Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|852
Gene name
LocationContig_119:39123..40165
Strand-
Gene length (bp)1042
Transcript length (bp)966
Coding sequence length (bp)966
Protein length (aa) 322

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01040 UbiA UbiA prenyltransferase family 3.8E-12 47 260

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups Yes
GO:0016021 integral component of membrane Yes
GO:0003824 catalytic activity No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0031224 intrinsic component of membrane No
GO:0016740 transferase activity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 45 67 22
3 98 116 18
4 168 185 17
5 209 231 22
6 235 254 19
7 266 288 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|852
MGLRSAVSREVDLFISFTWRDLSATVIPSSLFALGTFKNLDYTTMARNYAMALVWVTLYLYTFNLFTQGMSQDED
SINKPDRPLPCGKVDFYGCMKRYLVALAAFVATSLLYRPIMPETLTWAFITLLHGATQLGGNWFGKNVLAISIGS
WTLLSPPRKIMAADMPETWPQIVAASIWAGIVFNIQDFRDQKGDRLVARSTLPLVMGDVAARYAVAFFFAPLGFA
ALYYLGLAQTAPWLLGGLHLLTSYRILALRSSRADHDTHMLVTYMFCLILTLCSLQTLGFVSASRPVEKLLSDWI
FTVPLANFKQLWNPHLPSTLY*
Coding >OphauB2|852
ATGGGGCTACGCTCAGCAGTGTCCCGCGAAGTAGACCTCTTCATCAGCTTCACATGGCGAGACTTGTCCGCCACC
GTTATCCCATCCTCGCTCTTTGCCCTGGGCACATTCAAAAACCTAGACTACACCACCATGGCCCGCAACTACGCC
ATGGCGCTTGTATGGGTCACGCTATACCTCTACACCTTTAACCTCTTTACCCAGGGCATGAGTCAAGACGAAGAC
AGCATCAACAAGCCCGACCGCCCGCTTCCTTGCGGCAAAGTCGACTTTTACGGCTGCATGAAGCGATATCTCGTT
GCCCTGGCCGCCTTTGTCGCCACGTCGTTGCTATACCGACCCATTATGCCCGAGACGCTCACCTGGGCCTTCATC
ACCCTCCTGCACGGCGCCACGCAGCTTGGAGGCAACTGGTTCGGTAAAAATGTGCTTGCCATTTCCATTGGCAGC
TGGACGCTTCTCTCGCCGCCGCGCAAAATCATGGCTGCCGACATGCCGGAAACTTGGCCGCAAATCGTGGCCGCG
TCCATTTGGGCGGGCATAGTCTTCAACATTCAAGACTTTAGAGATCAAAAGGGCGATAGACTGGTTGCGCGAAGC
ACCCTGCCCCTCGTCATGGGCGATGTTGCCGCCCGCTATGCCGTGGCTTTCTTCTTTGCACCACTGGGGTTTGCC
GCGCTTTACTACTTGGGCCTGGCGCAGACGGCTCCATGGTTGCTGGGGGGATTGCATCTGCTAACATCATACCGC
ATCCTTGCGCTGCGAAGTAGCAGAGCTGACCATGACACCCACATGCTCGTCACCTACATGTTTTGTCTGATTCTG
ACGCTTTGCTCCTTGCAAACACTTGGCTTTGTTTCTGCGTCTAGACCTGTAGAGAAGCTGCTGTCGGACTGGATC
TTTACAGTTCCCCTTGCAAATTTCAAACAGCTTTGGAACCCGCACCTACCAAGCACACTGTACTGA
Transcript >OphauB2|852
ATGGGGCTACGCTCAGCAGTGTCCCGCGAAGTAGACCTCTTCATCAGCTTCACATGGCGAGACTTGTCCGCCACC
GTTATCCCATCCTCGCTCTTTGCCCTGGGCACATTCAAAAACCTAGACTACACCACCATGGCCCGCAACTACGCC
ATGGCGCTTGTATGGGTCACGCTATACCTCTACACCTTTAACCTCTTTACCCAGGGCATGAGTCAAGACGAAGAC
AGCATCAACAAGCCCGACCGCCCGCTTCCTTGCGGCAAAGTCGACTTTTACGGCTGCATGAAGCGATATCTCGTT
GCCCTGGCCGCCTTTGTCGCCACGTCGTTGCTATACCGACCCATTATGCCCGAGACGCTCACCTGGGCCTTCATC
ACCCTCCTGCACGGCGCCACGCAGCTTGGAGGCAACTGGTTCGGTAAAAATGTGCTTGCCATTTCCATTGGCAGC
TGGACGCTTCTCTCGCCGCCGCGCAAAATCATGGCTGCCGACATGCCGGAAACTTGGCCGCAAATCGTGGCCGCG
TCCATTTGGGCGGGCATAGTCTTCAACATTCAAGACTTTAGAGATCAAAAGGGCGATAGACTGGTTGCGCGAAGC
ACCCTGCCCCTCGTCATGGGCGATGTTGCCGCCCGCTATGCCGTGGCTTTCTTCTTTGCACCACTGGGGTTTGCC
GCGCTTTACTACTTGGGCCTGGCGCAGACGGCTCCATGGTTGCTGGGGGGATTGCATCTGCTAACATCATACCGC
ATCCTTGCGCTGCGAAGTAGCAGAGCTGACCATGACACCCACATGCTCGTCACCTACATGTTTTGTCTGATTCTG
ACGCTTTGCTCCTTGCAAACACTTGGCTTTGTTTCTGCGTCTAGACCTGTAGAGAAGCTGCTGTCGGACTGGATC
TTTACAGTTCCCCTTGCAAATTTCAAACAGCTTTGGAACCCGCACCTACCAAGCACACTGTACTGA
Gene >OphauB2|852
ATGGGGCTACGCTCAGCAGTGTCCCGCGAAGTAGACCTCTTCATCAGCTTCACATGGCGAGACTTGTCCGCCACC
GTTATCCCATCCTCGCTCTTTGCCCTGGGCACATTCAAAAACCTAGACTACACCACCATGGCCCGCAACTACGCC
ATGGCGCTTGTATGGGTCACGCTATACCTCTACACCTTTAACCTCTTTACCCAGGGCATGAGTCAAGACGAAGAC
AGCATCAACAAGCCCGACCGCCCGCTTCCTTGCGGCAAAGTCGACTTTTACGGCTGCATGAAGCGATATCTCGTT
GCCCTGGCCGCCTTTGTCGCCACGTCGTTGCTATACCGACCCATTATGCCCGAGACGCTCACCTGGGCCTTCATC
ACCCTCCTGCACGGCGCCACGCAGCTTGGAGGCAACTGGTTCGGTAAAAATGTGCTTGCCATTTCCATTGGCAGC
TGGACGCTTCTCTCGCCGCCGCGCAAAATCATGGCTGCCGACATGCCGGAAACTTGGCCGCAAATCGTGGCCGCG
TCCATTTGGGCGGGCATAGTCTTCAACATTCAAGACTTTAGAGATCAAAAGGGCGATAGACTGGTTGCGCGAAGC
ACCCTGCCCCTCGTCATGGGCGATGTTGCCGCCCGCTATGCCGTGGCTTTCTTCTTTGCACCACTGGGGTTTGCC
GCGCTTTACTACTTGGGCCTGGCGCAGACGGCTCCATGGTTGCTGGGGGGATTGCATCTGCTAACATCATACCGC
ATCCTTGCGCTGCGAAGTAGCAGAGCTGACCATGACACCCACATGGTGAGTTTGTTGACTGCCATGCGTCCAAAC
CTCTCAGGTCTCTTGGCTCGAGAACCAGGTGCTGACTTGTCACTAGCTCGTCACCTACATGTTTTGTCTGATTCT
GACGCTTTGCTCCTTGCAAACACTTGGCTTTGTTTCTGCGTCTAGACCTGTAGAGAAGCTGCTGTCGGACTGGAT
CTTTACAGTTCCCCTTGCAAATTTCAAACAGCTTTGGAACCCGCACCTACCAAGCACACTGTACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail