Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|837
Gene name
LocationContig_119:597..1364
Strand+
Gene length (bp)767
Transcript length (bp)582
Coding sequence length (bp)582
Protein length (aa) 194

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12328 Rpp20 Rpp20 subunit of nuclear RNase MRP and P 6.0E-21 42 148
PF01918 Alba Alba 2.3E-10 43 128

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38291|POP7_YEAST Ribonucleases P/MRP protein subunit POP7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POP7 PE=1 SV=1 23 153 8.0E-09

GO

GO Term Description Terminal node
GO:0001682 tRNA 5'-leader removal Yes
GO:0005655 nucleolar ribonuclease P complex Yes
GO:0003676 nucleic acid binding Yes
GO:0000172 ribonuclease MRP complex Yes
GO:0006396 RNA processing Yes
GO:0008033 tRNA processing No
GO:0090304 nucleic acid metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1902494 catalytic complex No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0099116 tRNA 5'-end processing No
GO:0003674 molecular_function No
GO:0006399 tRNA metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0030681 multimeric ribonuclease P complex No
GO:0006725 cellular aromatic compound metabolic process No
GO:0005575 cellular_component No
GO:1902555 endoribonuclease complex No
GO:0043170 macromolecule metabolic process No
GO:0008152 metabolic process No
GO:1990904 ribonucleoprotein complex No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0032991 protein-containing complex No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0030677 ribonuclease P complex No
GO:0044237 cellular metabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0034470 ncRNA processing No
GO:0097159 organic cyclic compound binding No
GO:0005732 sno(s)RNA-containing ribonucleoprotein complex No
GO:0000966 RNA 5'-end processing No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|837
MADTSSPAAPPVDKHPRTIPGLRVQKRPLLRRPAPASALTPLVYISSCTPFMSAARRISKLLARSQHSGAACKRA
TLQERIEQISSEQSGKTRVTAVGAGRAVEKMVALAAWFERQGGYLVELRTSTSAAVDDVINKEGDEEDAARVRMD
SVVVRFYSRGLDDEDYFFSWISLNASRYRMLMQLQTPCQIKFD*
Coding >OphauB2|837
ATGGCAGACACAAGCTCTCCGGCCGCGCCGCCAGTGGACAAGCACCCGCGCACCATTCCAGGCCTCCGCGTGCAA
AAGCGTCCGCTCCTCCGCCGCCCAGCCCCCGCGTCCGCTCTCACGCCCCTAGTCTACATTTCCTCATGCACGCCC
TTTATGTCTGCCGCACGCCGCATCTCCAAGCTCCTTGCGCGCTCGCAGCACAGCGGCGCGGCATGCAAGCGCGCG
ACACTACAGGAGCGCATCGAGCAAATATCGAGTGAGCAGAGCGGCAAGACTAGAGTTACGGCCGTGGGGGCGGGA
CGTGCAGTGGAAAAAATGGTGGCGCTGGCGGCGTGGTTTGAGCGCCAGGGGGGGTATTTGGTTGAGCTGAGGACG
AGCACGTCGGCGGCGGTGGATGATGTGATTAATAAAGAGGGGGATGAGGAGGATGCGGCGAGGGTGCGCATGGAT
AGCGTCGTGGTGAGGTTTTATTCAAGGGGGTTGGATGATGAAGATTACTTTTTTTCCTGGATTTCGCTAAACGCC
TCACGCTATCGAATGCTCATGCAGCTCCAGACGCCGTGCCAGATTAAATTCGACTAG
Transcript >OphauB2|837
ATGGCAGACACAAGCTCTCCGGCCGCGCCGCCAGTGGACAAGCACCCGCGCACCATTCCAGGCCTCCGCGTGCAA
AAGCGTCCGCTCCTCCGCCGCCCAGCCCCCGCGTCCGCTCTCACGCCCCTAGTCTACATTTCCTCATGCACGCCC
TTTATGTCTGCCGCACGCCGCATCTCCAAGCTCCTTGCGCGCTCGCAGCACAGCGGCGCGGCATGCAAGCGCGCG
ACACTACAGGAGCGCATCGAGCAAATATCGAGTGAGCAGAGCGGCAAGACTAGAGTTACGGCCGTGGGGGCGGGA
CGTGCAGTGGAAAAAATGGTGGCGCTGGCGGCGTGGTTTGAGCGCCAGGGGGGGTATTTGGTTGAGCTGAGGACG
AGCACGTCGGCGGCGGTGGATGATGTGATTAATAAAGAGGGGGATGAGGAGGATGCGGCGAGGGTGCGCATGGAT
AGCGTCGTGGTGAGGTTTTATTCAAGGGGGTTGGATGATGAAGATTACTTTTTTTCCTGGATTTCGCTAAACGCC
TCACGCTATCGAATGCTCATGCAGCTCCAGACGCCGTGCCAGATTAAATTCGACTAG
Gene >OphauB2|837
ATGGCAGACACAAGCTCTCCGGCCGCGCCGCCAGTGGACAAGCACCCGCGCACCATTCCAGGTATGTTCTCCAAG
CTCTCCCTCTTTTCCCACACACACAACAGCTCAAACCCCCCTCCTCCAGGCCTCCGCGTGCAAAAGCGTCCGCTC
CTCCGCCGCCCAGCCCCCGCGTCCGCTCTCACGCCCCTAGTCTACATTTCCTCATGCACGCCCTTTATGTCTGCC
GCACGCCGCATCTCCAAGCTCCTTGCGCGCTCGCAGCACAGCGGCGCGGCATGCAAGCGCGCGACACTACAGGAG
CGCATCGAGCAAATATCGAGTGAGCAGAGCGGCAAGACTAGAGTTACGGCCGTGGGGGCGGGACGTGCAGTGGAA
AAAATGGTGGCGCTGGCGGCGTGGTTTGAGCGCCAGGGGGGGTATTTGGTTGAGCTGAGGACGAGCACGTCGGCG
GCGGTGGATGATGTGATTAATAAAGAGGGGGATGAGGAGGATGCGGCGAGGGTGCGCATGGTGAGTTCGTTGGAG
TTGGTGGTTTGTCTCAAGTGAGGTGCACGAGGTATTCTGGGTGAGGATAGCGTCGTGGTGAGGTTTTATTCAAGG
GGGTTGGATGATGAAGGTATGGTGAAGTTGAACAGCATGATTTATTGTTTGCTGGCTAAAAAAGGGGGGGGTTGC
CAGATTACTTTTTTTCCTGGATTTCGCTAAACGCCTCACGCTATCGAATGCTCATGCAGCTCCAGACGCCGTGCC
AGATTAAATTCGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail