Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|857
Gene name
LocationContig_119:50815..52350
Strand-
Gene length (bp)1535
Transcript length (bp)1416
Coding sequence length (bp)1416
Protein length (aa) 472

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13242 Hydrolase_like HAD-hyrolase-like 1.6E-15 341 448
PF13344 Hydrolase_6 Haloacid dehalogenase-like hydrolase 2.4E-15 75 183

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P36151|YK50_YEAST Uncharacterized protein YKR070W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKR070W PE=1 SV=1 67 454 9.0E-50
sp|O13899|YF38_SCHPO Uncharacterized CDP-alcohol phosphatidyltransferase class-I family protein C22A12.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22A12.08c PE=3 SV=1 73 455 8.0E-43
sp|Q9BXW7|CECR5_HUMAN Cat eye syndrome critical region protein 5 OS=Homo sapiens GN=CECR5 PE=1 SV=1 34 458 8.0E-25
sp|Q91WM2|CECR5_MOUSE Cat eye syndrome critical region protein 5 homolog OS=Mus musculus GN=Cecr5 PE=1 SV=1 73 408 3.0E-24

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|857
MLPVTRSCLRLRPGRVACGWASWSIGYKQPSKPLAALAARRHLCFTPRLGESISEPDNSLDGNPEAQGALDHIGF
VFDIDGVLHQGVKPIPGTAPLLSNLFRKDVRYIFLSNGGGTHEDVKNESLGTRMCMSKTVRNYLINDRVILSHTP
MRAWSESAKQQTVLITGVREDTARQVAMQYGFKRVITPSDLLHANNDVYAFDKLKETLHAKHRALPDNKSASAIT
DPHCSPDSIPDNALRIDKIMVWNDPRDWAVDIQLIHDLLVSHRGYLGTVSALNGDASLPNRGWQQDGQPELWVSN
LDLYWKTNYPMNRFGTGAFVEALKGVWSAVTGGAELQYHAMGKPLRPTFEFAHQRLLHGDLGAIIHQKSEPGAQN
AEPTTPSSAAKPLRRVYMIGDNPESDIRGALEFKPEDGAEWVPILVRTGVWQQSAAEPEPRFKPAVIVDDVVEGV
LWALANEGVTMSREELFRGNE*
Coding >OphauB2|857
ATGTTACCTGTTACCAGAAGCTGCTTGAGGCTTCGCCCTGGCCGTGTAGCCTGTGGGTGGGCGTCTTGGTCAATT
GGTTACAAGCAGCCATCAAAGCCTCTTGCTGCACTCGCCGCACGCCGACACCTTTGCTTCACCCCAAGACTGGGC
GAGAGCATCAGCGAGCCGGACAACTCATTGGACGGAAACCCAGAAGCACAAGGAGCTTTGGACCACATCGGCTTT
GTTTTCGACATCGATGGCGTCCTTCACCAGGGCGTCAAACCCATACCCGGGACTGCACCACTCCTGAGCAACCTT
TTCAGAAAGGATGTGCGCTACATTTTCCTCTCCAATGGCGGGGGAACGCACGAAGACGTCAAGAATGAGTCGCTG
GGCACGAGGATGTGCATGAGCAAGACGGTTCGCAACTATCTTATTAACGACCGCGTCATTCTCTCACATACGCCT
ATGCGCGCGTGGTCTGAATCGGCCAAGCAGCAGACGGTTCTGATTACAGGCGTCCGCGAAGACACGGCGCGCCAG
GTGGCCATGCAATATGGATTCAAGCGCGTCATTACGCCGTCGGACCTCTTGCATGCCAATAACGATGTCTATGCC
TTTGACAAGCTCAAGGAAACCCTGCACGCAAAGCATCGTGCGCTGCCTGACAACAAGTCGGCGTCTGCCATTACT
GATCCACACTGCTCTCCCGACTCCATACCCGACAATGCGCTGCGCATCGACAAGATTATGGTGTGGAACGACCCG
CGCGACTGGGCGGTTGACATTCAACTCATTCACGACCTGCTTGTTTCGCATCGAGGCTACCTGGGCACCGTCTCG
GCGCTCAACGGCGACGCATCGCTACCCAACCGCGGATGGCAGCAGGACGGCCAGCCAGAGCTCTGGGTGTCCAAT
CTCGACCTGTACTGGAAGACGAATTATCCCATGAATCGATTCGGCACGGGTGCCTTTGTCGAGGCCTTGAAGGGG
GTCTGGTCGGCAGTGACGGGGGGCGCTGAGCTGCAGTATCATGCCATGGGCAAGCCCCTACGCCCCACCTTTGAG
TTTGCACACCAGCGACTGCTGCATGGCGACCTGGGGGCAATCATTCACCAAAAGTCGGAACCTGGTGCACAAAAT
GCTGAGCCAACAACCCCCAGCTCTGCAGCGAAGCCACTGCGCAGAGTATACATGATTGGCGACAATCCCGAAAGC
GACATTCGGGGCGCCCTAGAATTCAAGCCCGAGGATGGCGCCGAGTGGGTGCCCATCTTGGTGCGGACGGGCGTG
TGGCAGCAGAGCGCGGCGGAGCCTGAGCCACGGTTCAAGCCAGCCGTCATTGTTGACGATGTTGTCGAGGGGGTC
CTGTGGGCCTTGGCCAATGAGGGCGTCACTATGTCGCGCGAGGAGCTTTTCCGAGGCAACGAATAG
Transcript >OphauB2|857
ATGTTACCTGTTACCAGAAGCTGCTTGAGGCTTCGCCCTGGCCGTGTAGCCTGTGGGTGGGCGTCTTGGTCAATT
GGTTACAAGCAGCCATCAAAGCCTCTTGCTGCACTCGCCGCACGCCGACACCTTTGCTTCACCCCAAGACTGGGC
GAGAGCATCAGCGAGCCGGACAACTCATTGGACGGAAACCCAGAAGCACAAGGAGCTTTGGACCACATCGGCTTT
GTTTTCGACATCGATGGCGTCCTTCACCAGGGCGTCAAACCCATACCCGGGACTGCACCACTCCTGAGCAACCTT
TTCAGAAAGGATGTGCGCTACATTTTCCTCTCCAATGGCGGGGGAACGCACGAAGACGTCAAGAATGAGTCGCTG
GGCACGAGGATGTGCATGAGCAAGACGGTTCGCAACTATCTTATTAACGACCGCGTCATTCTCTCACATACGCCT
ATGCGCGCGTGGTCTGAATCGGCCAAGCAGCAGACGGTTCTGATTACAGGCGTCCGCGAAGACACGGCGCGCCAG
GTGGCCATGCAATATGGATTCAAGCGCGTCATTACGCCGTCGGACCTCTTGCATGCCAATAACGATGTCTATGCC
TTTGACAAGCTCAAGGAAACCCTGCACGCAAAGCATCGTGCGCTGCCTGACAACAAGTCGGCGTCTGCCATTACT
GATCCACACTGCTCTCCCGACTCCATACCCGACAATGCGCTGCGCATCGACAAGATTATGGTGTGGAACGACCCG
CGCGACTGGGCGGTTGACATTCAACTCATTCACGACCTGCTTGTTTCGCATCGAGGCTACCTGGGCACCGTCTCG
GCGCTCAACGGCGACGCATCGCTACCCAACCGCGGATGGCAGCAGGACGGCCAGCCAGAGCTCTGGGTGTCCAAT
CTCGACCTGTACTGGAAGACGAATTATCCCATGAATCGATTCGGCACGGGTGCCTTTGTCGAGGCCTTGAAGGGG
GTCTGGTCGGCAGTGACGGGGGGCGCTGAGCTGCAGTATCATGCCATGGGCAAGCCCCTACGCCCCACCTTTGAG
TTTGCACACCAGCGACTGCTGCATGGCGACCTGGGGGCAATCATTCACCAAAAGTCGGAACCTGGTGCACAAAAT
GCTGAGCCAACAACCCCCAGCTCTGCAGCGAAGCCACTGCGCAGAGTATACATGATTGGCGACAATCCCGAAAGC
GACATTCGGGGCGCCCTAGAATTCAAGCCCGAGGATGGCGCCGAGTGGGTGCCCATCTTGGTGCGGACGGGCGTG
TGGCAGCAGAGCGCGGCGGAGCCTGAGCCACGGTTCAAGCCAGCCGTCATTGTTGACGATGTTGTCGAGGGGGTC
CTGTGGGCCTTGGCCAATGAGGGCGTCACTATGTCGCGCGAGGAGCTTTTCCGAGGCAACGAATAG
Gene >OphauB2|857
ATGTTACCTGTTACCAGAAGCTGCTTGAGGCTTCGCCCTGGCCGTGTAGCCTGTGGGTGGGCGTCTTGGTCAATT
GGTTACAAGCAGCCATCAAAGCCTCTTGCTGCACTCGCCGCACGCCGACACCTTTGCTTCACCCCAAGACTGGGC
GAGAGCATCAGCGAGCCGGACAACTCATTGGACGGAAACCCAGAAGCACAAGGAGCTTTGGACCACATCGGCTTT
GTTTTCGAGTAAGTGGCCCCGCCCTGGCGCCAACAGAGATGTGCTAAGGCGTCTAGCATCGATGGCGTCCTTCAC
CAGGGCGTCAAACCCATACCCGGGACTGCACCACTCCTGAGCAACCTTTTCAGAAAGGATGTGCGCTACATTTTC
CTCTCCAATGGCGGGGGAACGCACGAAGACGTCAAGAATGAGTCGCTGGGCACGAGGATGTGCATGAGCAAGACG
GTTCGCAACTATCTTATTAACGACCGCGTCATTCTCTCACATACGCCTATGCGCGCGTGGTCTGAATCGGCCAAG
CAGCAGACGGTTCTGATTACAGGCGTCCGCGAAGACACGGCGCGCCAGGTGGCCATGCAGTTGAGTATATCCTCT
GCTCGAGCTAGTGGGGCGTGGCTTGCTAATGTATATGCATCGCCAACTCTTTTAGATATGGATTCAAGCGCGTCA
TTACGCCGTCGGACCTCTTGCATGCCAATAACGATGTCTATGCCTTTGACAAGCTCAAGGAAACCCTGCACGCAA
AGCATCGTGCGCTGCCTGACAACAAGTCGGCGTCTGCCATTACTGATCCACACTGCTCTCCCGACTCCATACCCG
ACAATGCGCTGCGCATCGACAAGATTATGGTGTGGAACGACCCGCGCGACTGGGCGGTTGACATTCAACTCATTC
ACGACCTGCTTGTTTCGCATCGAGGCTACCTGGGCACCGTCTCGGCGCTCAACGGCGACGCATCGCTACCCAACC
GCGGATGGCAGCAGGACGGCCAGCCAGAGCTCTGGGTGTCCAATCTCGACCTGTACTGGAAGACGAATTATCCCA
TGAATCGATTCGGCACGGGTGCCTTTGTCGAGGCCTTGAAGGGGGTCTGGTCGGCAGTGACGGGGGGCGCTGAGC
TGCAGTATCATGCCATGGGCAAGCCCCTACGCCCCACCTTTGAGTTTGCACACCAGCGACTGCTGCATGGCGACC
TGGGGGCAATCATTCACCAAAAGTCGGAACCTGGTGCACAAAATGCTGAGCCAACAACCCCCAGCTCTGCAGCGA
AGCCACTGCGCAGAGTATACATGATTGGCGACAATCCCGAAAGCGACATTCGGGGCGCCCTAGAATTCAAGCCCG
AGGATGGCGCCGAGTGGGTGCCCATCTTGGTGCGGACGGGCGTGTGGCAGCAGAGCGCGGCGGAGCCTGAGCCAC
GGTTCAAGCCAGCCGTCATTGTTGACGATGTTGTCGAGGGGGTCCTGTGGGCCTTGGCCAATGAGGGCGTCACTA
TGTCGCGCGAGGAGCTTTTCCGAGGCAACGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail