Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|849
Gene name
LocationContig_119:34476..35952
Strand-
Gene length (bp)1476
Transcript length (bp)1413
Coding sequence length (bp)1413
Protein length (aa) 471

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00628 PHD PHD-finger 2.1E-10 146 194

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74508|SPP1_SCHPO Set1 complex component spp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spp1 PE=3 SV=1 146 453 2.0E-19
sp|Q8C9B9|DIDO1_MOUSE Death-inducer obliterator 1 OS=Mus musculus GN=Dido1 PE=1 SV=4 143 193 7.0E-13
sp|Q9BTC0|DIDO1_HUMAN Death-inducer obliterator 1 OS=Homo sapiens GN=DIDO1 PE=1 SV=5 143 193 1.0E-12
sp|P0CH95|PHF8_DANRE Histone lysine demethylase PHF8 OS=Danio rerio GN=phf8 PE=1 SV=1 146 203 2.0E-08
sp|Q9W0T1|NU301_DROME Nucleosome-remodeling factor subunit NURF301 OS=Drosophila melanogaster GN=E(bx) PE=1 SV=2 146 192 3.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74508|SPP1_SCHPO Set1 complex component spp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spp1 PE=3 SV=1 146 453 2.0E-19
sp|Q8C9B9|DIDO1_MOUSE Death-inducer obliterator 1 OS=Mus musculus GN=Dido1 PE=1 SV=4 143 193 7.0E-13
sp|Q9BTC0|DIDO1_HUMAN Death-inducer obliterator 1 OS=Homo sapiens GN=DIDO1 PE=1 SV=5 143 193 1.0E-12
sp|P0CH95|PHF8_DANRE Histone lysine demethylase PHF8 OS=Danio rerio GN=phf8 PE=1 SV=1 146 203 2.0E-08
sp|Q9W0T1|NU301_DROME Nucleosome-remodeling factor subunit NURF301 OS=Drosophila melanogaster GN=E(bx) PE=1 SV=2 146 192 3.0E-08
sp|Q6P949|PHF2_DANRE Lysine-specific demethylase phf2 OS=Danio rerio GN=phf2 PE=2 SV=3 146 208 3.0E-08
sp|Q03012|SPP1_YEAST COMPASS component SPP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPP1 PE=1 SV=1 146 230 8.0E-08
sp|E6ZGB4|PHF2_DICLA Lysine-specific demethylase phf2 OS=Dicentrarchus labrax GN=phf2 PE=3 SV=1 146 203 1.0E-07
sp|Q9WTU0|PHF2_MOUSE Lysine-specific demethylase PHF2 OS=Mus musculus GN=Phf2 PE=1 SV=2 146 203 1.0E-07
sp|O75151|PHF2_HUMAN Lysine-specific demethylase PHF2 OS=Homo sapiens GN=PHF2 PE=1 SV=4 146 203 1.0E-07
sp|Q9W0T1|NU301_DROME Nucleosome-remodeling factor subunit NURF301 OS=Drosophila melanogaster GN=E(bx) PE=1 SV=2 146 192 2.0E-07
sp|Q12830|BPTF_HUMAN Nucleosome-remodeling factor subunit BPTF OS=Homo sapiens GN=BPTF PE=1 SV=3 142 198 2.0E-07
sp|Q5EA28|CXXC1_BOVIN CXXC-type zinc finger protein 1 OS=Bos taurus GN=CXXC1 PE=2 SV=1 133 192 4.0E-07
sp|Q80TJ7|PHF8_MOUSE Histone lysine demethylase PHF8 OS=Mus musculus GN=Phf8 PE=1 SV=2 146 203 5.0E-07
sp|Q9UPP1|PHF8_HUMAN Histone lysine demethylase PHF8 OS=Homo sapiens GN=PHF8 PE=1 SV=3 146 203 5.0E-07
sp|Q9P0U4|CXXC1_HUMAN CXXC-type zinc finger protein 1 OS=Homo sapiens GN=CXXC1 PE=1 SV=2 133 192 5.0E-07
sp|Q5RHD1|KDM7A_DANRE Lysine-specific demethylase 7A OS=Danio rerio GN=kdm7a PE=2 SV=2 146 192 6.0E-07
sp|Q6ZMT4|KDM7A_HUMAN Lysine-specific demethylase 7A OS=Homo sapiens GN=KDM7A PE=1 SV=2 146 203 7.0E-07
sp|Q9CWW7|CXXC1_MOUSE CXXC-type zinc finger protein 1 OS=Mus musculus GN=Cxxc1 PE=2 SV=1 136 192 7.0E-07
sp|P0CF52|KDM7B_DANRE Lysine-specific demethylase 7B OS=Danio rerio GN=jhdm1db PE=2 SV=1 146 203 1.0E-06
sp|Q9UT79|MSC1_SCHPO Multicopy suppressor of chk1 protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=msc1 PE=3 SV=1 137 204 1.0E-06
sp|Q3UWM4|KDM7A_MOUSE Lysine-specific demethylase 7A OS=Mus musculus GN=Kdm7a PE=2 SV=2 146 203 2.0E-06
sp|Q08D35|KDM7A_XENTR Lysine-specific demethylase 7A OS=Xenopus tropicalis GN=kdm7a PE=2 SV=1 146 192 3.0E-06
sp|Q9W352|CXXC1_DROME CXXC-type zinc finger protein 1 OS=Drosophila melanogaster GN=Cfp1 PE=1 SV=1 125 202 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|849
MERAQKHTTPAYYNEPRFVLIEDVETDAASDLPPSDLGPSLPDAAAVVQPSELPDATATPASRATPSSCLVQTPS
PAPQSLTSSSLATASAPMSVSKKKGPGSASSKTTKRPKGGAGAARAKKPKSSMSTTWKPGSAGEESDNGPYCICR
GPDDHRWMICCEACEDWFHGECIKMPKDIGESLIERFICPNCTTDKRATVYRKSCSFNACRKAARLTDTDPSAFC
SDEHAHLWWERMIAKLPKTHPKVGPSGDQLTQGELMAVLKSRLGGQEAPDGSKLFKAPFSGKVPNEESKDDMDDF
VGKILSDEEKKILQDAVETRKKLSQEKRLYNEMMLLVENAQERRRAAIAAGHFTDDICGYDSRLDTVLARDAFAA
YIESAEGMAALSLCDAATTGQEAQVPLQGICDRKRCKGHSGWQKMFPHSIKQQIRDLDKQAAAVAAEEKVVREAA
VERWKRKQTENNWVEVINDE*
Coding >OphauB2|849
ATGGAACGGGCTCAAAAGCACACAACGCCCGCTTACTACAACGAACCTCGATTTGTTCTTATTGAAGATGTCGAG
ACGGATGCCGCCAGTGACTTGCCGCCGTCGGACCTGGGGCCCTCGCTTCCCGACGCCGCTGCTGTCGTCCAACCC
TCGGAGCTTCCAGACGCCACAGCCACGCCGGCATCACGAGCAACACCAAGCTCTTGTCTTGTCCAGACGCCCTCG
CCTGCGCCCCAGTCCCTCACGTCGTCGTCGCTGGCGACTGCTTCAGCCCCCATGTCGGTCAGCAAGAAGAAGGGC
CCAGGCTCGGCGTCCAGCAAGACGACTAAGCGCCCCAAGGGTGGCGCCGGAGCTGCCAGGGCTAAGAAGCCCAAA
TCGAGCATGAGCACTACATGGAAACCCGGTTCGGCTGGCGAGGAATCAGACAACGGGCCCTATTGCATCTGCCGA
GGACCCGACGATCACCGCTGGATGATATGCTGCGAGGCTTGTGAGGATTGGTTCCACGGCGAATGCATCAAGATG
CCCAAGGATATCGGCGAGAGTCTTATTGAAAGATTTATCTGCCCCAACTGCACCACGGACAAACGTGCCACTGTC
TACAGAAAGTCTTGTTCATTCAATGCCTGTCGCAAGGCGGCGCGCCTCACCGACACGGACCCGAGCGCCTTTTGC
TCCGACGAGCATGCTCACTTGTGGTGGGAGCGCATGATTGCAAAGCTGCCCAAGACTCACCCCAAGGTTGGGCCG
TCGGGCGACCAGCTCACCCAAGGCGAGCTCATGGCGGTGCTCAAGAGCCGGCTGGGCGGCCAAGAGGCTCCAGAT
GGCAGCAAGCTCTTCAAGGCTCCCTTTTCCGGCAAGGTGCCCAATGAGGAGAGCAAAGATGACATGGACGATTTT
GTTGGCAAGATTCTGAGCGACGAGGAAAAAAAGATTCTCCAAGACGCCGTCGAGACGCGGAAAAAGCTGAGCCAG
GAAAAGCGGCTGTACAACGAAATGATGCTCCTGGTGGAGAATGCGCAAGAGCGGCGCCGAGCAGCCATTGCTGCG
GGCCACTTCACCGACGACATTTGCGGCTACGATTCACGTCTTGATACTGTACTGGCGCGAGATGCCTTTGCTGCA
TATATAGAGTCAGCCGAGGGCATGGCAGCGCTATCTCTGTGCGACGCGGCCACGACGGGCCAAGAAGCACAGGTG
CCACTACAAGGCATTTGCGACCGAAAGCGCTGCAAGGGCCACAGCGGATGGCAAAAAATGTTTCCTCATTCAATC
AAGCAGCAAATCCGCGACTTGGACAAGCAGGCTGCGGCAGTGGCGGCCGAGGAAAAGGTGGTGCGCGAGGCGGCG
GTGGAGCGGTGGAAGCGCAAGCAGACAGAAAACAACTGGGTAGAGGTCATTAACGACGAGTAG
Transcript >OphauB2|849
ATGGAACGGGCTCAAAAGCACACAACGCCCGCTTACTACAACGAACCTCGATTTGTTCTTATTGAAGATGTCGAG
ACGGATGCCGCCAGTGACTTGCCGCCGTCGGACCTGGGGCCCTCGCTTCCCGACGCCGCTGCTGTCGTCCAACCC
TCGGAGCTTCCAGACGCCACAGCCACGCCGGCATCACGAGCAACACCAAGCTCTTGTCTTGTCCAGACGCCCTCG
CCTGCGCCCCAGTCCCTCACGTCGTCGTCGCTGGCGACTGCTTCAGCCCCCATGTCGGTCAGCAAGAAGAAGGGC
CCAGGCTCGGCGTCCAGCAAGACGACTAAGCGCCCCAAGGGTGGCGCCGGAGCTGCCAGGGCTAAGAAGCCCAAA
TCGAGCATGAGCACTACATGGAAACCCGGTTCGGCTGGCGAGGAATCAGACAACGGGCCCTATTGCATCTGCCGA
GGACCCGACGATCACCGCTGGATGATATGCTGCGAGGCTTGTGAGGATTGGTTCCACGGCGAATGCATCAAGATG
CCCAAGGATATCGGCGAGAGTCTTATTGAAAGATTTATCTGCCCCAACTGCACCACGGACAAACGTGCCACTGTC
TACAGAAAGTCTTGTTCATTCAATGCCTGTCGCAAGGCGGCGCGCCTCACCGACACGGACCCGAGCGCCTTTTGC
TCCGACGAGCATGCTCACTTGTGGTGGGAGCGCATGATTGCAAAGCTGCCCAAGACTCACCCCAAGGTTGGGCCG
TCGGGCGACCAGCTCACCCAAGGCGAGCTCATGGCGGTGCTCAAGAGCCGGCTGGGCGGCCAAGAGGCTCCAGAT
GGCAGCAAGCTCTTCAAGGCTCCCTTTTCCGGCAAGGTGCCCAATGAGGAGAGCAAAGATGACATGGACGATTTT
GTTGGCAAGATTCTGAGCGACGAGGAAAAAAAGATTCTCCAAGACGCCGTCGAGACGCGGAAAAAGCTGAGCCAG
GAAAAGCGGCTGTACAACGAAATGATGCTCCTGGTGGAGAATGCGCAAGAGCGGCGCCGAGCAGCCATTGCTGCG
GGCCACTTCACCGACGACATTTGCGGCTACGATTCACGTCTTGATACTGTACTGGCGCGAGATGCCTTTGCTGCA
TATATAGAGTCAGCCGAGGGCATGGCAGCGCTATCTCTGTGCGACGCGGCCACGACGGGCCAAGAAGCACAGGTG
CCACTACAAGGCATTTGCGACCGAAAGCGCTGCAAGGGCCACAGCGGATGGCAAAAAATGTTTCCTCATTCAATC
AAGCAGCAAATCCGCGACTTGGACAAGCAGGCTGCGGCAGTGGCGGCCGAGGAAAAGGTGGTGCGCGAGGCGGCG
GTGGAGCGGTGGAAGCGCAAGCAGACAGAAAACAACTGGGTAGAGGTCATTAACGACGAGTAG
Gene >OphauB2|849
ATGGAACGGGCTCAAAAGCACACAACGCCCGCTTACTACAACGAACCTCGATTTGTTCTTATTGAAGATGTCGAG
ACGGATGCCGCCAGTGACTTGCCGCCGTCGGACCTGGGGCCCTCGCTTCCCGACGCCGCTGCTGTCGTCCAACCC
TCGGAGCTTCCAGACGCCACAGCCACGCCGGCATCACGAGCAACACCAAGCTCTTGTCTTGTCCAGACGCCCTCG
CCTGCGCCCCAGTCCCTCACGTCGTCGTCGCTGGCGACTGCTTCAGCCCCCATGTCGGTCAGCAAGAAGAAGGGC
CCAGGCTCGGCGTCCAGCAAGACGACTAAGCGCCCCAAGGGTGGCGCCGGAGCTGCCAGGGCTAAGAAGCCCAAA
TCGAGCATGAGCACTACATGGAAACCCGGTTCGGCTGGCGAGGAATCAGACAACGGGCCCTATTGCATCTGCCGA
GGACCCGACGATCACCGCTGGATGATATGCTGCGAGGCTTGTGAGGATTGGTTCCACGGCGAATGCATCAAGATG
CCCAAGGATATCGGCGAGAGTCTTATTGAAAGATTTATCTGCCCCAACTGCACCACGGACAAACGTGCCACTGTC
TACAGAAAGTCTTGTTCATTCAATGCCTGTCGCAAGGCGGCGCGCCTCACCGACACGGACCCGAGCGCCTTTTGC
TCCGACGAGCATGCTCACTTGTGGTGGGAGCGCATGATTGCAAAGCTGCCCAAGACTCACCCCAAGGTTGGGCCG
TCGGGCGACCAGCTCACCCAAGGCGAGCTCATGGCGGTGCTCAAGAGCCGGCTGGGCGGCCAAGAGGCTCCAGAT
GGCAGCAAGCTCTTCAAGGCTCCCTTTTCCGGCAAGGTGCCCAATGAGGAGAGCAAAGATGACATGGGTAGGGTC
TACAGCAGTCTAGCAGCGCTTGATGCTCCATGTTTTACTGACTGGACATTGCCAGACGATTTTGTTGGCAAGATT
CTGAGCGACGAGGAAAAAAAGATTCTCCAAGACGCCGTCGAGACGCGGAAAAAGCTGAGCCAGGAAAAGCGGCTG
TACAACGAAATGATGCTCCTGGTGGAGAATGCGCAAGAGCGGCGCCGAGCAGCCATTGCTGCGGGCCACTTCACC
GACGACATTTGCGGCTACGATTCACGTCTTGATACTGTACTGGCGCGAGATGCCTTTGCTGCATATATAGAGTCA
GCCGAGGGCATGGCAGCGCTATCTCTGTGCGACGCGGCCACGACGGGCCAAGAAGCACAGGTGCCACTACAAGGC
ATTTGCGACCGAAAGCGCTGCAAGGGCCACAGCGGATGGCAAAAAATGTTTCCTCATTCAATCAAGCAGCAAATC
CGCGACTTGGACAAGCAGGCTGCGGCAGTGGCGGCCGAGGAAAAGGTGGTGCGCGAGGCGGCGGTGGAGCGGTGG
AAGCGCAAGCAGACAGAAAACAACTGGGTAGAGGTCATTAACGACGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail