCTAGAGAAGGAACAGTTGCGGAAGCTGTTTGAGGAATCCATGACGCACTAG
Gene >OphauB2|877
ATGGTAGCACCAATCAGAGTCGTTCCCAGTGTGAGTCCGAGTACAAGCGCACCCAACACGTCGTCACTGCTCTTG
TGTCTCAGCCCTGCCCTGATAGACATGGGATCCAGGTTAACTGTGGTACGCCTCCAAGGCCGCCACGCGCGCCTC
CAGCCTGCTTCGTACGGTGCAGTTCACCCATCCGCCATCATGCCCATGCCACTGCAACCCCGGCTACCATCAGGC
GCCACCGAGCATCATTGCCCATGTGGGCCAAGCCGGCCGCCGCCACTTTGCCACGCCTCTTGGAGGCCAGCCCAC
GGAATACGCCTTTGAAATGGCAGCCTCGTCCATTCGCTTTGGGCCGGGAGTCACCCACGAGATTGGAATGGACTT
GAAGAATCTCGGCGCCCGCAAAGTCGCCGTCGTTACCGATGCTACCGTCGACAAACTCGACGCAATGGAGCAGGT
CCGACACGGGCTATCTCGCCAAGCAATCAGCTTCCAGGTCTTTTCCAACGTCAGGGTCGAGCCCAAGGACAGCTC
GTGCGTACTTGACATCCTTGCCGCGTCATTGGCTGACAAGGCCCAGCATCCAAGACGCCATTGACTGGTCGCGGT
CACACATGCCCGATGTCTTTGTCGCCGTCGGCGGCGGCTCTGTCATCGACACAGCCAAGCTTATGAACCTCTATG
CCGCCTATCCCGATGCCCCTCTCCTCGACTTTGTCAATGCGCCTCTGGGCAAGGGCCGTCCGGTCGACAAGCCCC
TCAAGCCCCTCATAGCCGTGCCAACAACGGCTGGCACCGGCAGCGAGACAACCGGCACTGCCATCTTCGACCTCG
TTTCCAAACGCGCAAAGACTGGTGTTGCTCACCGAAACCTCAAACCCACCCTGGGCATCTGCGATCCTATCAACA
CGAGAACCATGCCCGCAGCAGTCAAGGCTAGCTCTGGTCTCGATGTCCTCTGTCACTCACTCGAGTCTTGGACCG
CCATTCCCTACAACGAGCGCACGCCCCGGCCCACCAACCCCATTCTTCGGCCGGCATATCAGGGCGCCAACCCCA
TCTCCGACATTTTTTCTCTGCACGCGCTCAAAAGCACTGTCAAGTACCTGCCCCGCGCCATTCGTGACCCCGAGG
ATTTTGAGGCGCAAACACAAATGCTTCTTGCGTCAACTCTTGCCGGAATCGGCTTTGGTAATGCAGGCGTTCATT
TATGCCACGGTTCGTCCCTGTCACTGTCACTCTGCTCATTATGAATGCAAGCCTAACCTGGCGAGGCTGTAGGCA
TGTCTTACCCCATTTCGGGACAAAATCCGGGATACAAGCACTCGGGATACGCTGTTTCAACCCCCATTATTCCCC
ACGGAGTCTCTGTTGCCGTCACAGCACCTGCTGTATTCCGCTTCACGGCCGCATCCAACCCGGAGCGCCACCTAC
AGGCAGCTGAGGCGTTTGGCGTAGACGTGTCCAATGTGAAAAAGGAGAGTGCGGGTGAAGTCTTGGGTGAAGCAC
TGACAAAGTTCCTTGCCGGACTTGGTGACCAGCCCAAGGGGCTCCAAGACCTCGGCTTCAAGGCAGACAACATCG
ATGCATTGGTTGATGGCACTATTCCGCAGGAGCGCGTATTAATGCTCGCGCCTGGCCTTTCCAAGGAGCTGCAGC
TAGAGAAGGAACAGTTGCGGAAGCTGTTTGAGGAATCCATGACGCACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail