Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|869
Gene name
LocationContig_12:33143..36013
Strand-
Gene length (bp)2870
Transcript length (bp)2637
Coding sequence length (bp)2637
Protein length (aa) 879

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08632 Zds_C Activator of mitotic machinery Cdc14 phosphatase activation C-term 2.5E-27 704 754

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14100|ZDS1_SCHPO Protein zds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zds1 PE=1 SV=2 150 369 6.0E-18
sp|O14100|ZDS1_SCHPO Protein zds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zds1 PE=1 SV=2 704 788 1.0E-15
sp|P50111|ZDS1_YEAST Protein ZDS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZDS1 PE=1 SV=1 712 753 7.0E-09
sp|P54786|ZDS2_YEAST Protein ZDS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZDS2 PE=1 SV=1 712 753 1.0E-07

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2544
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5710
Ophiocordyceps australis map64 (Brazil) OphauB2|869 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01373
Ophiocordyceps camponoti-rufipedis Ophun1|2608
Ophiocordyceps kimflemingae Ophio5|5486
Ophiocordyceps subramaniannii Hirsu2|3762

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|869
MTSSRPRDKTAAGLGSRRGHSSTLSISDPSHHVTEAIGTLYGGDEEDYSSAGGARPLSFIHGSPYGEQIQRRLPE
QKQESDAPAQQPSIPVLSLDVQNLSKSPQAQRRSPVEPSSLGPSPSPTWSLRDVPTDAAASGSQFPLTNMDNPSD
IAQELSNLQALRRLSMDVGNSIDPDMPPGLTAMPVIAPTGDDDENDPSRLLWVPARVHPELAPSEFKSFLENRVQ
AIRRRSGDLSPSVDGDSSSPASSLRRKKSMLSRQIDNTGGRGAVGYVDGAERLHRLRSNGSQNSPELSIEDLVKD
PTKAVQKLTQDSHDAATASRGSETFEDDMPILPMAPGMGLRRSTRTTYRKGGSLRSGDRGSLSRRLGHRPPESDL
SEAVSKGDSMHKMHSESTVDKHTRPERAIRRASDHSQESHTASEGLSDEPVNRDQQPTRKSSVTKQASQDRAERP
ENTNNRMFPTRSSSQNAGSLRDHVPDQAMDDSSSQPVRRSATHGNFTIKQPQYTSKSSQNQIQMPGRGDSLASPS
AISCGDASRTDNLTFIPTLNHAEKSKSEKKSRKDRDEDSAGTSSGKSGGAWKWLKGVADDREKKREEKREESRRS
KGKAAAEKAPHDNVRLDLIQTSIERDNSKGRESLVLDRDDVDHKLLEERKKESNRKSDSKKDKDSSLISSIFGVS
KKKDKDKSNKKSQHHLQVPEEMPYKPQRPDVDYEWTRFPLLKERMIYRMAHLKLANPRRSLLSQVLLSNFMYSYL
AIVQAMHPQMNVPTSPQQKRLEEEARRKRQEQEYLAQQQTQDGQDDEDGLDQYNFEYHRAAVQYAESGPDEQVDY
VDDAQIYEDEHGSDNADDYGYEATEEYGHESKDYLEHPGGADGQGRHSRDNMW*
Coding >OphauB2|869
ATGACCTCATCTCGACCACGCGACAAGACCGCTGCTGGCCTCGGCAGTCGCCGTGGTCACTCGAGCACGCTGTCT
ATATCAGATCCGAGCCACCATGTCACCGAGGCCATAGGTACTCTGTACGGGGGCGATGAAGAGGACTACTCCAGT
GCTGGGGGCGCCCGGCCCCTCAGCTTCATCCACGGTTCTCCCTACGGCGAACAGATTCAACGGAGGCTTCCAGAG
CAGAAGCAAGAGAGTGATGCTCCGGCCCAGCAGCCCTCTATACCTGTCTTGTCTCTTGATGTGCAAAACCTGTCC
AAGTCACCTCAAGCTCAACGCAGGAGCCCGGTAGAGCCCAGCTCCTTGGGACCATCTCCTTCGCCGACATGGTCA
CTGCGAGATGTGCCAACAGATGCCGCCGCCTCAGGCTCACAGTTCCCTCTGACCAACATGGACAATCCCAGCGAT
ATCGCCCAAGAGCTGAGCAATTTGCAGGCCCTCAGAAGGCTCTCGATGGATGTTGGCAACAGCATAGATCCAGAC
ATGCCGCCAGGCCTTACGGCAATGCCCGTCATAGCCCCCACTGGAGACGACGATGAAAATGATCCATCCCGTCTC
CTCTGGGTTCCTGCTAGGGTTCATCCAGAGCTCGCCCCGAGTGAATTCAAATCCTTTCTGGAAAATCGTGTTCAG
GCAATCAGACGGAGATCTGGCGACTTGTCACCTTCAGTCGACGGCGATTCTAGCAGTCCGGCTTCATCTCTTCGA
CGTAAAAAGTCAATGTTATCTAGACAGATCGACAATACCGGCGGCCGAGGTGCCGTGGGCTACGTCGACGGGGCT
GAGCGCCTACACAGGCTGCGGTCCAATGGAAGCCAAAACAGTCCTGAACTCAGCATCGAGGACCTGGTCAAAGAC
CCCACTAAAGCGGTGCAAAAGCTCACCCAGGACTCGCACGACGCTGCCACGGCCTCACGTGGTTCTGAAACCTTT
GAAGATGACATGCCTATCCTGCCCATGGCTCCCGGAATGGGTTTGCGTAGATCTACACGCACTACGTATCGCAAG
GGTGGCAGCCTGCGCTCGGGAGATAGAGGCTCTCTTTCTCGACGCTTGGGCCATAGGCCGCCAGAGAGTGACCTG
TCCGAGGCTGTTTCCAAAGGCGACTCGATGCACAAAATGCACTCGGAGAGTACTGTCGATAAGCACACGCGCCCG
GAACGAGCCATTCGAAGAGCAAGTGATCACTCACAAGAATCACATACCGCTTCCGAAGGTCTCTCGGACGAGCCG
GTGAATCGCGATCAGCAGCCAACACGTAAATCATCGGTAACAAAGCAAGCTTCTCAAGACCGCGCAGAACGACCA
GAAAATACGAACAACAGGATGTTCCCAACAAGATCTTCATCACAAAACGCTGGATCTCTCAGAGACCATGTTCCA
GACCAAGCCATGGATGACTCTAGCTCGCAGCCAGTGCGGCGCTCGGCCACACATGGAAATTTTACTATCAAGCAG
CCCCAATACACCTCTAAATCATCACAAAACCAGATTCAGATGCCCGGTAGGGGAGATTCATTGGCTTCTCCTTCT
GCTATCTCGTGCGGAGATGCCTCTCGCACCGACAATTTAACCTTTATTCCAACACTGAACCACGCAGAAAAGTCC
AAATCGGAAAAGAAATCGAGAAAAGATCGAGACGAAGATTCTGCCGGCACGTCGAGCGGCAAGTCGGGCGGTGCA
TGGAAGTGGCTCAAGGGCGTGGCTGACGACAGAGAAAAGAAGAGGGAAGAGAAAAGGGAAGAGAGCAGACGCTCC
AAGGGCAAGGCTGCCGCGGAAAAGGCCCCGCATGACAATGTTCGGCTGGACCTTATCCAGACATCAATCGAGAGG
GATAATTCCAAGGGCCGTGAGAGTCTCGTATTGGACCGCGACGATGTCGACCACAAACTTCTGGAAGAACGTAAA
AAGGAGAGCAATCGAAAAAGCGACTCGAAAAAGGACAAGGATAGCAGTCTTATTTCATCCATTTTTGGTGTCAGC
AAGAAGAAGGACAAGGACAAGTCAAACAAGAAGAGCCAACACCACCTGCAAGTACCCGAAGAAATGCCCTACAAA
CCTCAGCGGCCAGATGTAGACTACGAATGGACGCGGTTCCCACTTCTCAAAGAGAGAATGATTTATCGCATGGCA
CATCTCAAGCTGGCCAATCCACGGCGCTCTCTCCTCAGTCAAGTGCTGTTGAGCAATTTTATGTACAGCTACTTG
GCCATTGTGCAGGCTATGCACCCGCAGATGAACGTGCCAACGTCGCCGCAGCAAAAACGGCTTGAGGAGGAGGCA
CGGCGCAAGCGACAAGAACAAGAATACCTTGCTCAACAGCAGACGCAGGACGGTCAAGACGATGAAGACGGTCTT
GACCAGTACAACTTTGAATATCACCGAGCTGCTGTTCAGTATGCAGAGTCTGGCCCTGACGAACAGGTCGACTAT
GTTGACGATGCGCAAATTTACGAGGACGAACACGGGAGCGACAACGCGGATGATTATGGCTACGAAGCCACCGAA
GAATATGGCCATGAATCCAAGGACTACCTTGAACACCCCGGTGGCGCTGACGGCCAAGGTCGCCACAGTCGAGAC
AATATGTGGTGA
Transcript >OphauB2|869
ATGACCTCATCTCGACCACGCGACAAGACCGCTGCTGGCCTCGGCAGTCGCCGTGGTCACTCGAGCACGCTGTCT
ATATCAGATCCGAGCCACCATGTCACCGAGGCCATAGGTACTCTGTACGGGGGCGATGAAGAGGACTACTCCAGT
GCTGGGGGCGCCCGGCCCCTCAGCTTCATCCACGGTTCTCCCTACGGCGAACAGATTCAACGGAGGCTTCCAGAG
CAGAAGCAAGAGAGTGATGCTCCGGCCCAGCAGCCCTCTATACCTGTCTTGTCTCTTGATGTGCAAAACCTGTCC
AAGTCACCTCAAGCTCAACGCAGGAGCCCGGTAGAGCCCAGCTCCTTGGGACCATCTCCTTCGCCGACATGGTCA
CTGCGAGATGTGCCAACAGATGCCGCCGCCTCAGGCTCACAGTTCCCTCTGACCAACATGGACAATCCCAGCGAT
ATCGCCCAAGAGCTGAGCAATTTGCAGGCCCTCAGAAGGCTCTCGATGGATGTTGGCAACAGCATAGATCCAGAC
ATGCCGCCAGGCCTTACGGCAATGCCCGTCATAGCCCCCACTGGAGACGACGATGAAAATGATCCATCCCGTCTC
CTCTGGGTTCCTGCTAGGGTTCATCCAGAGCTCGCCCCGAGTGAATTCAAATCCTTTCTGGAAAATCGTGTTCAG
GCAATCAGACGGAGATCTGGCGACTTGTCACCTTCAGTCGACGGCGATTCTAGCAGTCCGGCTTCATCTCTTCGA
CGTAAAAAGTCAATGTTATCTAGACAGATCGACAATACCGGCGGCCGAGGTGCCGTGGGCTACGTCGACGGGGCT
GAGCGCCTACACAGGCTGCGGTCCAATGGAAGCCAAAACAGTCCTGAACTCAGCATCGAGGACCTGGTCAAAGAC
CCCACTAAAGCGGTGCAAAAGCTCACCCAGGACTCGCACGACGCTGCCACGGCCTCACGTGGTTCTGAAACCTTT
GAAGATGACATGCCTATCCTGCCCATGGCTCCCGGAATGGGTTTGCGTAGATCTACACGCACTACGTATCGCAAG
GGTGGCAGCCTGCGCTCGGGAGATAGAGGCTCTCTTTCTCGACGCTTGGGCCATAGGCCGCCAGAGAGTGACCTG
TCCGAGGCTGTTTCCAAAGGCGACTCGATGCACAAAATGCACTCGGAGAGTACTGTCGATAAGCACACGCGCCCG
GAACGAGCCATTCGAAGAGCAAGTGATCACTCACAAGAATCACATACCGCTTCCGAAGGTCTCTCGGACGAGCCG
GTGAATCGCGATCAGCAGCCAACACGTAAATCATCGGTAACAAAGCAAGCTTCTCAAGACCGCGCAGAACGACCA
GAAAATACGAACAACAGGATGTTCCCAACAAGATCTTCATCACAAAACGCTGGATCTCTCAGAGACCATGTTCCA
GACCAAGCCATGGATGACTCTAGCTCGCAGCCAGTGCGGCGCTCGGCCACACATGGAAATTTTACTATCAAGCAG
CCCCAATACACCTCTAAATCATCACAAAACCAGATTCAGATGCCCGGTAGGGGAGATTCATTGGCTTCTCCTTCT
GCTATCTCGTGCGGAGATGCCTCTCGCACCGACAATTTAACCTTTATTCCAACACTGAACCACGCAGAAAAGTCC
AAATCGGAAAAGAAATCGAGAAAAGATCGAGACGAAGATTCTGCCGGCACGTCGAGCGGCAAGTCGGGCGGTGCA
TGGAAGTGGCTCAAGGGCGTGGCTGACGACAGAGAAAAGAAGAGGGAAGAGAAAAGGGAAGAGAGCAGACGCTCC
AAGGGCAAGGCTGCCGCGGAAAAGGCCCCGCATGACAATGTTCGGCTGGACCTTATCCAGACATCAATCGAGAGG
GATAATTCCAAGGGCCGTGAGAGTCTCGTATTGGACCGCGACGATGTCGACCACAAACTTCTGGAAGAACGTAAA
AAGGAGAGCAATCGAAAAAGCGACTCGAAAAAGGACAAGGATAGCAGTCTTATTTCATCCATTTTTGGTGTCAGC
AAGAAGAAGGACAAGGACAAGTCAAACAAGAAGAGCCAACACCACCTGCAAGTACCCGAAGAAATGCCCTACAAA
CCTCAGCGGCCAGATGTAGACTACGAATGGACGCGGTTCCCACTTCTCAAAGAGAGAATGATTTATCGCATGGCA
CATCTCAAGCTGGCCAATCCACGGCGCTCTCTCCTCAGTCAAGTGCTGTTGAGCAATTTTATGTACAGCTACTTG
GCCATTGTGCAGGCTATGCACCCGCAGATGAACGTGCCAACGTCGCCGCAGCAAAAACGGCTTGAGGAGGAGGCA
CGGCGCAAGCGACAAGAACAAGAATACCTTGCTCAACAGCAGACGCAGGACGGTCAAGACGATGAAGACGGTCTT
GACCAGTACAACTTTGAATATCACCGAGCTGCTGTTCAGTATGCAGAGTCTGGCCCTGACGAACAGGTCGACTAT
GTTGACGATGCGCAAATTTACGAGGACGAACACGGGAGCGACAACGCGGATGATTATGGCTACGAAGCCACCGAA
GAATATGGCCATGAATCCAAGGACTACCTTGAACACCCCGGTGGCGCTGACGGCCAAGGTCGCCACAGTCGAGAC
AATATGTGGTGA
Gene >OphauB2|869
ATGGTGCGTCTGCTCTTTGTCTTGTAAACTTTATTGGTGCATCTGTGCGGCTGGCTCGCATGGCTGAGACCAGCT
CACCGCCCTGCGCCAATTGCAAGTCTGCTACTATCACTATAGCTGAATATCACTGTCCTCGTCCTGCTGGCAAAG
CCACGCTGACATGATCTGATCGCCATAGACCTCATCTCGACCACGCGACAAGACCGCTGCTGGCCTCGGCAGTCG
CCGTGGTCACTCGAGCACGCTGTCTATATCAGATCCGAGCCACCATGTCACCGAGGCCATAGGTACTCTGTACGG
GGGCGATGAAGAGGACTACTCCAGTGCTGGGGGCGCCCGGCCCCTCAGCTTCATCCACGGTTCTCCCTACGGCGA
ACAGATTCAACGGAGGCTTCCAGAGCAGAAGCAAGAGAGTGATGCTCCGGCCCAGCAGCCCTCTATACCTGTCTT
GTCTCTTGATGTGCAAAACCTGTCCAAGTCACCTCAAGCTCAACGCAGGAGCCCGGTAGAGCCCAGCTCCTTGGG
ACCATCTCCTTCGCCGACATGGTCACTGCGAGATGTGCCAACAGATGCCGCCGCCTCAGGCTCACAGTTCCCTCT
GACCAACATGGACAATCCCAGCGATATCGCCCAAGAGCTGAGCAATTTGCAGGCCCTCAGAAGGCTCTCGATGGA
TGTTGGCAACAGCATAGATCCAGACATGCCGCCAGGCCTTACGGCAATGCCCGTCATAGCCCCCACTGGAGACGA
CGATGAAAATGATCCATCCCGTCTCCTCTGGGTTCCTGCTAGGGTTCATCCAGAGCTCGCCCCGAGTGAATTCAA
ATCCTTTCTGGAAAATCGTGTTCAGGCAATCAGACGGAGATCTGGCGACTTGTCACCTTCAGTCGACGGCGATTC
TAGCAGTCCGGCTTCATCTCTTCGACGTAAAAAGTCAATGTTATCTAGACAGATCGACAATACCGGCGGCCGAGG
TGCCGTGGGCTACGTCGACGGGGCTGAGCGCCTACACAGGCTGCGGTCCAATGGAAGCCAAAACAGTCCTGAACT
CAGCATCGAGGACCTGGTCAAAGACCCCACTAAAGCGGTGCAAAAGCTCACCCAGGACTCGCACGACGCTGCCAC
GGCCTCACGTGGTTCTGAAACCTTTGAAGATGACATGCCTATCCTGCCCATGGCTCCCGGAATGGGTTTGCGTAG
ATCTACACGCACTACGTATCGCAAGGGTGGCAGCCTGCGCTCGGGAGATAGAGGCTCTCTTTCTCGACGCTTGGG
CCATAGGCCGCCAGAGAGTGACCTGTCCGAGGCTGTTTCCAAAGGCGACTCGATGCACAAAATGCACTCGGAGAG
TACTGTCGATAAGCACACGCGCCCGGAACGAGCCATTCGAAGAGCAAGTGATCACTCACAAGAATCACATACCGC
TTCCGAAGGTCTCTCGGACGAGCCGGTGAATCGCGATCAGCAGCCAACACGTAAATCATCGGTAACAAAGCAAGC
TTCTCAAGACCGCGCAGAACGACCAGAAAATACGAACAACAGGATGTTCCCAACAAGATCTTCATCACAAAACGC
TGGATCTCTCAGAGACCATGTTCCAGACCAAGCCATGGATGACTCTAGCTCGCAGCCAGTGCGGCGCTCGGCCAC
ACATGGAAATTTTACTATCAAGCAGCCCCAATACACCTCTAAATCATCACAAAACCAGATTCAGATGCCCGGTAG
GGGAGATTCATTGGCTTCTCCTTCTGCTATCTCGTGCGGAGATGCCTCTCGCACCGACAATTTAACCTTTATTCC
AACACTGAACCACGCAGAAAAGTCCAAATCGGAAAAGAAATCGAGAAAAGATCGAGACGAAGATTCTGCCGGCAC
GTCGAGCGGCAAGTCGGGCGGTGCATGGAAGTGGCTCAAGGGCGTGGCTGACGACAGAGAAAAGAAGAGGGAAGA
GAAAAGGGAAGAGAGCAGACGCTCCAAGGGCAAGGCTGCCGCGGAAAAGGCCCCGCATGACAATGTTCGGCTGGA
CCTTATCCAGACATCAATCGAGAGGGATAATTCCAAGGGCCGTGAGAGTCTCGTATTGGACCGCGACGATGTCGA
CCACAAACTTCTGGAAGAACGTAAAAAGGAGAGCAATCGAAAAAGCGACTCGAAAAAGGACAAGGATAGCAGTCT
TATTTCATCCATTTTTGGTGTCAGCAAGAAGAAGGACAAGGACAAGTCAAACAAGAAGAGCCAACACCACCTGCA
AGTACCCGAAGAAATGCCCTACAAACCTCAGCGGCCAGATGTAGACTACGAATGGACGCGGTTCCCACTTCTCAA
AGAGAGAATGATTTATCGCATGGCACATCTCAAGCTGGCCAATCCACGGCGCTCTCTCCTCAGTCAAGTGCTGTT
GAGCAATTTTATGTACAGCTACTTGGCCATTGTGCAGGCTATGCACCCGCAGATGAACGTGCCAACGTCGCCGCA
GCAAAAACGGCTTGAGGAGGAGGCACGGCGCAAGCGACAAGAACAAGAATACCTTGCTCAACAGCAGACGCAGGA
CGGTCAAGACGATGAAGACGGTCTTGACCAGTACAACTTTGAATATCACCGAGTAAGGGCTGCCTTGTATTTCCT
TGACTGAAAGAATAATATTGCTAATAGCGACCAAGGCTGCTGTTCAGTATGCAGAGTCTGGCCCTGACGAACAGG
TCGACTATGTTGACGATGCGCAAATTTACGAGGACGAACACGGGAGCGACAACGCGGATGATTATGGCTACGAAG
CCACCGAAGAATATGGCCATGAATCCAAGGACTACCTTGAACACCCCGGTGGCGCTGACGGCCAAGGTCGCCACA
GTCGAGACAATATGTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail