Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|870
Gene name
LocationContig_12:37613..40122
Strand+
Gene length (bp)2509
Transcript length (bp)2004
Coding sequence length (bp)2004
Protein length (aa) 668

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10360 DUF2433 Protein of unknown function (DUF2433) 2.4E-48 280 409
PF00149 Metallophos Calcineurin-like phosphoesterase 2.8E-04 43 107

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O42947|YBPC_SCHPO Uncharacterized protein C16H5.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16H5.12c PE=1 SV=3 44 457 8.0E-120

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|870
MATSTRPYNNPGYLQNGGAAGLAQPGTAPLLPNQGRVIQSGPIRILCIADVRGNLRSLNELAKQARADYIIHTGD
FGFYDDTSLERIVEKTLKHVAQYSPLIPDHIKKSIQQGGSSPVKSRFSPTDLPLSELPLLLNGEVKLEVPVYTVW
GACEDVRVLEKFRSSEYKVQNLHIIDEARSMLLEVGGVKLRLLGLGGAVVMHKLFDNGEGRTTIAGGQGTMWTTL
LQMGELVDTAQRVYDPTETRVFVTHASPAREGILNQLSVALKADFSISAGLHFRYGSSYNEFSVNPTLDHYRGKL
AASKASFNDVWETVKGEVEPAIQQNEAQQNLLKNALQIVEKMPTTAAGGNPFGGPAAGQAALGQVDESAFKNMWN
FNLADATFGYLALEIQDGRIGTEMRAQGFNFSHRGAKQHPGAAAVPPAASTMTAPGGGHPSPAPSASQSATDTNY
NREASSTQPPKTTSALAPSASTVKSDTPKPVAQPADPSGASAKEHEKAATATVANGSANGLDPATSPLPKTPAAE
IIGLFVMNISNDDHCRDLFDNEDKGKIVKIERWGMQNKVVHFNTPQERDAALARLSEEVKTRAQEDRTRPLVRVF
VPLQAELRVIRIAPDAVEVAEAVAREHEAAEAEQEASKVMQAHPHRLQHPRRRSRNEMQSRTVSVCI*
Coding >OphauB2|870
ATGGCTACCTCTACACGTCCGTATAACAACCCTGGCTACCTTCAGAACGGCGGTGCTGCAGGTCTTGCACAACCC
GGAACCGCGCCCTTGCTGCCAAACCAGGGACGCGTCATTCAATCAGGCCCTATCAGGATTCTTTGCATAGCCGAT
GTTCGAGGGAATCTAAGATCGCTCAATGAGCTTGCAAAGCAAGCTCGCGCCGACTACATCATCCACACGGGCGAC
TTCGGCTTTTACGATGACACGTCGCTCGAGCGCATCGTCGAGAAAACGCTTAAACATGTGGCCCAATACTCGCCT
TTGATCCCGGACCATATTAAAAAGTCAATTCAGCAGGGCGGTAGTAGCCCTGTAAAGAGCCGTTTCTCTCCAACA
GACTTGCCGCTCTCTGAATTGCCCCTGCTGCTCAACGGCGAAGTCAAGCTCGAGGTACCTGTCTACACCGTTTGG
GGTGCCTGCGAGGATGTGCGCGTGCTTGAGAAGTTTAGGTCCTCTGAGTACAAGGTCCAAAATCTCCATATCATC
GACGAGGCACGTTCCATGCTCCTCGAGGTCGGCGGCGTCAAGCTCAGGCTGCTTGGTCTTGGTGGCGCCGTCGTG
ATGCACAAACTTTTTGACAATGGTGAGGGTCGCACCACAATTGCCGGTGGCCAAGGCACCATGTGGACAACATTG
TTGCAAATGGGCGAGCTCGTCGATACTGCCCAACGTGTCTACGACCCCACCGAAACGCGAGTTTTTGTCACCCAC
GCGTCCCCAGCCCGCGAAGGCATTCTCAACCAGCTTTCCGTCGCGCTCAAGGCAGACTTTTCTATTTCTGCCGGT
CTTCATTTCCGCTATGGAAGCTCATACAACGAATTCAGCGTTAACCCAACTTTGGACCACTATCGTGGCAAGCTC
GCCGCATCAAAGGCTTCCTTCAACGATGTGTGGGAAACTGTCAAGGGCGAGGTCGAACCTGCAATTCAGCAAAAC
GAGGCGCAGCAGAATTTACTCAAAAATGCCCTTCAGATTGTCGAGAAAATGCCGACGACAGCGGCTGGTGGCAAT
CCTTTTGGTGGGCCCGCGGCTGGTCAAGCTGCTCTTGGCCAGGTCGACGAAAGTGCCTTCAAAAACATGTGGAAT
TTCAATTTGGCCGATGCTACCTTTGGCTACCTGGCTCTCGAGATACAGGACGGCCGTATTGGTACCGAAATGCGC
GCACAGGGCTTCAATTTTTCGCATCGTGGAGCTAAGCAACATCCTGGTGCAGCTGCTGTGCCTCCTGCAGCGTCA
ACAATGACGGCTCCTGGAGGCGGACATCCTTCCCCGGCGCCGTCTGCGTCGCAGTCGGCTACAGACACGAATTAT
AACCGAGAAGCATCGTCGACACAACCACCCAAGACGACTTCTGCCCTAGCCCCGTCTGCGAGTACCGTTAAGTCA
GACACACCAAAGCCTGTGGCTCAGCCTGCAGATCCTTCTGGAGCTTCTGCCAAGGAGCATGAAAAGGCTGCGACT
GCAACAGTCGCCAATGGATCCGCCAATGGCCTCGATCCAGCAACATCGCCGCTTCCCAAGACGCCCGCGGCGGAG
ATAATTGGCCTGTTTGTTATGAACATCAGCAATGATGATCACTGCCGTGACTTGTTCGATAACGAGGACAAGGGC
AAAATTGTAAAAATCGAAAGATGGGGGATGCAGAACAAGGTGGTGCATTTTAATACCCCTCAGGAGCGCGACGCG
GCCCTGGCCAGGCTATCGGAAGAAGTCAAAACACGGGCCCAGGAGGACCGGACGAGACCGCTGGTCAGGGTATTT
GTACCGCTGCAGGCGGAACTACGAGTGATTCGGATAGCACCCGACGCGGTCGAGGTGGCCGAGGCCGTGGCGAGA
GAGCACGAGGCGGCCGAGGCCGAGCAGGAGGCATCAAAGGTGATGCAGGCACATCCTCACCGGCTGCAACATCCT
CGACGCCGGTCGCGGAATGAGATGCAAAGCAGGACTGTCAGTGTCTGCATCTGA
Transcript >OphauB2|870
ATGGCTACCTCTACACGTCCGTATAACAACCCTGGCTACCTTCAGAACGGCGGTGCTGCAGGTCTTGCACAACCC
GGAACCGCGCCCTTGCTGCCAAACCAGGGACGCGTCATTCAATCAGGCCCTATCAGGATTCTTTGCATAGCCGAT
GTTCGAGGGAATCTAAGATCGCTCAATGAGCTTGCAAAGCAAGCTCGCGCCGACTACATCATCCACACGGGCGAC
TTCGGCTTTTACGATGACACGTCGCTCGAGCGCATCGTCGAGAAAACGCTTAAACATGTGGCCCAATACTCGCCT
TTGATCCCGGACCATATTAAAAAGTCAATTCAGCAGGGCGGTAGTAGCCCTGTAAAGAGCCGTTTCTCTCCAACA
GACTTGCCGCTCTCTGAATTGCCCCTGCTGCTCAACGGCGAAGTCAAGCTCGAGGTACCTGTCTACACCGTTTGG
GGTGCCTGCGAGGATGTGCGCGTGCTTGAGAAGTTTAGGTCCTCTGAGTACAAGGTCCAAAATCTCCATATCATC
GACGAGGCACGTTCCATGCTCCTCGAGGTCGGCGGCGTCAAGCTCAGGCTGCTTGGTCTTGGTGGCGCCGTCGTG
ATGCACAAACTTTTTGACAATGGTGAGGGTCGCACCACAATTGCCGGTGGCCAAGGCACCATGTGGACAACATTG
TTGCAAATGGGCGAGCTCGTCGATACTGCCCAACGTGTCTACGACCCCACCGAAACGCGAGTTTTTGTCACCCAC
GCGTCCCCAGCCCGCGAAGGCATTCTCAACCAGCTTTCCGTCGCGCTCAAGGCAGACTTTTCTATTTCTGCCGGT
CTTCATTTCCGCTATGGAAGCTCATACAACGAATTCAGCGTTAACCCAACTTTGGACCACTATCGTGGCAAGCTC
GCCGCATCAAAGGCTTCCTTCAACGATGTGTGGGAAACTGTCAAGGGCGAGGTCGAACCTGCAATTCAGCAAAAC
GAGGCGCAGCAGAATTTACTCAAAAATGCCCTTCAGATTGTCGAGAAAATGCCGACGACAGCGGCTGGTGGCAAT
CCTTTTGGTGGGCCCGCGGCTGGTCAAGCTGCTCTTGGCCAGGTCGACGAAAGTGCCTTCAAAAACATGTGGAAT
TTCAATTTGGCCGATGCTACCTTTGGCTACCTGGCTCTCGAGATACAGGACGGCCGTATTGGTACCGAAATGCGC
GCACAGGGCTTCAATTTTTCGCATCGTGGAGCTAAGCAACATCCTGGTGCAGCTGCTGTGCCTCCTGCAGCGTCA
ACAATGACGGCTCCTGGAGGCGGACATCCTTCCCCGGCGCCGTCTGCGTCGCAGTCGGCTACAGACACGAATTAT
AACCGAGAAGCATCGTCGACACAACCACCCAAGACGACTTCTGCCCTAGCCCCGTCTGCGAGTACCGTTAAGTCA
GACACACCAAAGCCTGTGGCTCAGCCTGCAGATCCTTCTGGAGCTTCTGCCAAGGAGCATGAAAAGGCTGCGACT
GCAACAGTCGCCAATGGATCCGCCAATGGCCTCGATCCAGCAACATCGCCGCTTCCCAAGACGCCCGCGGCGGAG
ATAATTGGCCTGTTTGTTATGAACATCAGCAATGATGATCACTGCCGTGACTTGTTCGATAACGAGGACAAGGGC
AAAATTGTAAAAATCGAAAGATGGGGGATGCAGAACAAGGTGGTGCATTTTAATACCCCTCAGGAGCGCGACGCG
GCCCTGGCCAGGCTATCGGAAGAAGTCAAAACACGGGCCCAGGAGGACCGGACGAGACCGCTGGTCAGGGTATTT
GTACCGCTGCAGGCGGAACTACGAGTGATTCGGATAGCACCCGACGCGGTCGAGGTGGCCGAGGCCGTGGCGAGA
GAGCACGAGGCGGCCGAGGCCGAGCAGGAGGCATCAAAGGTGATGCAGGCACATCCTCACCGGCTGCAACATCCT
CGACGCCGGTCGCGGAATGAGATGCAAAGCAGGACTGTCAGTGTCTGCATCTGA
Gene >OphauB2|870
ATGGCTACCTCTGTAAGTCGCTACCCTCTGCCCTTCCTGCTTTTGCTTTGGCCTCTCTGCCGTCGCCCTGTTGTG
CGTTAAGGGCAGGTGCCGGCACGTGCTGTGCCTCCTTGGCCAGCTGACTGCGCTGCGGCTTCACAACTGGACGGG
GCGACGATGCTTCCCCTAGTAGTTTTTTTTTTCATCGTCGTCCGCGCTCTTTTCCACACCCCGACGAGCCGCATC
ACCAAACTCTCACTTTGAGGTCTAGCCGTAGCGACAACGCGAGCTGGCTATCCTTCCCCTATGGCCTCATCCATG
CTTGCTACAGCCCAGTCCCGCCTCTGGGAGCGAAATCGAAAGCTGTCCTCTGACATGCCACAGACACGTCCGTAT
AACAACCCTGGCTACCTTCAGAACGGCGGTGCTGCAGGTCTTGCACAACCCGGAACCGCGCCCTTGCTGCCAAAC
CAGGGACGCGTCATTCAATCAGGCCCTATCAGGATTCTTTGCATAGCCGATGTTCGAGGTATGTGGTGCTTCTGT
CTCGAGTTGGCAGCCTTGTGGACTAACGAGGGTTGTTGATGCGACACAGGGAATCTAAGATCGCTCAATGAGCTT
GCAAAGCAAGCTCGCGCCGACTACATCATCCACACGGGCGACTTCGGCTTTTACGATGACACGTCGCTCGAGCGC
ATCGTCGAGAAAACGCTTAAACATGTGGCCCAATACTCGCCTTTGATCCCGGACCATATTAAAAAGTCAATTCAG
CAGGGCGGTAGTAGCCCTGTAAAGAGCCGTTTCTCTCCAACAGACTTGCCGCTCTCTGAATTGCCCCTGCTGCTC
AACGGCGAAGTCAAGCTCGAGGTACCTGTCTACACCGTTTGGGGTGCCTGCGAGGATGTGCGCGTGCTTGAGAAG
TTTAGGTCCTCTGAGTACAAGGTCCAAAATCTCCATATCATCGACGAGGCACGTTCCATGCTCCTCGAGGTCGGC
GGCGTCAAGCTCAGGCTGCTTGGTCTTGGTGGCGCCGTCGTGATGCACAAACTTTTTGACAATGGTGAGGGTCGC
ACCACAATTGCCGGTGGCCAAGGCACCATGTGGACAACATTGTTGCAAATGGGCGAGCTCGTCGATACTGCCCAA
CGTGTCTACGACCCCACCGAAACGCGAGTTTTTGTCACCCACGCGTCCCCAGCCCGCGAAGGCATTCTCAACCAG
CTTTCCGTCGCGCTCAAGGCAGACTTTTCTATTTCTGCCGGTCTTCATTTCCGCTATGGAAGCTCATACAACGAA
TTCAGCGTTAACCCAACTTTGGACCACTATCGTGGCAAGCTCGCCGCATCAAAGGCTTCCTTCAACGATGTGTGG
GAAACTGTCAAGGGCGAGGTCGAACCTGCAATTCAGCAAAACGAGGCGCAGCAGAATTTACTCAAAAATGCCCTT
CAGATTGTCGAGAAAATGCCGACGACAGCGGCTGGTGGCAATCCTTTTGGTGGGCCCGCGGCTGGTCAAGCTGCT
CTTGGCCAGGTCGACGAAAGTGCCTTCAAAAACATGTGGAATTTCAATTTGGCCGATGCTACCTTTGGCTACCTG
GCTCTCGAGATACAGGACGGCCGTATTGGTACCGAAATGCGCGCACAGGGCTTCAATTTTTCGCATCGTGGAGCT
AAGCAACATCCTGGTGCAGCTGCTGTGCCTCCTGCAGCGTCAACAATGACGGCTCCTGGAGGCGGACATCCTTCC
CCGGCGCCGTCTGCGTCGCAGTCGGCTACAGACACGAATTATAACCGAGAAGCATCGTCGACACAACCACCCAAG
ACGACTTCTGCCCTAGCCCCGTCTGCGAGTACCGTTAAGTCAGACACACCAAAGCCTGTGGCTCAGCCTGCAGAT
CCTTCTGGAGCTTCTGCCAAGGAGCATGAAAAGGCTGCGACTGCAACAGTCGCCAATGGATCCGCCAATGGCCTC
GATCCAGCAACATCGCCGCTTCCCAAGACGCCCGCGGCGGAGATAATTGGCCTGTTTGTTATGAACATCAGCAAT
GATGATCACTGCCGTGACTTGTTCGATAACGAGGACAAGGGCAAAATTGTAAAAATCGAAAGATGGGGGATGCAG
AACAAGGTGGTGCATTTTAATACCCCTCAGGAGCGCGACGCGGCCCTGGCCAGGCTATCGGAAGAAGTCAAAACA
CGGGCCCAGGAGGACCGGACGAGACCGCTGGTCAGGGTATTTGTACCGCGTGAGGGGAAGCCGTTTGCAAATCGT
GGCGGTGCAGGCACTTGGGGCGCCAACGCACGTGGTGGCGGCACTGCTAGCGGCTATCGCAGTGCAGGCGGAACT
ACGAGTGATTCGGATAGCACCCGACGCGGTCGAGGTGGCCGAGGCCGTGGCGAGAGAGCACGAGGCGGCCGAGGC
CGAGCAGGAGGCATCAAAGGTGATGCAGGCACATCCTCACCGGCTGCAACATCCTCGACGCCGGTCGCGGAATGA
GATGCAAAGCAGGACTGTCAGTGTCTGCATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail