Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|867
Gene name
LocationContig_12:25589..31220
Strand-
Gene length (bp)5631
Transcript length (bp)4440
Coding sequence length (bp)4440
Protein length (aa) 1480

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14570 zf-RING_4 RING/Ubox like zinc-binding domain 1.2E-19 15 62
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 9.0E-08 123 198

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P34909|NOT4_YEAST General negative regulator of transcription subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOT2 PE=1 SV=1 6 260 8.0E-73
sp|Q09818|YAC4_SCHPO Putative general negative regulator of transcription C16C9.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16C9.04c PE=3 SV=1 9 282 1.0E-64
sp|Q8BT14|CNOT4_MOUSE CCR4-NOT transcription complex subunit 4 OS=Mus musculus GN=Cnot4 PE=1 SV=2 15 242 2.0E-60
sp|O95628|CNOT4_HUMAN CCR4-NOT transcription complex subunit 4 OS=Homo sapiens GN=CNOT4 PE=1 SV=3 15 242 3.0E-60

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|867
MAPQDSFFEEEEELCPLCIEEFDLSDRNFRPCPCGYQVCQFCFNNIKNNMNGLCPACRRPYDEKTIQWKVVTQEE
VAEFRANIQKNQKKRAQEQRQKEAQKREAEKENRKNLIGVRVVQKNLVYVTGLAPTIREDELLKTLRKPEFFGQY
GNIQKISISNRKSSDGQHHSLGIYVTFEKPEEATRCIQAVHGSQNGDRILKAQHGTTKYCSAWLKNEKCNNPGCM
FLHEQGDEEDSYTRQDLSSMNSIHTQRPLPSGGTSSRAASRQQASQPTPPPPMSQPMARSSSKEGSETGVDASAL
PSSASWARNPQRSRRGSQATSGTISSPTISTSQPATGDGAPSQNAEDSVISPTARNAQVTEPMPYMSWFKPTDVT
TEDMIKALTGWELPLRGKTVDETGPPMWDTYGGVRRRAMKREEAELRAREMEERREAHAASEPEPEARGGSLALG
GEPEERDVSSEGHGFDQRQTNTQPPIQRGSTDGNMFGSASLGASSSFSQSSTIAGSMGRAMTPQHFASLRSQTSF
ADQMPPGFTGQSNMLQQAPGHNRQSSRFNFANDNASSAATNIKLAANPRIMAQQSSMMPSAFQSQSSSQYYGSSM
PGPPPGLKSTGTPPSMFGQTFGGFGTVPKDSSSDLLQSLMGRNRAGGSQGLEAGKLDLADPSILQARMQAQSQSN
AGAGQGLFGGQSQAADDELPSLAEASDSVDALVSDEPQGVFLQHTAQPQPLGPPGIVAPHANMEPARQARPSNVN
VVPVLPKVGPPGLEHGAITPLATPRKPLAHANTSASTDPIKAPLSNQHRPAPSRQLSLLDDEDFPALNAPKHVAH
QTTAPAVSSVPTPRGTPAPKKQATTDRFPVPEKIAEPGGEKANIAPDAGPSRGAKNKTSVSGSQSFKLAAINTTG
IKTEDMTRNDASAATTPVTRTDSPVTRAAPRSIRVLPLSKADAAAMPSPAPSAASKAVSASHGPETPASEVVSDT
ASLVSASASVSRAGSPPLGKIGSAAVRPTTKSQQRKQRKEAARQETKIISEAPKAEPEEHAPLIGRKKKQKKQKA
AKSPVQETASTQGAAKEEKQAEAESLAEAKAQPSQGPDDETEKEECKGKMAKGESHKKASKAKSTERDTKQPTRR
RSNEAMTTQPDKAAQEEKPQPAVSSIFADIRNGLWTKVWDKLFLTKPVSASSLRPEHSNASGPSQGGVCGTPGAP
MKPGYCKDCACKCSEIHEEDLATLAAGKAVRKRLHADGSRMLITPNGDCIRGLTEEEEEAFLVLQAAIASTAEHP
AAYVALRHQSGNGAFSLIKGRAVPNGRPNIFPTSCQPQAQDPIGKLQREDALSYINQYVLPRLNLGGSSSGGVGG
ASTTSGGAKLSPTMARDSTAANFNSLAPYFYGPDAAAGVGIYSTAEATQGSQDYSSSPTLSLSVAGAPGAGDESS
RLLGGLGGSGGMPLLSVEDAEGALSAARKETEKLEKGLNAVIRRNRRLLLGGNH*
Coding >OphauB2|867
ATGGCGCCGCAGGATTCCTTTTTTGAGGAGGAGGAAGAACTCTGCCCGCTATGCATCGAAGAATTTGATCTATCT
GATCGTAACTTCCGGCCGTGTCCCTGTGGATATCAGGTTTGCCAATTCTGTTTCAATAACATCAAGAACAACATG
AATGGTCTCTGTCCGGCATGTAGACGTCCGTACGACGAGAAGACAATACAGTGGAAAGTCGTAACGCAGGAAGAA
GTTGCCGAATTCCGTGCCAACATTCAGAAAAACCAAAAGAAACGGGCTCAAGAACAACGTCAAAAAGAAGCGCAA
AAACGCGAAGCCGAAAAGGAAAATCGCAAGAATCTGATAGGGGTTCGCGTGGTTCAGAAGAACCTAGTGTACGTA
ACCGGATTGGCTCCTACCATTAGAGAAGACGAACTCCTCAAGACGTTACGCAAGCCCGAGTTTTTCGGACAGTAC
GGCAACATTCAGAAAATATCAATCAGTAACAGGAAAAGTTCAGACGGCCAACACCACTCACTCGGCATCTATGTA
ACATTTGAAAAACCAGAAGAGGCAACACGCTGCATCCAAGCCGTTCATGGGTCTCAGAACGGCGACCGCATCCTC
AAGGCACAGCACGGTACAACAAAATATTGTTCTGCATGGCTCAAGAATGAAAAGTGCAACAATCCCGGCTGCATG
TTTCTTCACGAGCAGGGTGATGAAGAGGACAGCTATACACGGCAGGATCTTTCGTCGATGAATAGCATACATACT
CAGCGTCCGCTCCCAAGCGGTGGGACCTCTTCACGTGCGGCATCACGCCAACAGGCCTCTCAACCAACTCCACCA
CCTCCCATGTCCCAGCCCATGGCCCGTTCGTCCAGTAAAGAGGGCTCCGAAACCGGGGTTGATGCATCTGCCTTA
CCTTCGTCCGCAAGCTGGGCTCGTAATCCTCAACGGAGCCGTCGGGGCAGTCAGGCCACCAGCGGTACAATCTCA
AGTCCTACCATTTCGACATCTCAGCCCGCAACCGGCGATGGTGCCCCCTCCCAAAACGCCGAAGATTCTGTCATA
TCACCTACAGCTCGCAATGCTCAGGTCACGGAACCTATGCCCTACATGTCTTGGTTCAAGCCTACAGACGTCACA
ACCGAAGACATGATTAAAGCTCTGACAGGTTGGGAGTTACCTCTTCGTGGCAAGACAGTCGACGAAACGGGACCG
CCCATGTGGGACACTTACGGTGGCGTTCGGCGCCGGGCTATGAAGCGTGAAGAGGCGGAATTGAGAGCAAGAGAG
ATGGAGGAACGACGTGAAGCGCATGCTGCATCTGAGCCGGAGCCCGAGGCCAGAGGCGGTAGCCTTGCTCTCGGC
GGTGAGCCTGAAGAACGTGACGTGAGCAGTGAGGGCCATGGATTTGATCAGAGGCAGACAAATACACAGCCCCCC
ATTCAGCGAGGAAGCACCGATGGCAATATGTTCGGCTCTGCGTCACTGGGTGCTTCGTCAAGTTTTAGTCAAAGT
TCAACGATTGCAGGGTCCATGGGGCGCGCCATGACGCCGCAGCATTTTGCTTCGCTGCGATCTCAGACCAGTTTC
GCCGACCAAATGCCTCCAGGCTTCACGGGCCAGAGCAACATGTTGCAACAGGCTCCTGGACACAATCGCCAGTCG
TCACGCTTCAACTTTGCCAATGATAATGCTAGTTCGGCGGCCACCAATATTAAACTGGCAGCAAACCCTCGCATC
ATGGCGCAACAGTCGTCAATGATGCCAAGTGCCTTCCAGTCGCAGAGTAGCAGCCAGTATTATGGCAGCTCGATG
CCTGGACCACCTCCGGGGCTCAAGTCGACGGGCACGCCTCCCAGCATGTTTGGACAGACCTTTGGTGGTTTTGGA
ACGGTGCCAAAGGATTCGTCGAGCGACCTTTTGCAAAGTCTCATGGGACGAAATCGAGCAGGTGGCAGCCAAGGA
CTCGAGGCCGGAAAGCTAGATCTTGCGGACCCGAGCATCCTGCAAGCACGGATGCAGGCCCAGTCGCAGAGCAAT
GCCGGAGCCGGTCAGGGACTGTTTGGAGGACAGAGTCAAGCAGCAGACGACGAGCTACCATCACTGGCTGAAGCG
AGTGATTCGGTGGATGCACTAGTCTCTGATGAACCACAAGGTGTCTTCTTGCAGCACACGGCACAGCCCCAGCCA
CTTGGACCGCCTGGGATCGTGGCGCCTCATGCAAATATGGAGCCTGCAAGACAAGCTCGCCCTTCAAACGTTAAT
GTTGTACCTGTCCTGCCGAAGGTTGGGCCACCTGGCCTTGAGCATGGAGCTATAACTCCGCTAGCGACGCCACGG
AAACCCTTGGCTCACGCGAACACATCTGCCTCGACTGATCCTATAAAGGCGCCCCTGTCCAATCAGCATCGTCCT
GCACCGTCTCGTCAACTGTCATTGTTAGATGATGAAGACTTCCCGGCACTAAATGCTCCCAAACATGTCGCTCAT
CAAACAACAGCACCCGCTGTTTCTTCAGTACCGACTCCACGAGGCACCCCTGCCCCTAAAAAGCAGGCTACGACA
GACCGGTTCCCAGTGCCGGAAAAGATCGCAGAACCAGGAGGTGAAAAAGCAAACATAGCACCTGATGCTGGCCCT
TCTCGCGGTGCCAAGAATAAAACGAGCGTTTCAGGCTCGCAAAGCTTTAAGCTGGCAGCAATCAATACTACTGGA
ATCAAGACCGAAGATATGACCAGGAACGACGCGTCGGCAGCCACAACTCCGGTGACTAGAACAGACTCACCTGTG
ACACGCGCAGCACCTCGATCAATCCGCGTTTTGCCCTTATCTAAAGCTGATGCAGCCGCAATGCCTTCGCCGGCG
CCCTCGGCAGCTTCAAAGGCGGTTTCGGCGTCTCACGGCCCAGAAACTCCAGCAAGCGAAGTTGTTAGTGACACA
GCATCTCTGGTGTCTGCTTCGGCCTCAGTCTCCCGCGCGGGATCTCCCCCACTTGGCAAGATTGGGTCTGCCGCC
GTGCGACCAACTACCAAGAGCCAACAGCGGAAACAACGCAAAGAGGCCGCGAGACAGGAGACGAAGATAATATCA
GAGGCTCCCAAAGCAGAGCCTGAGGAGCACGCTCCTTTAATTGGTCGCAAGAAGAAACAGAAGAAACAAAAGGCT
GCCAAGTCGCCAGTCCAAGAGACAGCCTCGACTCAAGGCGCGGCTAAAGAAGAAAAGCAAGCAGAAGCGGAATCG
CTAGCCGAAGCCAAAGCCCAGCCCTCGCAGGGCCCCGACGACGAGACAGAAAAAGAAGAGTGCAAAGGCAAAATG
GCTAAGGGCGAATCACACAAAAAGGCCAGTAAGGCTAAGAGCACTGAACGGGACACCAAGCAGCCAACAAGAAGA
AGGTCGAATGAGGCAATGACGACGCAACCCGACAAAGCAGCTCAAGAAGAAAAACCACAGCCAGCTGTATCGTCA
ATATTTGCGGACATTCGAAATGGTCTGTGGACAAAGGTTTGGGACAAGCTGTTTTTGACGAAGCCGGTATCTGCA
AGCTCGTTGCGTCCGGAGCATAGCAATGCATCTGGCCCCTCTCAGGGAGGTGTCTGTGGCACCCCAGGGGCGCCC
ATGAAGCCAGGCTACTGCAAGGATTGCGCGTGTAAGTGCAGCGAAATTCACGAGGAAGATCTGGCAACTCTTGCA
GCGGGCAAGGCAGTGCGGAAGCGGCTACATGCTGATGGAAGCCGTATGCTTATCACGCCAAATGGCGACTGCATT
CGTGGCCTGACGGAAGAAGAGGAGGAAGCTTTTTTGGTACTTCAGGCAGCGATAGCTTCCACGGCAGAGCATCCT
GCGGCCTACGTGGCTCTCCGGCACCAGTCTGGCAACGGAGCCTTTTCTCTCATCAAAGGCCGTGCAGTGCCGAAT
GGACGGCCCAATATCTTTCCGACAAGTTGTCAGCCACAGGCACAAGATCCGATTGGCAAGTTGCAGCGTGAAGAC
GCGCTTAGTTACATCAATCAATATGTGCTGCCGCGGTTGAATCTGGGTGGGAGCAGCAGCGGTGGCGTTGGCGGA
GCAAGCACGACGAGTGGCGGCGCCAAACTATCGCCAACAATGGCTCGGGATTCGACGGCAGCCAACTTCAACTCC
CTAGCTCCCTACTTTTACGGCCCAGACGCTGCAGCAGGCGTGGGCATCTACAGCACAGCCGAGGCAACACAAGGA
TCACAAGACTACTCGTCGTCACCCACGCTGTCGCTGTCAGTTGCTGGGGCTCCTGGCGCTGGCGACGAAAGCTCA
AGGCTCCTAGGCGGGCTCGGCGGCAGTGGGGGGATGCCCCTTCTCAGCGTTGAAGATGCCGAAGGCGCCTTGTCA
GCGGCGCGAAAGGAAACTGAGAAGCTTGAGAAGGGCCTCAATGCCGTTATCAGACGCAATAGAAGACTGCTCTTG
GGCGGGAACCACTAG
Transcript >OphauB2|867
ATGGCGCCGCAGGATTCCTTTTTTGAGGAGGAGGAAGAACTCTGCCCGCTATGCATCGAAGAATTTGATCTATCT
GATCGTAACTTCCGGCCGTGTCCCTGTGGATATCAGGTTTGCCAATTCTGTTTCAATAACATCAAGAACAACATG
AATGGTCTCTGTCCGGCATGTAGACGTCCGTACGACGAGAAGACAATACAGTGGAAAGTCGTAACGCAGGAAGAA
GTTGCCGAATTCCGTGCCAACATTCAGAAAAACCAAAAGAAACGGGCTCAAGAACAACGTCAAAAAGAAGCGCAA
AAACGCGAAGCCGAAAAGGAAAATCGCAAGAATCTGATAGGGGTTCGCGTGGTTCAGAAGAACCTAGTGTACGTA
ACCGGATTGGCTCCTACCATTAGAGAAGACGAACTCCTCAAGACGTTACGCAAGCCCGAGTTTTTCGGACAGTAC
GGCAACATTCAGAAAATATCAATCAGTAACAGGAAAAGTTCAGACGGCCAACACCACTCACTCGGCATCTATGTA
ACATTTGAAAAACCAGAAGAGGCAACACGCTGCATCCAAGCCGTTCATGGGTCTCAGAACGGCGACCGCATCCTC
AAGGCACAGCACGGTACAACAAAATATTGTTCTGCATGGCTCAAGAATGAAAAGTGCAACAATCCCGGCTGCATG
TTTCTTCACGAGCAGGGTGATGAAGAGGACAGCTATACACGGCAGGATCTTTCGTCGATGAATAGCATACATACT
CAGCGTCCGCTCCCAAGCGGTGGGACCTCTTCACGTGCGGCATCACGCCAACAGGCCTCTCAACCAACTCCACCA
CCTCCCATGTCCCAGCCCATGGCCCGTTCGTCCAGTAAAGAGGGCTCCGAAACCGGGGTTGATGCATCTGCCTTA
CCTTCGTCCGCAAGCTGGGCTCGTAATCCTCAACGGAGCCGTCGGGGCAGTCAGGCCACCAGCGGTACAATCTCA
AGTCCTACCATTTCGACATCTCAGCCCGCAACCGGCGATGGTGCCCCCTCCCAAAACGCCGAAGATTCTGTCATA
TCACCTACAGCTCGCAATGCTCAGGTCACGGAACCTATGCCCTACATGTCTTGGTTCAAGCCTACAGACGTCACA
ACCGAAGACATGATTAAAGCTCTGACAGGTTGGGAGTTACCTCTTCGTGGCAAGACAGTCGACGAAACGGGACCG
CCCATGTGGGACACTTACGGTGGCGTTCGGCGCCGGGCTATGAAGCGTGAAGAGGCGGAATTGAGAGCAAGAGAG
ATGGAGGAACGACGTGAAGCGCATGCTGCATCTGAGCCGGAGCCCGAGGCCAGAGGCGGTAGCCTTGCTCTCGGC
GGTGAGCCTGAAGAACGTGACGTGAGCAGTGAGGGCCATGGATTTGATCAGAGGCAGACAAATACACAGCCCCCC
ATTCAGCGAGGAAGCACCGATGGCAATATGTTCGGCTCTGCGTCACTGGGTGCTTCGTCAAGTTTTAGTCAAAGT
TCAACGATTGCAGGGTCCATGGGGCGCGCCATGACGCCGCAGCATTTTGCTTCGCTGCGATCTCAGACCAGTTTC
GCCGACCAAATGCCTCCAGGCTTCACGGGCCAGAGCAACATGTTGCAACAGGCTCCTGGACACAATCGCCAGTCG
TCACGCTTCAACTTTGCCAATGATAATGCTAGTTCGGCGGCCACCAATATTAAACTGGCAGCAAACCCTCGCATC
ATGGCGCAACAGTCGTCAATGATGCCAAGTGCCTTCCAGTCGCAGAGTAGCAGCCAGTATTATGGCAGCTCGATG
CCTGGACCACCTCCGGGGCTCAAGTCGACGGGCACGCCTCCCAGCATGTTTGGACAGACCTTTGGTGGTTTTGGA
ACGGTGCCAAAGGATTCGTCGAGCGACCTTTTGCAAAGTCTCATGGGACGAAATCGAGCAGGTGGCAGCCAAGGA
CTCGAGGCCGGAAAGCTAGATCTTGCGGACCCGAGCATCCTGCAAGCACGGATGCAGGCCCAGTCGCAGAGCAAT
GCCGGAGCCGGTCAGGGACTGTTTGGAGGACAGAGTCAAGCAGCAGACGACGAGCTACCATCACTGGCTGAAGCG
AGTGATTCGGTGGATGCACTAGTCTCTGATGAACCACAAGGTGTCTTCTTGCAGCACACGGCACAGCCCCAGCCA
CTTGGACCGCCTGGGATCGTGGCGCCTCATGCAAATATGGAGCCTGCAAGACAAGCTCGCCCTTCAAACGTTAAT
GTTGTACCTGTCCTGCCGAAGGTTGGGCCACCTGGCCTTGAGCATGGAGCTATAACTCCGCTAGCGACGCCACGG
AAACCCTTGGCTCACGCGAACACATCTGCCTCGACTGATCCTATAAAGGCGCCCCTGTCCAATCAGCATCGTCCT
GCACCGTCTCGTCAACTGTCATTGTTAGATGATGAAGACTTCCCGGCACTAAATGCTCCCAAACATGTCGCTCAT
CAAACAACAGCACCCGCTGTTTCTTCAGTACCGACTCCACGAGGCACCCCTGCCCCTAAAAAGCAGGCTACGACA
GACCGGTTCCCAGTGCCGGAAAAGATCGCAGAACCAGGAGGTGAAAAAGCAAACATAGCACCTGATGCTGGCCCT
TCTCGCGGTGCCAAGAATAAAACGAGCGTTTCAGGCTCGCAAAGCTTTAAGCTGGCAGCAATCAATACTACTGGA
ATCAAGACCGAAGATATGACCAGGAACGACGCGTCGGCAGCCACAACTCCGGTGACTAGAACAGACTCACCTGTG
ACACGCGCAGCACCTCGATCAATCCGCGTTTTGCCCTTATCTAAAGCTGATGCAGCCGCAATGCCTTCGCCGGCG
CCCTCGGCAGCTTCAAAGGCGGTTTCGGCGTCTCACGGCCCAGAAACTCCAGCAAGCGAAGTTGTTAGTGACACA
GCATCTCTGGTGTCTGCTTCGGCCTCAGTCTCCCGCGCGGGATCTCCCCCACTTGGCAAGATTGGGTCTGCCGCC
GTGCGACCAACTACCAAGAGCCAACAGCGGAAACAACGCAAAGAGGCCGCGAGACAGGAGACGAAGATAATATCA
GAGGCTCCCAAAGCAGAGCCTGAGGAGCACGCTCCTTTAATTGGTCGCAAGAAGAAACAGAAGAAACAAAAGGCT
GCCAAGTCGCCAGTCCAAGAGACAGCCTCGACTCAAGGCGCGGCTAAAGAAGAAAAGCAAGCAGAAGCGGAATCG
CTAGCCGAAGCCAAAGCCCAGCCCTCGCAGGGCCCCGACGACGAGACAGAAAAAGAAGAGTGCAAAGGCAAAATG
GCTAAGGGCGAATCACACAAAAAGGCCAGTAAGGCTAAGAGCACTGAACGGGACACCAAGCAGCCAACAAGAAGA
AGGTCGAATGAGGCAATGACGACGCAACCCGACAAAGCAGCTCAAGAAGAAAAACCACAGCCAGCTGTATCGTCA
ATATTTGCGGACATTCGAAATGGTCTGTGGACAAAGGTTTGGGACAAGCTGTTTTTGACGAAGCCGGTATCTGCA
AGCTCGTTGCGTCCGGAGCATAGCAATGCATCTGGCCCCTCTCAGGGAGGTGTCTGTGGCACCCCAGGGGCGCCC
ATGAAGCCAGGCTACTGCAAGGATTGCGCGTGTAAGTGCAGCGAAATTCACGAGGAAGATCTGGCAACTCTTGCA
GCGGGCAAGGCAGTGCGGAAGCGGCTACATGCTGATGGAAGCCGTATGCTTATCACGCCAAATGGCGACTGCATT
CGTGGCCTGACGGAAGAAGAGGAGGAAGCTTTTTTGGTACTTCAGGCAGCGATAGCTTCCACGGCAGAGCATCCT
GCGGCCTACGTGGCTCTCCGGCACCAGTCTGGCAACGGAGCCTTTTCTCTCATCAAAGGCCGTGCAGTGCCGAAT
GGACGGCCCAATATCTTTCCGACAAGTTGTCAGCCACAGGCACAAGATCCGATTGGCAAGTTGCAGCGTGAAGAC
GCGCTTAGTTACATCAATCAATATGTGCTGCCGCGGTTGAATCTGGGTGGGAGCAGCAGCGGTGGCGTTGGCGGA
GCAAGCACGACGAGTGGCGGCGCCAAACTATCGCCAACAATGGCTCGGGATTCGACGGCAGCCAACTTCAACTCC
CTAGCTCCCTACTTTTACGGCCCAGACGCTGCAGCAGGCGTGGGCATCTACAGCACAGCCGAGGCAACACAAGGA
TCACAAGACTACTCGTCGTCACCCACGCTGTCGCTGTCAGTTGCTGGGGCTCCTGGCGCTGGCGACGAAAGCTCA
AGGCTCCTAGGCGGGCTCGGCGGCAGTGGGGGGATGCCCCTTCTCAGCGTTGAAGATGCCGAAGGCGCCTTGTCA
GCGGCGCGAAAGGAAACTGAGAAGCTTGAGAAGGGCCTCAATGCCGTTATCAGACGCAATAGAAGACTGCTCTTG
GGCGGGAACCACTAG
Gene >OphauB2|867
ATGGCGCCGCAGGATTCCTTTTTTGAGGAGGAGGAAGAACTCTGGTAAGTTGGGACTTACCCAATGTTTATAGCA
GCATACGCCAATCTCTCAACACTTGCTCCAAAATCTCGCACTTGACAAAGCTCAGCTCGAACATTTAGTCGCTGA
CTCTGAGCGAAGCCCGCTATGCATCGAAGAATTTGATCTATCTGATCGTAACTTCCGGCCGTGTCCCTGTGGATA
TCAGGTAAGGATAAAACCGTTGTTTTTATTTTGTTATGTTTTGTTTACTCACCTCGACGGTGTAGGTTTGCCAAT
TCTGTTTCAATAACATCAAGAACAACATGAATGGTCTCTGTCCGGCATGTAGACGTCCGTACGACGAGAAGACAA
TACAGTGGAAAGTCGTAACGCAGGAAGAGTGCGTCATGCTAGTGCTGCACCTTGGGTCGTGACACAAAGCTGACT
AGTCATCAGAGTTGCCGAATTCCGTGCCAACATTCAGAAAAACCAAAAGAAACGGGCTCAAGAACAACGTCAAAA
AGAAGCGCAAAAACGCGAAGCCGAAAAGGAAAATCGCAAGAATCTGATAGGGGTTCGCGTGGTTCAGAAGAACCT
AGTGTACGTAACCGGATTGGCTCCTACCATTAGAGAAGACGAACTCCTCAAGACGTTACGCAAGCCCGAGTTTTT
CGGACAGTACGGCAACATTCAGAAAATATCAATCAGTAACAGGAAAAGTTCAGACGGCCAACACCACTCACTCGG
CATCTATGTAACATTTGAAAAACCAGAAGAGGCAACACGCTGCATCCAAGCCGTTCATGGGTCTCAGAACGGCGA
CCGCATCCTCAAGGCACAGCACGGTACAACAAAATATTGTTCTGCATGGCTCAAGAATGAAAAGTGCAACAATCC
CGGCTGCATGTTTCTTCACGAGCAGGGTGATGAAGAGGACAGCTATACACGGCAGGATCTTTCGTCGATGAATAG
CATACATACTCAGCGTCCGCTCCCAAGCGGTGGGACCTCTTCACGTGCGGCATCACGCCAACAGGCCTCTCAACC
AACTCCACCACCTCCCATGTCCCAGCCCATGGCCCGTTCGTCCAGTAAAGAGGGCTCCGAAACCGGGGTTGATGC
ATCTGCCTTACCTTCGTCCGCAAGCTGGGCTCGTAATCCTCAACGGAGCCGTCGGGGCAGTCAGGCCACCAGCGG
TACAATCTCAAGTCCTACCATTTCGACATCTCAGCCCGCAACCGGCGATGGTGCCCCCTCCCAAAACGCCGAAGA
TTCTGTCATATCACCTACAGCTCGCAATGCTCAGGTCACGGAACCTATGCCCTACATGTCTTGGTTCAAGCCTAC
AGACGTCACAACCGAAGACATGATTAAAGCTCTGACAGGTTGGGAGTTACCTCTTCGTGGCAAGACAGTCGACGA
AACGGGACCGCCCATGTGGGACACTTACGGTGGCGTTCGGCGCCGGGCTATGAAGCGTGAAGAGGCGGAATTGAG
AGCAAGAGAGATGGAGGAACGACGTGAAGCGCATGCTGCATCTGAGCCGGAGCCCGAGGCCAGAGGCGGTAGCCT
TGCTCTCGGCGGTGAGCCTGAAGAACGTGACGTGAGCAGTGAGGGCCATGGATTTGATCAGAGGCAGACAAATAC
ACAGCCCCCCATTCAGCGAGGAAGCACCGATGGCAATATGTTCGGCTCTGCGTCACTGGGTGCTTCGTCAAGTTT
TAGTCAAAGTTCAACGATTGCAGGGTCCATGGGGCGCGCCATGACGCCGCAGCATTTTGCTTCGCTGCGATCTCA
GACCAGTTTCGCCGACCAAATGCCTCCAGGCTTCACGGGCCAGAGCAACATGTTGCAACAGGCTCCTGGACACAA
TCGCCAGTCGTCACGCTTCAACTTTGCCAATGATAATGCTAGTTCGGCGGCCACCAATATTAAACTGGCAGCAAA
CCCTCGCATCATGGCGCAACAGTCGTCAATGATGCCAAGTGCCTTCCAGTCGCAGAGTAGCAGCCAGTATTATGG
CAGCTCGATGCCTGGACCACCTCCGGGGCTCAAGTCGACGGGCACGCCTCCCAGCATGTTTGGACAGACCTTTGG
TGGTTTTGGAACGGTGCCAAAGGATTCGTCGAGCGACCTTTTGCAAAGTCTCATGGGACGAAATCGAGCAGGTGG
CAGCCAAGGACTCGAGGCCGGAAAGCGTGAGTACTTTGTCTCTTCTTTTCACAACCAATACCCAGCACCTTCACT
AGCACAAACCCAAACACAAGTACCGGCACCTCCATCATCTACCTCTACCCCAGCTCCTGCTCCGGGCCTCCTGGC
ATCGCTCTACGGCAATCAGCCCGTGGCATACCAAGATTTCAGTTCCAAGCAGAAGAAGAAGGGGAAGAAGCACAG
ACATGCTAACACTTCCTCCTCTGGGGGGAGTGGCTTAGTAGATCTTGCGGACCCGAGCATCCTGCAAGCACGGAT
GCAGGCCCAGTCGCAGAGCAATGCCGGAGCCGGTCAGGGACTGTTTGGAGGACAGAGTCAAGGTGGGTACAATCC
CAACATGATGTACAATGCCAACTACCCCCGGTGGTAGCTGGGAATGACTGTCTGGTCATGACTACATTCTTCAGT
CACGTCTAATGTCTTGTTGTTTTCCTATTTTCCAATGTTATATGGTGGTATAAACTGTTGGGATGGCGTCTGGGT
CTTGGGAGGAAATGACTGCTCGACGGACCTTGGAATTTGGCCCAACGGCCCGTCATCACGGGAGACAAGAGGCGT
CTCCTTGTTTCTGCTTCTTCGGGGCACCGCGACTGCAAGGAGGCGTCACGATATCAACGAGATTCCTTCGATTGC
TTCTCTTTTTCTTTTTGGACCATCATCCTCGGCCGGCCGCGACGTCGGCGATAGCTGGAGGACCAAGTCAGGCAA
GCCATCATCGTCTTCCACGGGCACACCGTATGTACGTTAACAAGATCGCATTGATGCGTTGCGTGTCCCCTTTAT
GGGTGGTGGCGACGCATCTTGCTGATCAGAATAAAGACAACAATCCCTCTAAGTCATGTCACTCCTCAATTATTT
CCGCGTGGAAGACGATGATGGGAAGCCGTAGCACCTGGACTCCCCACGTCGTGTTCTGTATGATCAGCCGGATGG
CGTTGCGTAGTTTATTTGTTTACATTTAGCTTTTTCTCATTCTCCTCCCCCCTTGAACTGCTTACTCAAGCATGG
AGAAAACTTGATGCTAATTTTCTTCTCTCAGCAGCAGACGACGAGCTACCATCACTGGCTGAAGCGAGTGATTCG
GTGGATGCACTAGTCTCTGATGAACCACAAGGTGTCTTCTTGCAGCACACGGCACAGCCCCAGCCACTTGGACCG
CCTGGGATCGTGGCGCCTCATGCAAATATGGAGCCTGCAAGACAAGCTCGCCCTTCAAACGTTAATGTTGTACCT
GTCCTGCCGAAGGTTGGGCCACCTGGCCTTGAGCATGGAGCTATAACTCCGCTAGCGACGCCACGGAAACCCTTG
GCTCACGCGAACACATCTGCCTCGACTGATCCTATAAAGGCGCCCCTGTCCAATCAGCATCGTCCTGCACCGTCT
CGTCAACTGTCATTGTTAGATGATGAAGACTTCCCGGCACTAAATGCTCCCAAACATGTCGCTCATCAAACAACA
GCACCCGCTGTTTCTTCAGTACCGACTCCACGAGGCACCCCTGCCCCTAAAAAGCAGGCTACGACAGACCGGTTC
CCAGTGCCGGAAAAGATCGCAGAACCAGGAGGTGAAAAAGCAAACATAGCACCTGATGCTGGCCCTTCTCGCGGT
GCCAAGAATAAAACGAGCGTTTCAGGCTCGCAAAGCTTTAAGCTGGCAGCAATCAATACTACTGGAATCAAGACC
GAAGATATGACCAGGAACGACGCGTCGGCAGCCACAACTCCGGTGACTAGAACAGACTCACCTGTGACACGCGCA
GCACCTCGATCAATCCGCGTTTTGCCCTTATCTAAAGCTGATGCAGCCGCAATGCCTTCGCCGGCGCCCTCGGCA
GCTTCAAAGGCGGTTTCGGCGTCTCACGGCCCAGAAACTCCAGCAAGCGAAGTTGTTAGTGACACAGCATCTCTG
GTGTCTGCTTCGGCCTCAGTCTCCCGCGCGGGATCTCCCCCACTTGGCAAGATTGGGTCTGCCGCCGTGCGACCA
ACTACCAAGAGCCAACAGCGGAAACAACGCAAAGAGGCCGCGAGACAGGAGACGAAGATAATATCAGAGGCTCCC
AAAGCAGAGCCTGAGGAGCACGCTCCTTTAATTGGTCGCAAGAAGAAACAGAAGAAACAAAAGGCTGCCAAGTCG
CCAGTCCAAGAGACAGCCTCGACTCAAGGCGCGGCTAAAGAAGAAAAGCAAGCAGAAGCGGAATCGCTAGCCGAA
GCCAAAGCCCAGCCCTCGCAGGGCCCCGACGACGAGACAGAAAAAGAAGAGTGCAAAGGCAAAATGGCTAAGGGC
GAATCACACAAAAAGGCCAGTAAGGCTAAGAGCACTGAACGGGACACCAAGCAGCCAACAAGAAGAAGGTCGAAT
GAGGCAATGACGACGCAACCCGACAAAGCAGCTCAAGAAGAAAAACCACAGCCAGCTGTATCGTCAATATTTGCG
GACATTCGAAATGGTCTGTGGACAAAGGTTTGGGACAAGCTGTTTTTGACGAAGCCGGTATCTGCAAGCTCGTTG
CGTCCGGAGCATAGCAATGCATCTGGCCCCTCTCAGGGAGGTGTCTGTGGCACCCCAGGGGCGCCCATGAAGCCA
GGCTACTGCAAGGATTGCGCGTGTAAGTGCAGCGAAATTCACGAGGAAGATCTGGCAACTCTTGCAGCGGGCAAG
GCAGTGCGGAAGCGGCTACATGCTGATGGAAGCCGTATGCTTATCACGCCAAATGGCGACTGCATTCGTGGCCTG
ACGGAAGAAGAGGAGGAAGCTTTTTTGGTACTTCAGGCAGCGATAGCTTCCACGGCAGAGCATCCTGCGGCCTAC
GTGGCTCTCCGGCACCAGTCTGGCAACGGAGCCTTTTCTCTCATCAAAGGCCGTGCAGTGCCGAATGGACGGCCC
AATATCTTTCCGACAAGTTGTCAGCCACAGGCACAAGATCCGATTGGCAAGTTGCAGCGTGAAGACGCGCTTAGT
TACATCAATCAATATGTGCTGCCGCGGTTGAATCTGGGTGGGAGCAGCAGCGGTGGCGTTGGCGGAGCAAGCACG
ACGAGTGGCGGCGCCAAACTATCGCCAACAATGGCTCGGGATTCGACGGCAGCCAACTTCAACTCCCTAGCTCCC
TACTTTTACGGCCCAGACGCTGCAGCAGGCGTGGGCATCTACAGCACAGCCGAGGCAACACAAGGATCACAAGAC
TACTCGTCGTCACCCACGCTGTCGCTGTCAGTTGCTGGGGCTCCTGGCGCTGGCGACGAAAGCTCAAGGCTCCTA
GGCGGGCTCGGCGGCAGTGGGGGGATGCCCCTTCTCAGCGTTGAAGATGCCGAAGGCGCCTTGTCAGCGGCGCGA
AAGGAAACTGAGAAGCTTGAGAAGGGCCTCAATGCCGTTATCAGACGCAATAGAAGACTGCTCTTGGGCGGGAAC
CACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail