Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|845
Gene name
LocationContig_119:24715..25450
Strand-
Gene length (bp)735
Transcript length (bp)519
Coding sequence length (bp)519
Protein length (aa) 173

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06747 CHCH CHCH domain 6.9E-07 91 124

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P21976|NDUA8_NEUCR NADH-ubiquinone oxidoreductase 20.8 kDa subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B1O14.280 PE=1 SV=2 1 165 6.0E-87
sp|Q9DCJ5|NDUA8_MOUSE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 OS=Mus musculus GN=Ndufa8 PE=1 SV=3 26 147 5.0E-16
sp|Q0MQB1|NDUA8_PANTR NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 OS=Pan troglodytes GN=NDUFA8 PE=2 SV=3 26 147 2.0E-13
sp|P51970|NDUA8_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 OS=Homo sapiens GN=NDUFA8 PE=1 SV=3 26 147 2.0E-13
sp|Q0MQB0|NDUA8_GORGO NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 OS=Gorilla gorilla gorilla GN=NDUFA8 PE=2 SV=3 26 147 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P21976|NDUA8_NEUCR NADH-ubiquinone oxidoreductase 20.8 kDa subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B1O14.280 PE=1 SV=2 1 165 6.0E-87
sp|Q9DCJ5|NDUA8_MOUSE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 OS=Mus musculus GN=Ndufa8 PE=1 SV=3 26 147 5.0E-16
sp|Q0MQB1|NDUA8_PANTR NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 OS=Pan troglodytes GN=NDUFA8 PE=2 SV=3 26 147 2.0E-13
sp|P51970|NDUA8_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 OS=Homo sapiens GN=NDUFA8 PE=1 SV=3 26 147 2.0E-13
sp|Q0MQB0|NDUA8_GORGO NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 OS=Gorilla gorilla gorilla GN=NDUFA8 PE=2 SV=3 26 147 2.0E-13
sp|P0CB92|NDUA8_PONPY NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 OS=Pongo pygmaeus GN=NDUFA8 PE=2 SV=1 26 147 3.0E-13
sp|P0CB91|NDUA8_PONAB NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 OS=Pongo abelii GN=NDUFA8 PE=2 SV=1 26 147 3.0E-13
sp|P42029|NDUA8_BOVIN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 OS=Bos taurus GN=NDUFA8 PE=1 SV=2 26 147 1.0E-12
sp|Q9SQT4|NDA8A_ARATH NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8-A OS=Arabidopsis thaliana GN=At3g06310 PE=2 SV=1 32 113 2.0E-06
sp|Q8LGE7|NDA8B_ARATH NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8-B OS=Arabidopsis thaliana GN=At5g18800 PE=1 SV=1 32 121 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|845
MATRRPQFNQELLIDTTPLPADVPPVKEIGASSAPLLSASFFIGARCRDYNDDYMQCKTEKPGRGEFECMKEGRR
VTRCAQSVIKDINTHCLAEFRKHWECLDDRNHQLWQCRPAEWNLNKCVYEKLKLEKKIPDQPANVTPVELRRRQI
FADVPPPPLQQPFIPGQSDAKQ*
Coding >OphauB2|845
ATGGCGACCCGACGACCTCAGTTCAACCAGGAGCTCCTCATTGACACAACGCCGCTGCCGGCCGACGTGCCTCCG
GTCAAGGAGATCGGCGCGAGCTCGGCGCCGCTACTGTCAGCCTCGTTCTTCATCGGCGCACGATGCCGCGACTAC
AATGACGACTATATGCAGTGCAAGACGGAGAAGCCAGGGCGCGGCGAGTTTGAGTGCATGAAGGAGGGACGGAGG
GTGACGCGGTGCGCCCAGAGCGTCATCAAGGACATCAACACGCACTGCCTCGCCGAGTTTAGGAAACACTGGGAG
TGCCTCGACGACCGGAACCACCAGCTTTGGCAGTGCCGTCCTGCCGAGTGGAATCTCAACAAGTGCGTCTACGAA
AAATTGAAATTGGAAAAGAAGATCCCAGATCAGCCAGCCAACGTGACGCCTGTGGAGCTGCGGAGGAGGCAGATC
TTTGCCGACGTGCCGCCCCCGCCCCTCCAGCAACCATTTATTCCAGGCCAAAGTGACGCGAAGCAGTGA
Transcript >OphauB2|845
ATGGCGACCCGACGACCTCAGTTCAACCAGGAGCTCCTCATTGACACAACGCCGCTGCCGGCCGACGTGCCTCCG
GTCAAGGAGATCGGCGCGAGCTCGGCGCCGCTACTGTCAGCCTCGTTCTTCATCGGCGCACGATGCCGCGACTAC
AATGACGACTATATGCAGTGCAAGACGGAGAAGCCAGGGCGCGGCGAGTTTGAGTGCATGAAGGAGGGACGGAGG
GTGACGCGGTGCGCCCAGAGCGTCATCAAGGACATCAACACGCACTGCCTCGCCGAGTTTAGGAAACACTGGGAG
TGCCTCGACGACCGGAACCACCAGCTTTGGCAGTGCCGTCCTGCCGAGTGGAATCTCAACAAGTGCGTCTACGAA
AAATTGAAATTGGAAAAGAAGATCCCAGATCAGCCAGCCAACGTGACGCCTGTGGAGCTGCGGAGGAGGCAGATC
TTTGCCGACGTGCCGCCCCCGCCCCTCCAGCAACCATTTATTCCAGGCCAAAGTGACGCGAAGCAGTGA
Gene >OphauB2|845
ATGGCGACCCGACGACCTCAGTACGCATCCTCTGCCATTCATCATGTACTGCATGGGCCGTGGCTGACGACCAAG
AACAGGTTCAACCAGGAGCTCCTCATTGACACAACGCCGCTGCCGGCCGACGTGCCTCCGGTCAAGGAGATCGGC
GCGAGCTCGGCGCCGCTACTGTCAGCCTCGTTCTTCATCGGCGCACGATGCCGCGACTACAATGACGACTATATG
CAGTGCAAGACGGAGAAGCCAGGGCGCGGCGAGTTTGAGTGCATGAAGGAGGGACGGAGGGTGACGCGGTGCGCC
CAGAGCGTGTAGGTTGAATCAGGCCATGGCTAGCTTGTCCCCCGAGGACAAGATGCTGGCATTGTCTTGCCCGAC
GTGGTGAGGGTTGACGCGTTTTGCTCGCACAGCATCAAGGACATCAACACGCACTGCCTCGCCGAGTTTAGGAAA
CACTGGGAGTGCCTCGACGACCGGAACCACCAGCTTTGGCAGTGCCGTCCTGCCGAGTGGAATCTCAACAAGTGC
GTCTACGAAAAATTGGTGAGTTGGCCCCGAACCCAATCAGCTTGCCCAGATGGGCCAACGTGTTGTCTTTAGAAA
TTGGAAAAGAAGATCCCAGATCAGCCAGCCAACGTGACGCCTGTGGAGCTGCGGAGGAGGCAGATCTTTGCCGAC
GTGCCGCCCCCGCCCCTCCAGCAACCATTTATTCCAGGCCAAAGTGACGCGAAGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail