Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|850
Gene name
LocationContig_119:36378..37354
Strand+
Gene length (bp)976
Transcript length (bp)840
Coding sequence length (bp)840
Protein length (aa) 280

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02630 SCO1-SenC SCO1/SenC 5.9E-47 115 251

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P23833|SCO1_YEAST Protein SCO1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCO1 PE=1 SV=1 60 275 3.0E-75
sp|P38072|SCO2_YEAST Protein SCO2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCO2 PE=1 SV=1 73 275 1.0E-69
sp|O42899|SCO1_SCHPO Protein sco1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sco1 PE=3 SV=1 69 268 5.0E-69
sp|Q8VYP0|SCO11_ARATH Protein SCO1 homolog 1, mitochondrial OS=Arabidopsis thaliana GN=HCC1 PE=2 SV=1 69 276 2.0E-49
sp|O75880|SCO1_HUMAN Protein SCO1 homolog, mitochondrial OS=Homo sapiens GN=SCO1 PE=1 SV=1 21 278 4.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P23833|SCO1_YEAST Protein SCO1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCO1 PE=1 SV=1 60 275 3.0E-75
sp|P38072|SCO2_YEAST Protein SCO2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCO2 PE=1 SV=1 73 275 1.0E-69
sp|O42899|SCO1_SCHPO Protein sco1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sco1 PE=3 SV=1 69 268 5.0E-69
sp|Q8VYP0|SCO11_ARATH Protein SCO1 homolog 1, mitochondrial OS=Arabidopsis thaliana GN=HCC1 PE=2 SV=1 69 276 2.0E-49
sp|O75880|SCO1_HUMAN Protein SCO1 homolog, mitochondrial OS=Homo sapiens GN=SCO1 PE=1 SV=1 21 278 4.0E-48
sp|Q5SUC9|SCO1_MOUSE Protein SCO1 homolog, mitochondrial OS=Mus musculus GN=Sco1 PE=1 SV=1 65 279 1.0E-47
sp|A1A4J8|SCO1_BOVIN Protein SCO1 homolog, mitochondrial OS=Bos taurus GN=SCO1 PE=2 SV=1 69 278 9.0E-47
sp|Q8VCL2|SCO2_MOUSE Protein SCO2 homolog, mitochondrial OS=Mus musculus GN=Sco2 PE=1 SV=1 77 272 1.0E-43
sp|A6H784|SCO2_BOVIN Protein SCO2 homolog, mitochondrial OS=Bos taurus GN=SCO2 PE=2 SV=1 77 272 6.0E-42
sp|O43819|SCO2_HUMAN Protein SCO2 homolog, mitochondrial OS=Homo sapiens GN=SCO2 PE=1 SV=3 93 272 1.0E-41
sp|Q92H76|SCO22_RICCN SCO2-like protein RC0895 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC0895 PE=3 SV=1 113 263 2.0E-40
sp|Q1RIN4|SCO22_RICBR SCO2-like protein RBE_0699 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0699 PE=3 SV=1 113 261 3.0E-39
sp|Q9ZCW7|SCO22_RICPR SCO2-like protein RP587 OS=Rickettsia prowazekii (strain Madrid E) GN=RP587 PE=3 SV=1 111 267 5.0E-39
sp|Q4UKW2|SCO22_RICFE SCO2-like protein RF_0960 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0960 PE=3 SV=1 113 263 6.0E-39
sp|Q5RH02|SCO2_DANRE Protein SCO2 homolog, mitochondrial OS=Danio rerio GN=sco2 PE=3 SV=1 88 273 3.0E-37
sp|Q8LAL0|SCO12_ARATH Protein SCO1 homolog 2, mitochondrial OS=Arabidopsis thaliana GN=HCC2 PE=2 SV=1 89 272 8.0E-36
sp|Q68WF1|SCO22_RICTY SCO2-like protein RT0576 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0576 PE=3 SV=2 113 274 3.0E-31
sp|P47206|SCOP_PSEST Putative copper-binding protein OS=Pseudomonas stutzeri GN=scoP PE=3 SV=2 120 251 2.0E-28
sp|Q52720|SENC_RHOCB Protein SenC OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=senC PE=3 SV=2 98 268 5.0E-26
sp|Q92JM5|SCO21_RICCN SCO2-like protein RC0042 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC0042 PE=3 SV=1 118 253 3.0E-17
sp|Q1RKK4|SCO21_RICBR SCO2-like protein RBE_0029 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0029 PE=3 SV=1 118 253 1.0E-16
sp|Q9ZEB4|SCO21_RICPR SCO2-like protein RP031 OS=Rickettsia prowazekii (strain Madrid E) GN=RP031 PE=3 SV=1 118 249 3.0E-16
sp|Q4UNH4|SCO21_RICFE SCO2-like protein RF_0043 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0043 PE=3 SV=1 118 253 7.0E-16
sp|P54178|SCO1_BACSU SCO1 protein homolog OS=Bacillus subtilis (strain 168) GN=ypmQ PE=1 SV=2 118 261 5.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 71 90 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|850
MAAPVIWSRALRGALGPSLIGRCQRCFSGRALQPGLRPSKFLRQAQPALGQRRTKYKTIEQAKSRHSTGPFSWKA
GLVFVVTCAALVWYFDHEKKRMERKRIAEATKGIGKPQVGGAFTLMDHNGQTFTSDMMKGRHALVYFGFTRCPDI
CPEELDKMARMIDKIEAKAPGKLLPIVITCDPERDSPEALKAYLAEFHEAFLGLTGTYEQIQDVCKAYRVYFSTP
KDVKPGQDYLVDHSIYFYLMDPDGDFIEALGRQHSPDEGAKLVLDHMRDWKYKK*
Coding >OphauB2|850
ATGGCAGCTCCAGTCATTTGGTCGAGGGCCCTCCGTGGCGCACTTGGTCCGTCATTGATTGGCCGGTGCCAGCGC
TGCTTCTCGGGTCGCGCTCTCCAGCCTGGGCTCCGACCAAGCAAATTCCTACGACAGGCACAGCCAGCTCTGGGC
CAGCGACGGACAAAGTACAAGACGATTGAGCAGGCCAAGAGCAGACATAGCACCGGACCCTTTTCCTGGAAAGCA
GGCCTCGTCTTTGTTGTCACCTGCGCCGCCCTGGTTTGGTACTTTGACCATGAAAAGAAGCGCATGGAGCGCAAG
CGAATCGCCGAGGCCACCAAGGGCATTGGAAAGCCCCAAGTCGGCGGCGCATTTACCCTCATGGACCACAATGGC
CAGACCTTTACCAGTGACATGATGAAGGGCCGCCACGCCTTGGTCTACTTTGGCTTCACGCGCTGCCCCGACATT
TGCCCCGAAGAGCTCGACAAGATGGCGCGCATGATTGACAAGATTGAGGCCAAGGCGCCTGGCAAACTGCTTCCC
ATTGTTATAACGTGCGATCCCGAGCGCGACAGCCCCGAGGCGCTCAAGGCCTATCTGGCCGAGTTTCACGAGGCC
TTTTTGGGCCTGACGGGCACCTATGAGCAGATTCAGGACGTGTGCAAAGCGTACCGCGTCTACTTTAGCACGCCC
AAGGATGTGAAGCCGGGTCAGGACTACCTTGTCGACCACAGCATATACTTTTATCTCATGGATCCCGATGGCGAC
TTTATCGAGGCGCTGGGGAGACAGCACTCGCCTGATGAGGGCGCCAAGCTTGTGCTCGACCACATGAGAGATTGG
AAGTATAAAAAGTAG
Transcript >OphauB2|850
ATGGCAGCTCCAGTCATTTGGTCGAGGGCCCTCCGTGGCGCACTTGGTCCGTCATTGATTGGCCGGTGCCAGCGC
TGCTTCTCGGGTCGCGCTCTCCAGCCTGGGCTCCGACCAAGCAAATTCCTACGACAGGCACAGCCAGCTCTGGGC
CAGCGACGGACAAAGTACAAGACGATTGAGCAGGCCAAGAGCAGACATAGCACCGGACCCTTTTCCTGGAAAGCA
GGCCTCGTCTTTGTTGTCACCTGCGCCGCCCTGGTTTGGTACTTTGACCATGAAAAGAAGCGCATGGAGCGCAAG
CGAATCGCCGAGGCCACCAAGGGCATTGGAAAGCCCCAAGTCGGCGGCGCATTTACCCTCATGGACCACAATGGC
CAGACCTTTACCAGTGACATGATGAAGGGCCGCCACGCCTTGGTCTACTTTGGCTTCACGCGCTGCCCCGACATT
TGCCCCGAAGAGCTCGACAAGATGGCGCGCATGATTGACAAGATTGAGGCCAAGGCGCCTGGCAAACTGCTTCCC
ATTGTTATAACGTGCGATCCCGAGCGCGACAGCCCCGAGGCGCTCAAGGCCTATCTGGCCGAGTTTCACGAGGCC
TTTTTGGGCCTGACGGGCACCTATGAGCAGATTCAGGACGTGTGCAAAGCGTACCGCGTCTACTTTAGCACGCCC
AAGGATGTGAAGCCGGGTCAGGACTACCTTGTCGACCACAGCATATACTTTTATCTCATGGATCCCGATGGCGAC
TTTATCGAGGCGCTGGGGAGACAGCACTCGCCTGATGAGGGCGCCAAGCTTGTGCTCGACCACATGAGAGATTGG
AAGTATAAAAAGTAG
Gene >OphauB2|850
ATGGCAGCTCCAGTCATTTGGTCGAGGGCCCTCCGTGGCGCACTTGGTCCGTCATTGATTGGCCGGTGCCAGCGC
TGCTTCTCGGGTCGCGCTCTCCAGCCTGGGCTCCGACCAAGCAAATTCCTACGACAGGCACAGCCAGCTCTGGGC
CAGCGACGGACAAAGTACAAGACGATTGAGCAGGCCAAGAGCAGACATAGCACCGGAGTATGTCCCTTTTACCCG
TCGTTGCTGCAAGACTGCCTTGCGGAGGACCCGAGATTGTTGACGAATTGAACCTTGTTGGCAGCCCTTTTCCTG
GAAAGCAGGCCTCGTCTTTGTTGTCACCTGCGCCGCCCTGGTTTGGTACTTTGACCATGAAAAGAAGCGCATGGA
GCGCAAGCGAATCGCCGAGGCCACCAAGGGCATTGGAAAGCCCCAAGTCGGCGGCGCATTTACCCTCATGGACCA
CAATGGCCAGACCTTTACCAGTGACATGATGAAGGGCCGCCACGCCTTGGTAAGTGCAGATATGTGCTGCTTACA
AGCTGTGCCATCTGACACCAAGCCCCAGGTCTACTTTGGCTTCACGCGCTGCCCCGACATTTGCCCCGAAGAGCT
CGACAAGATGGCGCGCATGATTGACAAGATTGAGGCCAAGGCGCCTGGCAAACTGCTTCCCATTGTTATAACGTG
CGATCCCGAGCGCGACAGCCCCGAGGCGCTCAAGGCCTATCTGGCCGAGTTTCACGAGGCCTTTTTGGGCCTGAC
GGGCACCTATGAGCAGATTCAGGACGTGTGCAAAGCGTACCGCGTCTACTTTAGCACGCCCAAGGATGTGAAGCC
GGGTCAGGACTACCTTGTCGACCACAGCATATACTTTTATCTCATGGATCCCGATGGCGACTTTATCGAGGCGCT
GGGGAGACAGCACTCGCCTGATGAGGGCGCCAAGCTTGTGCTCGACCACATGAGAGATTGGAAGTATAAAAAGTA
G

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail