Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|876
Gene name
LocationContig_12:60295..61462
Strand-
Gene length (bp)1167
Transcript length (bp)1167
Coding sequence length (bp)1167
Protein length (aa) 389

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03576 Peptidase_S58 Peptidase family S58 2.5E-115 30 371

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|A0MTQ2|BAPA_SPHMI Beta-peptidyl aminopeptidase BapA OS=Sphingosinicella microcystinivorans PE=1 SV=1 25 386 1.0E-71
sp|Q52VH2|BAPA_SPHXN Beta-peptidyl aminopeptidase BapA OS=Sphingosinicella xenopeptidilytica GN=bapA PE=1 SV=1 26 387 2.0E-65

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|876
MSKQSLSGRGRIRHVLPTLYLGRWNPGRLNSITDVPGVLVDTQSIQPDQSVNTGVTTILPRRDWFESSSFAGVFR
FNGCGEMTGAHWINEAGVLCSPIVITGTPSVGEGYRGITQYFYNNHGQEAGVDLFMFPLVAETYDGYLSDPTRFA
VTPQHVMDGIKNASAERVAEGNTGGGTGMICHRFKGGTGSSSRLVPGYDSQGNQTTYTVGVLVQANYGMADTLHI
GGVPVGHLMADKAPTEKPAVAPGPEPRKDGSIIIIVATDAPLLPIQLQRLARRATVGLAKVGGYGHNNSGDIFLA
FSTGNKVPFQIMSSGADADAPKLDHPVPRDVRMTDNDSINGLFEAAGDATEEAIYNALCMAETMTGFKDRKVEAL
DLDLVRQLVEQRI*
Coding >OphauB2|876
ATGTCCAAGCAATCATTGTCGGGACGCGGCCGCATCCGCCATGTGCTTCCAACGCTGTATCTGGGCAGGTGGAAT
CCTGGACGCCTCAATTCCATCACCGATGTGCCTGGAGTGCTGGTGGACACGCAGTCGATCCAGCCCGACCAAAGC
GTCAACACTGGCGTCACAACGATTCTGCCGCGGCGCGACTGGTTTGAGTCGTCGTCGTTTGCCGGCGTCTTCCGC
TTCAATGGCTGCGGCGAGATGACGGGGGCTCACTGGATCAACGAGGCGGGCGTCTTGTGCTCGCCCATTGTCATT
ACAGGCACGCCGTCGGTGGGCGAGGGCTATCGCGGCATCACGCAATACTTTTACAACAACCATGGCCAAGAGGCG
GGCGTGGATCTCTTCATGTTTCCGCTCGTGGCTGAGACGTACGATGGCTACCTGAGCGACCCGACGCGCTTTGCT
GTCACGCCCCAACATGTCATGGACGGCATCAAGAATGCGTCGGCGGAGCGAGTGGCCGAGGGCAACACGGGCGGC
GGCACTGGCATGATTTGCCATCGCTTCAAGGGCGGCACGGGGTCGAGCAGCCGCTTAGTGCCTGGCTACGACAGC
CAAGGGAACCAGACGACGTACACGGTGGGCGTGCTCGTCCAGGCCAACTACGGCATGGCTGATACACTGCACATA
GGCGGCGTCCCCGTCGGTCACTTGATGGCGGATAAGGCGCCGACCGAGAAGCCGGCTGTAGCCCCTGGCCCCGAG
CCGCGCAAGGACGGCAGCATCATCATCATTGTCGCCACCGACGCCCCGTTACTGCCCATCCAGCTGCAGCGGCTG
GCACGCCGCGCCACCGTGGGCCTGGCCAAGGTGGGCGGCTACGGCCACAACAACTCGGGCGACATCTTTCTCGCC
TTCTCCACGGGCAACAAGGTGCCCTTCCAGATCATGTCCTCGGGGGCCGATGCCGACGCACCCAAGCTCGACCAC
CCGGTGCCGCGCGACGTCCGCATGACGGACAATGACTCCATCAATGGCCTGTTTGAGGCGGCGGGCGATGCAACC
GAGGAGGCCATTTACAATGCGCTGTGCATGGCCGAGACAATGACGGGCTTCAAGGACCGCAAGGTTGAGGCGCTG
GACCTGGATCTGGTGAGACAGCTGGTTGAGCAACGCATCTAG
Transcript >OphauB2|876
ATGTCCAAGCAATCATTGTCGGGACGCGGCCGCATCCGCCATGTGCTTCCAACGCTGTATCTGGGCAGGTGGAAT
CCTGGACGCCTCAATTCCATCACCGATGTGCCTGGAGTGCTGGTGGACACGCAGTCGATCCAGCCCGACCAAAGC
GTCAACACTGGCGTCACAACGATTCTGCCGCGGCGCGACTGGTTTGAGTCGTCGTCGTTTGCCGGCGTCTTCCGC
TTCAATGGCTGCGGCGAGATGACGGGGGCTCACTGGATCAACGAGGCGGGCGTCTTGTGCTCGCCCATTGTCATT
ACAGGCACGCCGTCGGTGGGCGAGGGCTATCGCGGCATCACGCAATACTTTTACAACAACCATGGCCAAGAGGCG
GGCGTGGATCTCTTCATGTTTCCGCTCGTGGCTGAGACGTACGATGGCTACCTGAGCGACCCGACGCGCTTTGCT
GTCACGCCCCAACATGTCATGGACGGCATCAAGAATGCGTCGGCGGAGCGAGTGGCCGAGGGCAACACGGGCGGC
GGCACTGGCATGATTTGCCATCGCTTCAAGGGCGGCACGGGGTCGAGCAGCCGCTTAGTGCCTGGCTACGACAGC
CAAGGGAACCAGACGACGTACACGGTGGGCGTGCTCGTCCAGGCCAACTACGGCATGGCTGATACACTGCACATA
GGCGGCGTCCCCGTCGGTCACTTGATGGCGGATAAGGCGCCGACCGAGAAGCCGGCTGTAGCCCCTGGCCCCGAG
CCGCGCAAGGACGGCAGCATCATCATCATTGTCGCCACCGACGCCCCGTTACTGCCCATCCAGCTGCAGCGGCTG
GCACGCCGCGCCACCGTGGGCCTGGCCAAGGTGGGCGGCTACGGCCACAACAACTCGGGCGACATCTTTCTCGCC
TTCTCCACGGGCAACAAGGTGCCCTTCCAGATCATGTCCTCGGGGGCCGATGCCGACGCACCCAAGCTCGACCAC
CCGGTGCCGCGCGACGTCCGCATGACGGACAATGACTCCATCAATGGCCTGTTTGAGGCGGCGGGCGATGCAACC
GAGGAGGCCATTTACAATGCGCTGTGCATGGCCGAGACAATGACGGGCTTCAAGGACCGCAAGGTTGAGGCGCTG
GACCTGGATCTGGTGAGACAGCTGGTTGAGCAACGCATCTAG
Gene >OphauB2|876
ATGTCCAAGCAATCATTGTCGGGACGCGGCCGCATCCGCCATGTGCTTCCAACGCTGTATCTGGGCAGGTGGAAT
CCTGGACGCCTCAATTCCATCACCGATGTGCCTGGAGTGCTGGTGGACACGCAGTCGATCCAGCCCGACCAAAGC
GTCAACACTGGCGTCACAACGATTCTGCCGCGGCGCGACTGGTTTGAGTCGTCGTCGTTTGCCGGCGTCTTCCGC
TTCAATGGCTGCGGCGAGATGACGGGGGCTCACTGGATCAACGAGGCGGGCGTCTTGTGCTCGCCCATTGTCATT
ACAGGCACGCCGTCGGTGGGCGAGGGCTATCGCGGCATCACGCAATACTTTTACAACAACCATGGCCAAGAGGCG
GGCGTGGATCTCTTCATGTTTCCGCTCGTGGCTGAGACGTACGATGGCTACCTGAGCGACCCGACGCGCTTTGCT
GTCACGCCCCAACATGTCATGGACGGCATCAAGAATGCGTCGGCGGAGCGAGTGGCCGAGGGCAACACGGGCGGC
GGCACTGGCATGATTTGCCATCGCTTCAAGGGCGGCACGGGGTCGAGCAGCCGCTTAGTGCCTGGCTACGACAGC
CAAGGGAACCAGACGACGTACACGGTGGGCGTGCTCGTCCAGGCCAACTACGGCATGGCTGATACACTGCACATA
GGCGGCGTCCCCGTCGGTCACTTGATGGCGGATAAGGCGCCGACCGAGAAGCCGGCTGTAGCCCCTGGCCCCGAG
CCGCGCAAGGACGGCAGCATCATCATCATTGTCGCCACCGACGCCCCGTTACTGCCCATCCAGCTGCAGCGGCTG
GCACGCCGCGCCACCGTGGGCCTGGCCAAGGTGGGCGGCTACGGCCACAACAACTCGGGCGACATCTTTCTCGCC
TTCTCCACGGGCAACAAGGTGCCCTTCCAGATCATGTCCTCGGGGGCCGATGCCGACGCACCCAAGCTCGACCAC
CCGGTGCCGCGCGACGTCCGCATGACGGACAATGACTCCATCAATGGCCTGTTTGAGGCGGCGGGCGATGCAACC
GAGGAGGCCATTTACAATGCGCTGTGCATGGCCGAGACAATGACGGGCTTCAAGGACCGCAAGGTTGAGGCGCTG
GACCTGGATCTGGTGAGACAGCTGGTTGAGCAACGCATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail