Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|855
Gene name
LocationContig_119:45267..47287
Strand+
Gene length (bp)2020
Transcript length (bp)1803
Coding sequence length (bp)1803
Protein length (aa) 601

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00651 BTB BTB/POZ domain 1.4E-04 146 209
PF00651 BTB BTB/POZ domain 1.7E-11 328 411
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.5E-07 41 120
PF13637 Ank_4 Ankyrin repeats (many copies) 5.2E-06 42 88
PF00023 Ank Ankyrin repeat 1.0E-02 69 93

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10225|BTB3_SCHPO BTB/POZ domain-containing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=btb3 PE=1 SV=1 30 526 5.0E-80
sp|P40560|YIA1_YEAST Ankyrin repeat-containing protein YIL001W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL001W PE=1 SV=1 36 522 5.0E-60
sp|Q5XIU1|ABTB1_RAT Ankyrin repeat and BTB/POZ domain-containing protein 1 OS=Rattus norvegicus GN=Abtb1 PE=2 SV=1 37 534 3.0E-30
sp|Q99LJ2|ABTB1_MOUSE Ankyrin repeat and BTB/POZ domain-containing protein 1 OS=Mus musculus GN=Abtb1 PE=2 SV=1 37 510 1.0E-29
sp|Q969K4|ABTB1_HUMAN Ankyrin repeat and BTB/POZ domain-containing protein 1 OS=Homo sapiens GN=ABTB1 PE=1 SV=1 37 510 6.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10225|BTB3_SCHPO BTB/POZ domain-containing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=btb3 PE=1 SV=1 30 526 5.0E-80
sp|P40560|YIA1_YEAST Ankyrin repeat-containing protein YIL001W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL001W PE=1 SV=1 36 522 5.0E-60
sp|Q5XIU1|ABTB1_RAT Ankyrin repeat and BTB/POZ domain-containing protein 1 OS=Rattus norvegicus GN=Abtb1 PE=2 SV=1 37 534 3.0E-30
sp|Q99LJ2|ABTB1_MOUSE Ankyrin repeat and BTB/POZ domain-containing protein 1 OS=Mus musculus GN=Abtb1 PE=2 SV=1 37 510 1.0E-29
sp|Q969K4|ABTB1_HUMAN Ankyrin repeat and BTB/POZ domain-containing protein 1 OS=Homo sapiens GN=ABTB1 PE=1 SV=1 37 510 6.0E-28
sp|Q9SJ85|Y2474_ARATH BTB/POZ domain-containing protein At2g04740 OS=Arabidopsis thaliana GN=At2g04740 PE=2 SV=2 29 181 1.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|855
MIFGKSELQGKLGEQNSLIKNGVLREENPLDQSPEFNEFLLACRKGDLRTCQQLMSLGVNINGKDKYDYTPLIIA
SLCGHYELVRLLLESGALAERNTFQGERCIYNALNDRIRNLLLEYDFSKSSDALVYWSTHLCSLLTRTAPATFDF
EVVMSDLSRFNAHKFLLAARTGFFPRLFAHDASASSWHADDLGVAPRALELVLRHVYLDDDWLRELGSAEEEARL
GPALDRVSGLLGMEELWEAVLAARQDRRVARQRFRDQEARALRDVAGFFQRHVLGGKIVVERLRVDEVCWQRDNA
AFADVLLCAHSAPPDNDASLSAPPTSTLYPAHKAMLIRSQYFATMFSGPFVESRPLPHLRIITMDCSPPVLALIL
TYLYTESINCPLRHALDLLYAADMLLLDGLKNKAAVTISTLGSPAHHQATLSPLDNNDDDDEADLLDIFDVLTAA
WDLAVPRLEEFAARYIAARLESYIDDEAFRDAVRKSAARIRARHDTDSIELVDDVRFHLSERFRLRFEDTGLANV
LAAAQQQQRDEKMGADAAAASHDDVAESAQNGQALAVAQEAASPPPDDDFAVAAAKYQLLLDKIDAMLEQLGLDA
*
Coding >OphauB2|855
ATGATTTTCGGCAAGTCCGAGCTACAGGGAAAACTAGGCGAGCAAAACAGTCTCATCAAGAATGGCGTGCTGCGC
GAGGAAAACCCCCTCGACCAGAGCCCCGAATTCAACGAATTCCTCCTCGCCTGCCGCAAGGGCGACTTGCGCACC
TGTCAGCAGCTCATGAGCCTAGGCGTAAACATCAACGGCAAGGACAAGTACGACTATACGCCCCTCATCATTGCA
AGCTTGTGCGGACACTATGAGCTGGTGCGCCTGCTTCTCGAATCTGGCGCGCTGGCGGAGCGCAACACGTTTCAG
GGCGAGCGCTGCATCTACAATGCCCTCAATGACCGTATCCGCAACCTCTTGCTCGAGTACGACTTTTCCAAATCG
TCTGATGCGCTCGTCTACTGGTCCACCCACCTATGCAGTCTTTTGACACGCACCGCGCCAGCAACTTTTGACTTT
GAAGTCGTGATGTCCGATTTATCCCGCTTCAACGCACACAAGTTTCTACTCGCTGCACGCACAGGCTTTTTCCCT
CGCCTTTTTGCACACGACGCCAGCGCATCGTCGTGGCACGCCGACGATTTGGGTGTGGCGCCGCGCGCGCTGGAG
CTGGTGCTGCGCCACGTCTATCTCGACGACGACTGGTTGCGCGAGCTGGGCTCGGCCGAGGAGGAGGCGCGCTTG
GGGCCGGCGCTGGACCGGGTGAGTGGGCTGCTGGGCATGGAGGAGCTGTGGGAGGCGGTGCTGGCGGCGCGGCAG
GACAGGCGGGTGGCGAGGCAGCGCTTTCGGGACCAAGAGGCGCGGGCGCTGCGCGACGTGGCGGGCTTTTTTCAG
CGCCATGTGCTGGGCGGCAAGATTGTGGTTGAGAGGCTGCGCGTCGACGAGGTGTGCTGGCAGCGCGACAATGCC
GCCTTTGCCGATGTGCTGCTCTGCGCCCACTCTGCTCCTCCCGACAATGACGCATCCCTCTCTGCGCCACCCACC
TCGACTCTCTATCCCGCACACAAGGCCATGCTCATTCGCAGCCAATACTTTGCCACCATGTTCTCCGGCCCCTTT
GTCGAATCTCGCCCTCTGCCCCACCTCCGCATCATTACCATGGACTGCTCCCCGCCCGTCCTCGCCCTCATCCTC
ACCTATCTCTACACCGAATCTATAAACTGCCCGCTCCGCCATGCCCTCGACCTCTTGTACGCTGCAGACATGCTC
CTCCTCGACGGGCTTAAAAACAAGGCTGCCGTGACAATCAGCACCCTTGGCAGCCCCGCCCACCACCAAGCAACA
CTTTCCCCTCTCGACAACAACGACGACGACGACGAGGCCGACTTGCTGGATATTTTTGACGTGCTAACCGCTGCT
TGGGATCTGGCCGTTCCCCGCCTCGAGGAATTCGCCGCGCGCTACATTGCCGCTCGCCTAGAGTCGTATATTGAC
GACGAGGCGTTTAGAGACGCGGTGCGCAAGTCGGCGGCGCGTATTCGCGCGCGGCATGATACCGATTCCATCGAG
TTGGTGGATGATGTGCGCTTTCATCTCTCGGAGCGCTTTCGCCTGCGCTTTGAGGATACCGGGCTGGCAAACGTC
TTGGCGGCGGCGCAGCAGCAGCAGCGCGACGAAAAGATGGGTGCCGATGCGGCTGCTGCTAGTCACGACGATGTG
GCAGAGTCGGCGCAAAATGGTCAAGCATTGGCCGTTGCTCAAGAGGCTGCCAGTCCGCCACCAGACGACGACTTT
GCCGTTGCGGCGGCAAAATATCAGCTCCTGTTGGATAAAATTGACGCCATGCTTGAGCAACTCGGCCTCGATGCG
TAG
Transcript >OphauB2|855
ATGATTTTCGGCAAGTCCGAGCTACAGGGAAAACTAGGCGAGCAAAACAGTCTCATCAAGAATGGCGTGCTGCGC
GAGGAAAACCCCCTCGACCAGAGCCCCGAATTCAACGAATTCCTCCTCGCCTGCCGCAAGGGCGACTTGCGCACC
TGTCAGCAGCTCATGAGCCTAGGCGTAAACATCAACGGCAAGGACAAGTACGACTATACGCCCCTCATCATTGCA
AGCTTGTGCGGACACTATGAGCTGGTGCGCCTGCTTCTCGAATCTGGCGCGCTGGCGGAGCGCAACACGTTTCAG
GGCGAGCGCTGCATCTACAATGCCCTCAATGACCGTATCCGCAACCTCTTGCTCGAGTACGACTTTTCCAAATCG
TCTGATGCGCTCGTCTACTGGTCCACCCACCTATGCAGTCTTTTGACACGCACCGCGCCAGCAACTTTTGACTTT
GAAGTCGTGATGTCCGATTTATCCCGCTTCAACGCACACAAGTTTCTACTCGCTGCACGCACAGGCTTTTTCCCT
CGCCTTTTTGCACACGACGCCAGCGCATCGTCGTGGCACGCCGACGATTTGGGTGTGGCGCCGCGCGCGCTGGAG
CTGGTGCTGCGCCACGTCTATCTCGACGACGACTGGTTGCGCGAGCTGGGCTCGGCCGAGGAGGAGGCGCGCTTG
GGGCCGGCGCTGGACCGGGTGAGTGGGCTGCTGGGCATGGAGGAGCTGTGGGAGGCGGTGCTGGCGGCGCGGCAG
GACAGGCGGGTGGCGAGGCAGCGCTTTCGGGACCAAGAGGCGCGGGCGCTGCGCGACGTGGCGGGCTTTTTTCAG
CGCCATGTGCTGGGCGGCAAGATTGTGGTTGAGAGGCTGCGCGTCGACGAGGTGTGCTGGCAGCGCGACAATGCC
GCCTTTGCCGATGTGCTGCTCTGCGCCCACTCTGCTCCTCCCGACAATGACGCATCCCTCTCTGCGCCACCCACC
TCGACTCTCTATCCCGCACACAAGGCCATGCTCATTCGCAGCCAATACTTTGCCACCATGTTCTCCGGCCCCTTT
GTCGAATCTCGCCCTCTGCCCCACCTCCGCATCATTACCATGGACTGCTCCCCGCCCGTCCTCGCCCTCATCCTC
ACCTATCTCTACACCGAATCTATAAACTGCCCGCTCCGCCATGCCCTCGACCTCTTGTACGCTGCAGACATGCTC
CTCCTCGACGGGCTTAAAAACAAGGCTGCCGTGACAATCAGCACCCTTGGCAGCCCCGCCCACCACCAAGCAACA
CTTTCCCCTCTCGACAACAACGACGACGACGACGAGGCCGACTTGCTGGATATTTTTGACGTGCTAACCGCTGCT
TGGGATCTGGCCGTTCCCCGCCTCGAGGAATTCGCCGCGCGCTACATTGCCGCTCGCCTAGAGTCGTATATTGAC
GACGAGGCGTTTAGAGACGCGGTGCGCAAGTCGGCGGCGCGTATTCGCGCGCGGCATGATACCGATTCCATCGAG
TTGGTGGATGATGTGCGCTTTCATCTCTCGGAGCGCTTTCGCCTGCGCTTTGAGGATACCGGGCTGGCAAACGTC
TTGGCGGCGGCGCAGCAGCAGCAGCGCGACGAAAAGATGGGTGCCGATGCGGCTGCTGCTAGTCACGACGATGTG
GCAGAGTCGGCGCAAAATGGTCAAGCATTGGCCGTTGCTCAAGAGGCTGCCAGTCCGCCACCAGACGACGACTTT
GCCGTTGCGGCGGCAAAATATCAGCTCCTGTTGGATAAAATTGACGCCATGCTTGAGCAACTCGGCCTCGATGCG
TAG
Gene >OphauB2|855
ATGATTTTCGGCAAGTCCGAGCTACAGGGAAAACTAGGCGAGCAAAACAGTCTCATCAAGAATGGCGTGCTGCGC
GAGGAAAACCCCCTCGACCAGAGCCCCGAATTCAACGAATTCCTCCTCGCCTGCCGCAAGGGCGACTTGCGCACC
TGTCAGCAGCTCATGAGCCTAGGCGTAAACATCAACGGCAAGGACAAGTACGACTATACGCCCCTCATCATTGTA
AGCCGGCTATATACCCTAGATTGCCGAGACGCCAAAGTGCTGACTCGAGCTTCCACCAGGCAAGCTTGTGCGGAC
ACTATGAGCTGGTGCGCCTGCTTCTCGAATCTGGTATATAAAAAAAGTCCCGAAAAATCCCCCGCCCTAAAAAGG
GAGGCCAGAGTGGGAAGCATGTCTGCAGCGCGGCTCACCTACTTTTGCAGGCGCGCTGGCGGAGCGCAACACGTT
TCAGGGCGAGCGCTGCATCTACAATGCCCTCAATGACCGTATCCGCAACCTCTTGCTCGAGTACGACTTTTCCAA
ATCGTCTGATGCGCTCGTCTACTGGTCCACCCACCTATGCAGTCTTTTGACACGCACCGCGCCAGCAACTTTTGA
CTTTGAAGTCGTGATGTCCGATTTATCCCGCTTCAACGCACACAAGTTTCTACTCGCTGCACGCACAGGCTTTTT
CCCTCGCCTTTTTGCACACGACGCCAGCGCATCGTCGTGGCACGCCGACGATTTGGGTGTGGCGCCGCGCGCGCT
GGAGCTGGTGCTGCGCCACGTCTATCTCGACGACGACTGGTTGCGCGAGCTGGGCTCGGCCGAGGAGGAGGCGCG
CTTGGGGCCGGCGCTGGACCGGGTGAGTGGGCTGCTGGGCATGGAGGAGCTGTGGGAGGCGGTGCTGGCGGCGCG
GCAGGACAGGCGGGTGGCGAGGCAGCGCTTTCGGGACCAAGAGGCGCGGGCGCTGCGCGACGTGGCGGGCTTTTT
TCAGCGCCATGTGCTGGGCGGCAAGATTGTGGTTGAGAGGCTGCGCGTCGACGAGGTGTGCTGGCAGCGCGACAA
TGCCGCCTTTGCCGATGTGCTGCTCTGCGCCCACTCTGCTCCTCCCGGTGCGCTTGTTTTTCCCCCTTGGCTCTC
GTTTTGATCCATTTTCCCTCTAACCCTCTCGCTAGACAATGACGCATCCCTCTCTGCGCCACCCACCTCGACTCT
CTATCCCGCACACAAGGCCATGCTCATTCGCAGCCAATACTTTGCCACCATGTTCTCCGGCCCCTTTGTCGAATC
TCGCCCTCTGCCCCACCTCCGCATCATTACCATGGACTGCTCCCCGCCCGTCCTCGCCCTCATCCTCACCTATCT
CTACACCGAATCTATAAACTGCCCGCTCCGCCATGCCCTCGACCTCTTGTACGCTGCAGACATGCTCCTCCTCGA
CGGGCTTAAAAACAAGGCTGCCGTGACAATCAGCACCCTTGGCAGCCCCGCCCACCACCAAGCAACACTTTCCCC
TCTCGACAACAACGACGACGACGACGAGGCCGACTTGCTGGATATTTTTGACGTGCTAACCGCTGCTTGGGATCT
GGCCGTTCCCCGCCTCGAGGAATTCGCCGCGCGCTACATTGCCGCTCGCCTAGAGTCGTATATTGACGACGAGGC
GTTTAGAGACGCGGTGCGCAAGTCGGCGGCGCGTATTCGCGCGCGGCATGATACCGATTCCATCGAGTTGGTGGA
TGATGTGCGCTTTCATCTCTCGGAGCGCTTTCGCCTGCGCTTTGAGGATACCGGGCTGGCAAACGTCTTGGCGGC
GGCGCAGCAGCAGCAGCGCGACGAAAAGATGGGTGCCGATGCGGCTGCTGCTAGTCACGACGATGTGGCAGAGTC
GGCGCAAAATGGTCAAGCATTGGCCGTTGCTCAAGAGGCTGCCAGTCCGCCACCAGACGACGACTTTGCCGTTGC
GGCGGCAAAATATCAGCTCCTGTTGGATAAAATTGACGCCATGCTTGAGCAACTCGGCCTCGATGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail