Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|830
Gene name
LocationContig_118:50557..54425
Strand+
Gene length (bp)3868
Transcript length (bp)3492
Coding sequence length (bp)3492
Protein length (aa) 1164

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00617 RasGEF RasGEF domain 5.9E-58 912 1093
PF00618 RasGEF_N RasGEF N-terminal motif 3.7E-28 744 842
PF00018 SH3_1 SH3 domain 4.2E-13 18 63
PF07653 SH3_2 Variant SH3 domain 1.5E-12 16 68
PF14604 SH3_9 Variant SH3 domain 8.0E-12 19 65

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P43069|CDC25_CANAL Cell division control protein 25 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC25 PE=3 SV=1 720 1148 2.0E-90
sp|Q02342|CDC25_LACKL Cell division control protein 25 (Fragment) OS=Lachancea kluyveri GN=CDC25 PE=3 SV=1 720 1146 6.0E-88
sp|P04821|CDC25_YEAST Cell division control protein 25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC25 PE=1 SV=1 720 1146 2.0E-85
sp|C8ZCV7|SDC25_YEAS8 Guanine nucleotide exchange factor SDC25 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=SDC25 PE=3 SV=1 722 1150 9.0E-66
sp|P0CF34|YL016_YEAST Putative truncated guanine nucleotide exchange factor SDC25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDC25 PE=5 SV=1 722 1150 2.0E-65
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P43069|CDC25_CANAL Cell division control protein 25 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC25 PE=3 SV=1 720 1148 2.0E-90
sp|Q02342|CDC25_LACKL Cell division control protein 25 (Fragment) OS=Lachancea kluyveri GN=CDC25 PE=3 SV=1 720 1146 6.0E-88
sp|P04821|CDC25_YEAST Cell division control protein 25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC25 PE=1 SV=1 720 1146 2.0E-85
sp|C8ZCV7|SDC25_YEAS8 Guanine nucleotide exchange factor SDC25 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=SDC25 PE=3 SV=1 722 1150 9.0E-66
sp|P0CF34|YL016_YEAST Putative truncated guanine nucleotide exchange factor SDC25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDC25 PE=5 SV=1 722 1150 2.0E-65
sp|P0CF32|SDC25_YEASX Guanine nucleotide exchange factor SDC25 OS=Saccharomyces cerevisiae GN=SDC25 PE=3 SV=1 722 1150 2.0E-65
sp|A7A0P0|SDC25_YEAS7 Guanine nucleotide exchange factor SDC25 OS=Saccharomyces cerevisiae (strain YJM789) GN=SDC25 PE=3 SV=2 722 1150 2.0E-64
sp|B3LTF3|SDC25_YEAS1 Guanine nucleotide exchange factor SDC25 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SDC25 PE=3 SV=1 722 1150 2.0E-64
sp|B5VMS9|SDC25_YEAS6 Guanine nucleotide exchange factor SDC25 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=SDC25 PE=3 SV=1 722 1150 2.0E-64
sp|Q8IS14|GEFJ_DICDI Ras guanine nucleotide exchange factor J OS=Dictyostelium discoideum GN=gefJ PE=2 SV=1 738 1154 4.0E-64
sp|Q8IS15|GEFI_DICDI Ras guanine nucleotide exchange factor I OS=Dictyostelium discoideum GN=gefI PE=2 SV=1 733 1154 1.0E-62
sp|Q9USU1|EFC25_SCHPO Ras guanine nucleotide exchange factor efc25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=efc25 PE=1 SV=1 371 1146 1.0E-61
sp|Q62245|SOS1_MOUSE Son of sevenless homolog 1 OS=Mus musculus GN=Sos1 PE=1 SV=2 724 1146 2.0E-60
sp|Q07889|SOS1_HUMAN Son of sevenless homolog 1 OS=Homo sapiens GN=SOS1 PE=1 SV=1 720 1146 2.0E-59
sp|P26675|SOS_DROME Protein son of sevenless OS=Drosophila melanogaster GN=Sos PE=1 SV=2 742 1146 2.0E-59
sp|Q54PQ4|GEFA_DICDI Ras guanine nucleotide exchange factor A OS=Dictyostelium discoideum GN=gefA PE=2 SV=1 743 1147 5.0E-58
sp|Q07890|SOS2_HUMAN Son of sevenless homolog 2 OS=Homo sapiens GN=SOS2 PE=1 SV=2 724 1146 2.0E-57
sp|Q02384|SOS2_MOUSE Son of sevenless homolog 2 OS=Mus musculus GN=Sos2 PE=1 SV=2 721 1146 2.0E-57
sp|P26674|STE6_SCHPO Protein ste6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ste6 PE=3 SV=1 744 1161 3.0E-52
sp|Q8IS18|GEFE_DICDI Ras guanine nucleotide exchange factor E OS=Dictyostelium discoideum GN=gefE PE=2 SV=1 809 1149 4.0E-51
sp|Q55GH9|GEFW_DICDI Ras guanine nucleotide exchange factor W OS=Dictyostelium discoideum GN=gefW PE=2 SV=1 697 1111 8.0E-51
sp|Q8SSQ0|GEFR_DICDI Ras guanine nucleotide exchange factor R OS=Dictyostelium discoideum GN=gefR PE=1 SV=1 728 1147 7.0E-49
sp|Q552M5|GEFY_DICDI Ras guanine nucleotide exchange factor Y OS=Dictyostelium discoideum GN=gefY PE=1 SV=2 744 1145 2.0E-48
sp|Q54TK8|GEFP_DICDI Ras guanine nucleotide exchange factor P OS=Dictyostelium discoideum GN=gefP PE=2 SV=1 730 1147 4.0E-46
sp|A2CEA7|RGRF2_DANRE Ras-specific guanine nucleotide-releasing factor 2 OS=Danio rerio GN=rasgrf2 PE=3 SV=1 818 1146 5.0E-44
sp|Q13972|RGRF1_HUMAN Ras-specific guanine nucleotide-releasing factor 1 OS=Homo sapiens GN=RASGRF1 PE=1 SV=2 818 1146 1.0E-42
sp|Q54FF3|GEFK_DICDI Ras guanine nucleotide exchange factor K OS=Dictyostelium discoideum GN=gefK PE=2 SV=1 897 1146 1.0E-40
sp|Q8SSQ3|GEFM_DICDI Ras guanine nucleotide exchange factor M OS=Dictyostelium discoideum GN=gefM PE=2 SV=1 895 1123 2.0E-40
sp|P70392|RGRF2_MOUSE Ras-specific guanine nucleotide-releasing factor 2 OS=Mus musculus GN=Rasgrf2 PE=1 SV=2 818 1146 5.0E-40
sp|Q99JE4|RGRF2_RAT Ras-specific guanine nucleotide-releasing factor 2 OS=Rattus norvegicus GN=Rasgrf2 PE=1 SV=1 818 1146 6.0E-40
sp|O14827|RGRF2_HUMAN Ras-specific guanine nucleotide-releasing factor 2 OS=Homo sapiens GN=RASGRF2 PE=1 SV=2 818 1146 2.0E-39
sp|P27671|RGRF1_MOUSE Ras-specific guanine nucleotide-releasing factor 1 OS=Mus musculus GN=Rasgrf1 PE=1 SV=2 818 1146 3.0E-39
sp|P28818|RGRF1_RAT Ras-specific guanine nucleotide-releasing factor 1 OS=Rattus norvegicus GN=Rasgrf1 PE=1 SV=1 818 1146 2.0E-38
sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 740 1146 1.0E-37
sp|Q8ST25|GEFG_DICDI Ras guanine nucleotide exchange factor G OS=Dictyostelium discoideum GN=gefG PE=2 SV=1 771 1154 4.0E-37
sp|Q55FD8|GEFV_DICDI Ras guanine nucleotide exchange factor V OS=Dictyostelium discoideum GN=gefV PE=2 SV=1 714 1153 2.0E-36
sp|Q86G47|GEFQ_DICDI Ras guanine nucleotide exchange factor Q OS=Dictyostelium discoideum GN=gefQ PE=2 SV=1 888 1148 2.0E-36
sp|Q8IS20|GEFC_DICDI Ras guanine nucleotide exchange factor C OS=Dictyostelium discoideum GN=gefC PE=2 SV=1 894 1125 1.0E-35
sp|Q8SSW7|GEFS_DICDI Ras guanine nucleotide exchange factor S OS=Dictyostelium discoideum GN=gefS PE=2 SV=1 735 1146 3.0E-34
sp|Q8IS16|GEFH_DICDI Ras guanine nucleotide exchange factor H OS=Dictyostelium discoideum GN=gefH PE=2 SV=1 836 1123 1.0E-32
sp|Q9NZL6|RGL1_HUMAN Ral guanine nucleotide dissociation stimulator-like 1 OS=Homo sapiens GN=RGL1 PE=1 SV=1 743 1144 2.0E-32
sp|Q6P112|RGL1_DANRE Ral guanine nucleotide dissociation stimulator-like 1 OS=Danio rerio GN=rgl1 PE=2 SV=1 743 1144 1.0E-31
sp|Q13905|RPGF1_HUMAN Rap guanine nucleotide exchange factor 1 OS=Homo sapiens GN=RAPGEF1 PE=1 SV=3 742 1146 1.0E-31
sp|Q60695|RGL1_MOUSE Ral guanine nucleotide dissociation stimulator-like 1 OS=Mus musculus GN=Rgl1 PE=1 SV=2 743 1144 2.0E-31
sp|B0UXH6|RGPS1_DANRE Ras-specific guanine nucleotide-releasing factor RalGPS1 OS=Danio rerio GN=ralgps1 PE=2 SV=1 905 1145 2.0E-30
sp|O77086|C3G_DROME Guanine nucleotide-releasing factor 2 OS=Drosophila melanogaster GN=C3G PE=1 SV=4 742 1148 7.0E-30
sp|Q8IS21|GEFB_DICDI Ras guanine nucleotide exchange factor B OS=Dictyostelium discoideum GN=gefB PE=2 SV=1 910 1146 1.0E-29
sp|Q5ZJK0|RGPS1_CHICK Ras-specific guanine nucleotide-releasing factor RalGPS1 OS=Gallus gallus GN=RALGPS1 PE=2 SV=1 906 1145 2.0E-29
sp|Q4R7W3|RGPS2_MACFA Ras-specific guanine nucleotide-releasing factor RalGPS2 OS=Macaca fascicularis GN=RALGPS2 PE=2 SV=1 906 1145 2.0E-28
sp|Q86X27|RGPS2_HUMAN Ras-specific guanine nucleotide-releasing factor RalGPS2 OS=Homo sapiens GN=RALGPS2 PE=1 SV=1 906 1145 3.0E-28
sp|Q9ERD6|RGPS2_MOUSE Ras-specific guanine nucleotide-releasing factor RalGPS2 OS=Mus musculus GN=Ralgps2 PE=1 SV=2 906 1145 3.0E-28
sp|F1MSG6|RPGF2_BOVIN Rap guanine nucleotide exchange factor 2 OS=Bos taurus GN=RAPGEF2 PE=1 SV=2 902 1109 4.0E-28
sp|Q55EC7|GEFX_DICDI RasGEF domain-containing serine/threonine-protein kinase X OS=Dictyostelium discoideum GN=gefX PE=2 SV=1 897 1145 4.0E-28
sp|F1PBJ0|RPGF2_CANLF Rap guanine nucleotide exchange factor 2 OS=Canis lupus familiaris GN=RAPGEF2 PE=1 SV=2 902 1109 4.0E-28
sp|F1M386|RPGF2_RAT Rap guanine nucleotide exchange factor 2 OS=Rattus norvegicus GN=Rapgef2 PE=1 SV=2 902 1109 8.0E-28
sp|Q8CHG7|RPGF2_MOUSE Rap guanine nucleotide exchange factor 2 OS=Mus musculus GN=Rapgef2 PE=1 SV=2 902 1109 9.0E-28
sp|Q9Y4G8|RPGF2_HUMAN Rap guanine nucleotide exchange factor 2 OS=Homo sapiens GN=RAPGEF2 PE=1 SV=1 902 1109 1.0E-27
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 723 1123 3.0E-27
sp|Q5JS13|RGPS1_HUMAN Ras-specific guanine nucleotide-releasing factor RalGPS1 OS=Homo sapiens GN=RALGPS1 PE=1 SV=1 906 1145 4.0E-27
sp|Q8IS11|GEFO_DICDI Ras guanine nucleotide exchange factor O OS=Dictyostelium discoideum GN=gefO PE=2 SV=1 901 1123 4.0E-27
sp|Q3UYI5|RGL3_MOUSE Ral guanine nucleotide dissociation stimulator-like 3 OS=Mus musculus GN=Rgl3 PE=1 SV=2 904 1145 5.0E-27
sp|A2AR50|RGPS1_MOUSE Ras-specific guanine nucleotide-releasing factor RalGPS1 OS=Mus musculus GN=Ralgps1 PE=1 SV=2 906 1145 1.0E-26
sp|O15211|RGL2_HUMAN Ral guanine nucleotide dissociation stimulator-like 2 OS=Homo sapiens GN=RGL2 PE=1 SV=1 744 1157 2.0E-25
sp|Q54S40|GBPD_DICDI Cyclic GMP-binding protein D OS=Dictyostelium discoideum GN=gbpD PE=2 SV=1 914 1160 4.0E-25
sp|Q3MIN7|RGL3_HUMAN Ral guanine nucleotide dissociation stimulator-like 3 OS=Homo sapiens GN=RGL3 PE=1 SV=2 904 1145 1.0E-24
sp|Q03386|GNDS_RAT Ral guanine nucleotide dissociation stimulator OS=Rattus norvegicus GN=Ralgds PE=1 SV=1 914 1145 2.0E-24
sp|Q8IZJ4|RGDSR_HUMAN Ral-GDS-related protein OS=Homo sapiens GN=RGL4 PE=2 SV=1 913 1145 3.0E-24
sp|Q8IS12|GEFN_DICDI Ras guanine nucleotide exchange factor N OS=Dictyostelium discoideum GN=gefN PE=2 SV=1 732 1123 4.0E-24
sp|Q61193|RGL2_MOUSE Ral guanine nucleotide dissociation stimulator-like 2 OS=Mus musculus GN=Rgl2 PE=1 SV=2 744 1145 8.0E-24
sp|Q5TJE5|RGL2_CANLF Ral guanine nucleotide dissociation stimulator-like 2 OS=Canis lupus familiaris GN=RGL2 PE=3 SV=1 739 1157 2.0E-23
sp|Q12967|GNDS_HUMAN Ral guanine nucleotide dissociation stimulator OS=Homo sapiens GN=RALGDS PE=1 SV=2 884 1145 2.0E-23
sp|Q32N25|GRP2A_XENLA RAS guanyl-releasing protein 2-A OS=Xenopus laevis GN=rasgrp2-a PE=2 SV=1 903 1148 3.0E-23
sp|Q92565|RPGF5_HUMAN Rap guanine nucleotide exchange factor 5 OS=Homo sapiens GN=RAPGEF5 PE=1 SV=1 901 1146 5.0E-23
sp|Q8TEU7|RPGF6_HUMAN Rap guanine nucleotide exchange factor 6 OS=Homo sapiens GN=RAPGEF6 PE=1 SV=2 902 1103 6.0E-23
sp|Q03385|GNDS_MOUSE Ral guanine nucleotide dissociation stimulator OS=Mus musculus GN=Ralgds PE=1 SV=2 914 1118 1.0E-22
sp|P83900|RPGF5_RAT Rap guanine nucleotide exchange factor 5 OS=Rattus norvegicus GN=Rapgef5 PE=2 SV=1 901 1146 1.0E-22
sp|Q6DCK3|GRP2B_XENLA RAS guanyl-releasing protein 2-B OS=Xenopus laevis GN=rasgrp2-b PE=2 SV=1 903 1148 3.0E-22
sp|Q8C0Q9|RPGF5_MOUSE Rap guanine nucleotide exchange factor 5 OS=Mus musculus GN=Rapgef5 PE=2 SV=2 901 1146 5.0E-22
sp|Q6NTL4|GRP1_XENLA RAS guanyl-releasing protein 1 OS=Xenopus laevis GN=rasgrp1 PE=2 SV=1 782 1146 1.0E-21
sp|Q7LDG7|GRP2_HUMAN RAS guanyl-releasing protein 2 OS=Homo sapiens GN=RASGRP2 PE=1 SV=1 903 1146 2.0E-21
sp|Q9R1K8|GRP1_RAT RAS guanyl-releasing protein 1 OS=Rattus norvegicus GN=Rasgrp1 PE=1 SV=1 799 1146 2.0E-21
sp|A4IJ06|GRP1_XENTR RAS guanyl-releasing protein 1 OS=Xenopus tropicalis GN=rasgrp1 PE=2 SV=1 903 1146 3.0E-21
sp|G5EDB9|RPGF_CAEEL Rap guanine nucleotide exchange factor OS=Caenorhabditis elegans GN=pxf-1 PE=1 SV=1 888 1118 3.0E-21
sp|O95267|GRP1_HUMAN RAS guanyl-releasing protein 1 OS=Homo sapiens GN=RASGRP1 PE=1 SV=2 799 1146 5.0E-21
sp|A6N9I4|GRP2_BOVIN RAS guanyl-releasing protein 2 OS=Bos taurus GN=RASGRP2 PE=2 SV=1 893 1148 1.0E-20
sp|Q8IS19|GEFD_DICDI Ras guanine nucleotide exchange factor D OS=Dictyostelium discoideum GN=gefD PE=2 SV=1 907 1151 2.0E-20
sp|Q9Z1S3|GRP1_MOUSE RAS guanyl-releasing protein 1 OS=Mus musculus GN=Rasgrp1 PE=1 SV=1 799 1146 2.0E-20
sp|P0C643|GRP2_RAT RAS guanyl-releasing protein 2 OS=Rattus norvegicus GN=Rasgrp2 PE=1 SV=1 903 1146 3.0E-20
sp|Q5RC04|RGF1B_PONAB Ras-GEF domain-containing family member 1B OS=Pongo abelii GN=RASGEF1B PE=2 SV=2 746 1125 7.0E-20
sp|Q9QUG9|GRP2_MOUSE RAS guanyl-releasing protein 2 OS=Mus musculus GN=Rasgrp2 PE=1 SV=2 903 1146 9.0E-20
sp|Q0VAM2|RGF1B_HUMAN Ras-GEF domain-containing family member 1B OS=Homo sapiens GN=RASGEF1B PE=1 SV=2 746 1125 1.0E-19
sp|Q68EF8|RPGFL_MOUSE Rap guanine nucleotide exchange factor-like 1 OS=Mus musculus GN=Rapgefl1 PE=1 SV=2 908 1108 1.0E-19
sp|Q9UHV5|RPGFL_HUMAN Rap guanine nucleotide exchange factor-like 1 OS=Homo sapiens GN=RAPGEFL1 PE=1 SV=2 908 1108 2.0E-19
sp|Q8JZL7|RGF1B_MOUSE Ras-GEF domain-containing family member 1B OS=Mus musculus GN=Rasgef1b PE=1 SV=1 746 1125 3.0E-19
sp|Q5R9B2|RPGFL_PONPY Rap guanine nucleotide exchange factor-like 1 OS=Pongo pygmaeus GN=RAPGEFL1 PE=2 SV=1 908 1108 6.0E-19
sp|Q8IV61|GRP3_HUMAN Ras guanyl-releasing protein 3 OS=Homo sapiens GN=RASGRP3 PE=1 SV=1 749 1146 9.0E-19
sp|Q6DHR3|RG1BA_DANRE Ras-GEF domain-containing family member 1B-A OS=Danio rerio GN=rasgef1ba PE=2 SV=2 746 1125 1.0E-18
sp|Q8WZA2|RPGF4_HUMAN Rap guanine nucleotide exchange factor 4 OS=Homo sapiens GN=RAPGEF4 PE=1 SV=1 908 1108 1.0E-18
sp|Q9D300|RGF1C_MOUSE Ras-GEF domain-containing family member 1C OS=Mus musculus GN=Rasgef1c PE=2 SV=1 763 1152 1.0E-18
sp|A4IFE4|RGF1B_BOVIN Ras-GEF domain-containing family member 1B OS=Bos taurus GN=RASGEF1B PE=2 SV=1 746 1125 5.0E-18
sp|Q95KH6|RGF1C_MACFA Ras-GEF domain-containing family member 1C OS=Macaca fascicularis GN=RASGEF1C PE=2 SV=1 763 1123 6.0E-18
sp|Q8N431|RGF1C_HUMAN Ras-GEF domain-containing family member 1C OS=Homo sapiens GN=RASGEF1C PE=2 SV=2 763 1152 2.0E-17
sp|Q9EQZ6|RPGF4_MOUSE Rap guanine nucleotide exchange factor 4 OS=Mus musculus GN=Rapgef4 PE=1 SV=1 908 1108 2.0E-17
sp|Q9Z1C8|RPGF3_RAT Rap guanine nucleotide exchange factor 3 OS=Rattus norvegicus GN=Rapgef3 PE=2 SV=2 885 1108 6.0E-17
sp|Q9Z1C7|RPGF4_RAT Rap guanine nucleotide exchange factor 4 (Fragment) OS=Rattus norvegicus GN=Rapgef4 PE=2 SV=1 908 1108 7.0E-16
sp|Q8VCC8|RPGF3_MOUSE Rap guanine nucleotide exchange factor 3 OS=Mus musculus GN=Rapgef3 PE=1 SV=2 952 1108 8.0E-16
sp|O95398|RPGF3_HUMAN Rap guanine nucleotide exchange factor 3 OS=Homo sapiens GN=RAPGEF3 PE=1 SV=6 908 1092 3.0E-15
sp|A0JM95|RGF1A_XENTR Ras-GEF domain-containing family member 1A OS=Xenopus tropicalis GN=rasgef1a PE=2 SV=1 746 1125 7.0E-15
sp|Q28EC1|RGF1B_XENTR Ras-GEF domain-containing family member 1B OS=Xenopus tropicalis GN=rasgef1b PE=2 SV=1 746 1125 3.0E-14
sp|Q6CY10|LTE1_KLULA Guanine nucleotide exchange factor LTE1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LTE1 PE=3 SV=1 909 1105 4.0E-14
sp|Q6FT12|LTE1_CANGA Guanine nucleotide exchange factor LTE1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LTE1 PE=3 SV=1 905 1107 4.0E-14
sp|Q6DBW1|RG1BB_DANRE Ras-GEF domain-containing family member 1B-B OS=Danio rerio GN=rasgef1bb PE=2 SV=1 746 1125 7.0E-14
sp|P07866|LTE1_YEAST Guanine nucleotide exchange factor LTE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LTE1 PE=1 SV=2 905 1107 1.0E-13
sp|Q8MVR1|GBPC_DICDI Cyclic GMP-binding protein C OS=Dictyostelium discoideum GN=gbpC PE=1 SV=1 905 1161 1.0E-12
sp|Q8N9B8|RGF1A_HUMAN Ras-GEF domain-containing family member 1A OS=Homo sapiens GN=RASGEF1A PE=2 SV=2 746 1125 1.0E-12
sp|Q75BH9|LTE1_ASHGO Guanine nucleotide exchange factor LTE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LTE1 PE=3 SV=1 899 1107 2.0E-12
sp|P25300|BUD5_YEAST Bud site selection protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD5 PE=1 SV=2 906 1111 1.0E-10
sp|P34578|RPGF1_CAEEL Rap guanine nucleotide exchange factor 1 OS=Caenorhabditis elegans GN=epac-1 PE=3 SV=3 888 1154 1.0E-10
sp|A6QLK6|GRAP_BOVIN GRB2-related adapter protein OS=Bos taurus GN=GRAP PE=2 SV=1 7 69 3.0E-10
sp|Q8TDF6|GRP4_HUMAN RAS guanyl-releasing protein 4 OS=Homo sapiens GN=RASGRP4 PE=1 SV=2 893 1079 1.0E-09
sp|Q1LZ97|GRP4_BOVIN RAS guanyl-releasing protein 4 OS=Bos taurus GN=RASGRP4 PE=2 SV=1 893 1079 1.0E-09
sp|Q14155|ARHG7_HUMAN Rho guanine nucleotide exchange factor 7 OS=Homo sapiens GN=ARHGEF7 PE=1 SV=2 15 71 2.0E-09
sp|Q8R5I4|GRP4_RAT RAS guanyl-releasing protein 4 OS=Rattus norvegicus GN=Rasgrp4 PE=1 SV=1 903 1079 5.0E-09
sp|Q8BTM9|GRP4_MOUSE RAS guanyl-releasing protein 4 OS=Mus musculus GN=Rasgrp4 PE=1 SV=1 903 1079 7.0E-09
sp|O55043|ARHG7_RAT Rho guanine nucleotide exchange factor 7 OS=Rattus norvegicus GN=Arhgef7 PE=1 SV=1 15 65 8.0E-09
sp|Q9P212|PLCE1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Homo sapiens GN=PLCE1 PE=1 SV=3 933 1083 1.0E-08
sp|Q5ZLR6|ARHG6_CHICK Rho guanine nucleotide exchange factor 6 OS=Gallus gallus GN=ARHGEF6 PE=2 SV=1 10 116 1.0E-08
sp|Q9VU84|DBNL_DROME Drebrin-like protein OS=Drosophila melanogaster GN=Abp1 PE=1 SV=1 11 70 1.0E-08
sp|P62484|ABI2_MOUSE Abl interactor 2 OS=Mus musculus GN=Abi2 PE=1 SV=1 17 69 1.0E-08
sp|Q9NYB9|ABI2_HUMAN Abl interactor 2 OS=Homo sapiens GN=ABI2 PE=1 SV=1 17 69 1.0E-08
sp|Q9ES28|ARHG7_MOUSE Rho guanine nucleotide exchange factor 7 OS=Mus musculus GN=Arhgef7 PE=1 SV=2 15 65 1.0E-08
sp|P19706|MYSB_ACACA Myosin heavy chain IB OS=Acanthamoeba castellanii GN=MIB PE=1 SV=2 17 67 2.0E-08
sp|P27870|VAV_MOUSE Proto-oncogene vav OS=Mus musculus GN=Vav1 PE=1 SV=1 4 67 4.0E-08
sp|Q15052|ARHG6_HUMAN Rho guanine nucleotide exchange factor 6 OS=Homo sapiens GN=ARHGEF6 PE=1 SV=2 10 118 4.0E-08
sp|A8MVU1|NCF1C_HUMAN Putative neutrophil cytosol factor 1C OS=Homo sapiens GN=NCF1C PE=5 SV=1 10 79 4.0E-08
sp|Q5XXR3|ARHG6_RAT Rho guanine nucleotide exchange factor 6 OS=Rattus norvegicus GN=Arhgef6 PE=1 SV=1 10 65 5.0E-08
sp|Q8K4I3|ARHG6_MOUSE Rho guanine nucleotide exchange factor 6 OS=Mus musculus GN=Arhgef6 PE=1 SV=1 10 65 6.0E-08
sp|Q99962|SH3G2_HUMAN Endophilin-A1 OS=Homo sapiens GN=SH3GL2 PE=1 SV=1 2 71 6.0E-08
sp|Q09822|CDC15_SCHPO Cell division control protein 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc15 PE=1 SV=2 16 69 6.0E-08
sp|Q8AXV1|SH3G2_CHICK Endophilin-A1 OS=Gallus gallus GN=SH3GL2 PE=1 SV=1 2 69 9.0E-08
sp|O35179|SH3G2_RAT Endophilin-A1 OS=Rattus norvegicus GN=Sh3gl2 PE=1 SV=2 2 71 9.0E-08
sp|Q8IS20|GEFC_DICDI Ras guanine nucleotide exchange factor C OS=Dictyostelium discoideum GN=gefC PE=2 SV=1 742 874 1.0E-07
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 17 75 1.0E-07
sp|Q09014|NCF1_MOUSE Neutrophil cytosol factor 1 OS=Mus musculus GN=Ncf1 PE=1 SV=3 10 75 1.0E-07
sp|Q8AXV0|SH3G1_CHICK Endophilin-A2 OS=Gallus gallus GN=SH3GL1 PE=1 SV=1 17 69 1.0E-07
sp|Q6CVA8|HSE1_KLULA Class E vacuolar protein-sorting machinery protein HSE1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HSE1 PE=3 SV=1 17 96 1.0E-07
sp|Q62420|SH3G2_MOUSE Endophilin-A1 OS=Mus musculus GN=Sh3gl2 PE=1 SV=2 17 71 2.0E-07
sp|Q96B97|SH3K1_HUMAN SH3 domain-containing kinase-binding protein 1 OS=Homo sapiens GN=SH3KBP1 PE=1 SV=2 21 74 2.0E-07
sp|Q8R550|SH3K1_MOUSE SH3 domain-containing kinase-binding protein 1 OS=Mus musculus GN=Sh3kbp1 PE=1 SV=1 21 74 2.0E-07
sp|P14598|NCF1_HUMAN Neutrophil cytosol factor 1 OS=Homo sapiens GN=NCF1 PE=1 SV=3 10 79 2.0E-07
sp|P54100|VAV_RAT Proto-oncogene vav OS=Rattus norvegicus GN=Vav1 PE=2 SV=1 4 67 2.0E-07
sp|Q925Q9|SH3K1_RAT SH3 domain-containing kinase-binding protein 1 OS=Rattus norvegicus GN=Sh3kbp1 PE=1 SV=2 21 74 2.0E-07
sp|Q75DS3|HSE1_ASHGO Class E vacuolar protein-sorting machinery protein HSE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HSE1 PE=3 SV=1 17 96 2.0E-07
sp|A6NI72|NCF1B_HUMAN Putative neutrophil cytosol factor 1B OS=Homo sapiens GN=NCF1B PE=5 SV=2 10 79 2.0E-07
sp|Q9P7E8|APP1_SCHPO Protein app1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=app1 PE=2 SV=1 2 69 2.0E-07
sp|Q555L8|Y4695_DICDI SH3 and F-BAR domain-containing protein DDB_G0274695 OS=Dictyostelium discoideum GN=DDB_G0274695 PE=3 SV=1 6 67 3.0E-07
sp|Q6GM14|DBNLB_XENLA Drebrin-like protein B OS=Xenopus laevis GN=dbnl-b PE=2 SV=1 13 69 3.0E-07
sp|Q09746|BZZ1_SCHPO Protein BZZ1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bzz1 PE=3 SV=1 16 65 4.0E-07
sp|O74352|HOB1_SCHPO Protein hob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hob1 PE=1 SV=1 16 68 4.0E-07
sp|O74749|HSE1_SCHPO Class E vacuolar protein-sorting machinery protein hse1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hse1 PE=3 SV=1 2 109 4.0E-07
sp|A1DFN5|HSE1_NEOFI Class E vacuolar protein-sorting machinery protein hse1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hse1 PE=3 SV=1 4 72 4.0E-07
sp|Q8AXU9|SH3G3_CHICK Endophilin-A3 OS=Gallus gallus GN=SH3GL3 PE=1 SV=1 17 69 4.0E-07
sp|P29355|SEM5_CAEEL Sex muscle abnormal protein 5 OS=Caenorhabditis elegans GN=sem-5 PE=1 SV=1 16 65 4.0E-07
sp|Q2GT05|HSE1_CHAGB Class E vacuolar protein-sorting machinery protein HSE1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HSE1 PE=3 SV=1 5 72 5.0E-07
sp|Q4WHP5|HSE1_ASPFU Class E vacuolar protein-sorting machinery protein hse1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hse1 PE=3 SV=1 4 72 5.0E-07
sp|Q13588|GRAP_HUMAN GRB2-related adapter protein OS=Homo sapiens GN=GRAP PE=1 SV=1 7 69 6.0E-07
sp|F1M707|NCF1_RAT Neutrophil cytosolic factor 1 OS=Rattus norvegicus GN=Ncf1 PE=1 SV=2 10 75 7.0E-07
sp|Q1E878|HSE1_COCIM Class E vacuolar protein-sorting machinery protein HSE1 OS=Coccidioides immitis (strain RS) GN=HSE1 PE=3 SV=1 9 72 1.0E-06
sp|O77774|NCF1_BOVIN Neutrophil cytosol factor 1 OS=Bos taurus GN=NCF1 PE=2 SV=1 10 79 1.0E-06
sp|Q75JD4|Y1676_DICDI SH3 and F-BAR domain-containing protein DDB_G0271676 OS=Dictyostelium discoideum GN=DDB_G0271676 PE=3 SV=1 14 65 1.0E-06
sp|O43125|CSH3_SCHPO Protein csh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csh3 PE=2 SV=1 17 78 1.0E-06
sp|O42287|ITSN1_XENLA Intersectin-1 OS=Xenopus laevis GN=itsn1 PE=1 SV=1 2 75 2.0E-06
sp|Q0U6X7|HSE1_PHANO Class E vacuolar protein-sorting machinery protein HSE1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HSE1 PE=3 SV=1 17 72 2.0E-06
sp|P34109|MYOD_DICDI Myosin ID heavy chain OS=Dictyostelium discoideum GN=myoD PE=1 SV=2 1 69 2.0E-06
sp|P10569|MYSC_ACACA Myosin IC heavy chain OS=Acanthamoeba castellanii GN=MIC PE=1 SV=1 18 69 2.0E-06
sp|F1LRS8|CD2AP_RAT CD2-associated protein OS=Rattus norvegicus GN=Cd2ap PE=1 SV=2 17 74 2.0E-06
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus GN=Itsn2 PE=1 SV=2 17 75 2.0E-06
sp|Q07883|GRB2_CHICK Growth factor receptor-bound protein 2 OS=Gallus gallus GN=GRB2 PE=1 SV=1 5 70 2.0E-06
sp|Q96HU1|SGSM3_HUMAN Small G protein signaling modulator 3 OS=Homo sapiens GN=SGSM3 PE=1 SV=1 18 95 3.0E-06
sp|Q7T2D0|SGSM3_DANRE Small G protein signaling modulator 3 OS=Danio rerio GN=sgsm3 PE=2 SV=1 18 102 3.0E-06
sp|Q55EC7|GEFX_DICDI RasGEF domain-containing serine/threonine-protein kinase X OS=Dictyostelium discoideum GN=gefX PE=2 SV=1 752 848 4.0E-06
sp|Q6P6R7|SGSM3_RAT Small G protein signaling modulator 3 OS=Rattus norvegicus GN=Sgsm3 PE=1 SV=1 18 95 4.0E-06
sp|P62994|GRB2_RAT Growth factor receptor-bound protein 2 OS=Rattus norvegicus GN=Grb2 PE=1 SV=1 5 70 4.0E-06
sp|Q5R4J7|GRB2_PONAB Growth factor receptor-bound protein 2 OS=Pongo abelii GN=GRB2 PE=2 SV=1 5 70 4.0E-06
sp|P62993|GRB2_HUMAN Growth factor receptor-bound protein 2 OS=Homo sapiens GN=GRB2 PE=1 SV=1 5 70 4.0E-06
sp|Q8VCZ6|SGSM3_MOUSE Small G protein signaling modulator 3 OS=Mus musculus GN=Sgsm3 PE=1 SV=1 18 88 4.0E-06
sp|A6H8I2|SGSM3_XENLA Small G protein signaling modulator 3 homolog OS=Xenopus laevis GN=sgsm3 PE=2 SV=1 18 88 4.0E-06
sp|Q60631|GRB2_MOUSE Growth factor receptor-bound protein 2 OS=Mus musculus GN=Grb2 PE=1 SV=1 5 70 5.0E-06
sp|P34092|MYOB_DICDI Myosin IB heavy chain OS=Dictyostelium discoideum GN=myoB PE=1 SV=2 6 67 6.0E-06
sp|Q2KI13|SGSM3_BOVIN Small G protein signaling modulator 3 OS=Bos taurus GN=SGSM3 PE=2 SV=1 18 95 6.0E-06
sp|Q76NI1|VKIND_HUMAN Protein very KIND OS=Homo sapiens GN=KNDC1 PE=2 SV=2 916 1123 8.0E-06
sp|Q6C2N2|HSE1_YARLI Class E vacuolar protein-sorting machinery protein HSE1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HSE1 PE=3 SV=1 7 72 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005085 guanyl-nucleotide exchange factor activity Yes
GO:0007264 small GTPase mediated signal transduction Yes
GO:0065007 biological regulation No
GO:0030695 GTPase regulator activity No
GO:0098772 molecular function regulator activity No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0050789 regulation of biological process No
GO:0035556 intracellular signal transduction No
GO:0007165 signal transduction No
GO:0050794 regulation of cellular process No
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0030234 enzyme regulator activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|830
MNGSISPAPSGPTGLYVRALFDYHADDGTSLSFQHGDIIEVVTRLESGWWDGIINGVRGWFPSNYCELVSAPDDS
AAKEFSAPAVDDSRDSAQTNNSVQDNLDQDEGLEASRLNSLPIEGTDTEDYQSGTDFWIPQATSDGRLYYFNTMT
GDRRAELPMESPVSSAETGPRDRNNFKVPDKSRPPIELMASGFTQDEDDKSTTSVSEAEDEALTRSFKGYTKPRH
RTSLSAALSPSASMDSMNGSSPGRRARKDVLSNGRSSGGKPPNNMASATAFTSTTYHLPTTATLPRSFFDDGATP
PLTWSLLVTNMKLAIDRYREAIANNNRSDFVARAEDISDHLRLLLAAGSGTTDNHSGQPSIISTNKALYPHFRDM
MSKFSKLVISSHIAASDWPSTESVQKCLQEADGVLHGVFSYVEVARQQRGEEIPRLFPGFVIGSSKGGSWQNNGL
GSQDPVAANFLEDDDSANEPTATLDAVLLESLAERRRAMISSTRELDRSLATPDGIITPYHHEAIGNSTCMAGSK
VMDSFKLWIAMIESIDLSYLSNILGTSNFDQYSMAKQGVYDAMSDLILGCQAVTGPLADEWSQVRGESLKSRLAY
VRQCARTLETTSSHMQYSLQLLSEEVQPIGVKQTPQSEDGRPGDAQSSRGRFWHGDGQHAERHNNNSTSAPAVPR
PPFVTAPTFMEGEPPTGSLRKGDYAKVKKIFGEDPSPQTSTQPDDTPDFLRLDYEDDVSWDTKTSPPTVRGGTLL
ALVEQLTRHDKLDSSFNTTFLLTYRSFTSGRELFELLVKRFGIQPPDGLIQSDYETWRDRKQKPIRFRVVNILKS
WFDSFWTEEFNDESKQLICDVFDFARDRVKSTDTPGSGPLMSVLTQRLQGKEAGARRMIQTLNQSTPSPIVPKNI
KKLKFLDIDSTEFARQLTIIESRLYGKIKAAECLNKTWQKKVASSEPDAAPNVKALILHSNQLTNWVAEMILGQM
DVKKRVVVIKHFVAIADKCRSLNNFSTLTSVISALGTAPIARLKRTWEQVPQRVQAVLETMRRLMASTKNFGEYR
ESLHVANPPCIPFFGVYLTDLTFIEDGIPSVIKKTNLINFAKRAKTAEVIRDIQQYQNVGYSLQSVPELQDYLLS
NMQAAGDVHEMYDKSLQIEPREREEEKIVRVLAESGFL*
Coding >OphauB2|830
ATGAACGGCAGCATAAGTCCGGCGCCGTCCGGCCCTACTGGTCTATATGTCCGCGCGCTATTTGACTACCATGCA
GACGATGGAACAAGCCTGAGCTTTCAGCATGGCGATATCATCGAAGTTGTGACTCGCCTCGAGAGCGGTTGGTGG
GATGGCATCATAAACGGAGTCCGCGGCTGGTTCCCGAGCAACTATTGCGAGCTCGTTTCTGCTCCTGATGATTCG
GCGGCCAAGGAATTCAGCGCCCCTGCGGTCGACGACAGTCGAGACAGCGCTCAGACCAACAATTCGGTCCAGGAC
AATCTCGATCAAGATGAGGGCTTGGAGGCTAGTAGGCTCAACAGCCTGCCAATTGAGGGTACCGACACTGAAGAC
TATCAGTCGGGCACCGATTTTTGGATTCCTCAAGCCACTTCGGACGGCCGCTTGTACTACTTCAACACTATGACG
GGCGACCGCAGAGCCGAGCTGCCCATGGAATCACCTGTTTCATCAGCAGAAACAGGTCCTCGCGACCGTAACAAT
TTCAAGGTGCCCGACAAAAGTCGCCCTCCTATCGAGCTCATGGCCAGTGGTTTTACCCAGGATGAGGACGACAAA
TCTACAACATCGGTTTCTGAAGCAGAGGATGAGGCATTAACGCGCTCATTCAAAGGTTACACGAAGCCTCGCCAT
CGTACTTCACTAAGCGCTGCTCTGTCTCCGTCGGCATCAATGGATTCGATGAACGGCTCTTCGCCCGGTCGGCGC
GCCAGAAAAGACGTCTTGTCTAACGGTAGATCGTCGGGCGGCAAGCCACCTAACAATATGGCTTCCGCCACCGCT
TTCACAAGCACGACATATCATCTCCCAACAACAGCAACTCTTCCTCGCTCGTTTTTTGACGATGGAGCAACGCCG
CCACTTACCTGGAGTTTACTCGTCACCAACATGAAACTTGCTATTGATCGATATCGCGAGGCTATTGCCAACAAC
AATCGCTCAGACTTTGTTGCCAGGGCCGAAGATATATCCGATCATCTACGTCTTCTTTTGGCCGCCGGGTCCGGT
ACCACTGATAATCATTCTGGACAACCTTCCATTATATCAACTAACAAGGCACTGTATCCTCACTTCCGCGACATG
ATGTCAAAATTCTCCAAGCTCGTCATATCTTCCCACATTGCCGCTTCAGACTGGCCTAGTACTGAATCCGTTCAG
AAATGCTTGCAGGAAGCTGACGGCGTCTTACATGGCGTTTTTAGCTATGTCGAGGTTGCCAGACAACAACGAGGC
GAGGAAATTCCCCGTCTTTTCCCTGGATTCGTAATTGGCAGCAGCAAAGGCGGAAGCTGGCAAAATAACGGCCTA
GGGTCGCAAGATCCCGTGGCGGCAAACTTTTTGGAGGATGACGACAGCGCCAATGAGCCCACTGCCACCTTGGAC
GCCGTATTACTTGAAAGTCTTGCAGAGCGTCGACGCGCAATGATCTCGTCCACCAGGGAGCTTGACAGGAGCTTG
GCTACTCCTGATGGCATCATCACACCATATCATCACGAGGCAATCGGCAATTCTACCTGCATGGCTGGCTCCAAG
GTTATGGACAGTTTCAAGCTCTGGATCGCAATGATTGAATCGATTGATCTCTCATATTTAAGCAATATTCTGGGA
ACAAGCAACTTTGATCAGTACAGCATGGCTAAGCAAGGCGTTTACGATGCCATGTCGGATCTCATTCTCGGTTGT
CAGGCGGTTACTGGGCCTTTGGCAGATGAATGGAGTCAAGTACGGGGAGAAAGCTTGAAAAGTCGCCTCGCGTAC
GTGCGGCAATGTGCGCGAACCCTAGAAACAACCTCTTCACATATGCAATACTCGCTGCAGTTGCTATCGGAAGAA
GTACAGCCCATTGGGGTGAAGCAAACACCACAATCGGAAGATGGTCGACCTGGAGACGCCCAGTCGTCACGTGGA
CGCTTCTGGCATGGGGATGGGCAACACGCAGAAAGGCATAATAACAACTCGACGTCTGCACCAGCAGTTCCACGA
CCGCCATTTGTCACAGCACCGACTTTTATGGAGGGCGAGCCTCCGACGGGCAGCTTGCGCAAGGGTGATTATGCC
AAAGTCAAAAAGATATTTGGAGAGGACCCGTCGCCACAAACCAGCACGCAGCCCGACGATACGCCTGATTTTCTC
AGGCTCGATTACGAAGATGACGTGTCTTGGGATACCAAGACGTCACCTCCTACTGTCAGGGGCGGCACACTGCTG
GCGCTTGTTGAGCAACTCACCCGGCATGACAAGCTTGACTCAAGTTTCAATACCACTTTTCTTCTCACGTACCGT
TCCTTCACTTCTGGGCGTGAGCTGTTTGAGTTATTGGTAAAGCGTTTTGGAATCCAGCCACCTGATGGCTTGATA
CAGTCAGACTACGAGACATGGAGGGATCGCAAGCAAAAGCCGATACGATTTCGCGTGGTGAATATATTGAAGAGC
TGGTTCGATAGTTTTTGGACTGAAGAGTTCAACGATGAGTCGAAGCAGCTCATCTGTGACGTTTTTGACTTTGCC
CGGGACAGGGTCAAATCTACGGATACGCCTGGCTCTGGTCCTTTGATGTCGGTCCTTACCCAGAGACTCCAAGGA
AAGGAGGCGGGAGCACGGCGGATGATTCAAACACTCAACCAGAGCACACCATCTCCCATTGTCCCCAAGAACATC
AAGAAGCTCAAATTTCTTGATATCGACTCTACCGAGTTTGCCAGACAGTTGACCATTATCGAATCACGCTTGTAT
GGAAAGATCAAGGCGGCCGAGTGTCTCAATAAGACGTGGCAGAAAAAAGTGGCGAGCAGCGAGCCAGATGCTGCA
CCCAATGTCAAGGCCTTGATTCTGCACTCAAACCAGCTGACCAATTGGGTTGCGGAGATGATATTGGGCCAGATG
GACGTCAAGAAGCGTGTTGTCGTCATTAAACACTTTGTTGCCATTGCTGATAAATGTCGAAGTCTTAACAATTTT
TCGACGCTCACATCGGTAATATCGGCGCTGGGCACGGCCCCAATAGCCCGCCTTAAGAGGACGTGGGAACAGGTG
CCGCAACGAGTGCAGGCTGTTTTGGAGACGATGCGGCGTCTTATGGCCAGCACCAAGAATTTTGGAGAATATCGC
GAGTCGCTCCATGTTGCTAACCCGCCGTGCATACCATTTTTCGGCGTATATCTCACCGACTTGACGTTTATAGAA
GACGGCATCCCATCCGTCATCAAGAAGACCAACTTGATCAACTTTGCAAAGCGGGCAAAGACGGCAGAAGTGATT
CGTGATATTCAACAGTACCAGAACGTGGGCTATTCGCTGCAATCGGTACCAGAGCTGCAGGACTACTTGTTGAGC
AACATGCAGGCCGCGGGGGATGTGCACGAAATGTACGACAAGAGCTTACAAATTGAGCCGCGAGAGCGCGAGGAA
GAAAAGATTGTCAGGGTTCTGGCCGAGTCGGGCTTCCTCTAA
Transcript >OphauB2|830
ATGAACGGCAGCATAAGTCCGGCGCCGTCCGGCCCTACTGGTCTATATGTCCGCGCGCTATTTGACTACCATGCA
GACGATGGAACAAGCCTGAGCTTTCAGCATGGCGATATCATCGAAGTTGTGACTCGCCTCGAGAGCGGTTGGTGG
GATGGCATCATAAACGGAGTCCGCGGCTGGTTCCCGAGCAACTATTGCGAGCTCGTTTCTGCTCCTGATGATTCG
GCGGCCAAGGAATTCAGCGCCCCTGCGGTCGACGACAGTCGAGACAGCGCTCAGACCAACAATTCGGTCCAGGAC
AATCTCGATCAAGATGAGGGCTTGGAGGCTAGTAGGCTCAACAGCCTGCCAATTGAGGGTACCGACACTGAAGAC
TATCAGTCGGGCACCGATTTTTGGATTCCTCAAGCCACTTCGGACGGCCGCTTGTACTACTTCAACACTATGACG
GGCGACCGCAGAGCCGAGCTGCCCATGGAATCACCTGTTTCATCAGCAGAAACAGGTCCTCGCGACCGTAACAAT
TTCAAGGTGCCCGACAAAAGTCGCCCTCCTATCGAGCTCATGGCCAGTGGTTTTACCCAGGATGAGGACGACAAA
TCTACAACATCGGTTTCTGAAGCAGAGGATGAGGCATTAACGCGCTCATTCAAAGGTTACACGAAGCCTCGCCAT
CGTACTTCACTAAGCGCTGCTCTGTCTCCGTCGGCATCAATGGATTCGATGAACGGCTCTTCGCCCGGTCGGCGC
GCCAGAAAAGACGTCTTGTCTAACGGTAGATCGTCGGGCGGCAAGCCACCTAACAATATGGCTTCCGCCACCGCT
TTCACAAGCACGACATATCATCTCCCAACAACAGCAACTCTTCCTCGCTCGTTTTTTGACGATGGAGCAACGCCG
CCACTTACCTGGAGTTTACTCGTCACCAACATGAAACTTGCTATTGATCGATATCGCGAGGCTATTGCCAACAAC
AATCGCTCAGACTTTGTTGCCAGGGCCGAAGATATATCCGATCATCTACGTCTTCTTTTGGCCGCCGGGTCCGGT
ACCACTGATAATCATTCTGGACAACCTTCCATTATATCAACTAACAAGGCACTGTATCCTCACTTCCGCGACATG
ATGTCAAAATTCTCCAAGCTCGTCATATCTTCCCACATTGCCGCTTCAGACTGGCCTAGTACTGAATCCGTTCAG
AAATGCTTGCAGGAAGCTGACGGCGTCTTACATGGCGTTTTTAGCTATGTCGAGGTTGCCAGACAACAACGAGGC
GAGGAAATTCCCCGTCTTTTCCCTGGATTCGTAATTGGCAGCAGCAAAGGCGGAAGCTGGCAAAATAACGGCCTA
GGGTCGCAAGATCCCGTGGCGGCAAACTTTTTGGAGGATGACGACAGCGCCAATGAGCCCACTGCCACCTTGGAC
GCCGTATTACTTGAAAGTCTTGCAGAGCGTCGACGCGCAATGATCTCGTCCACCAGGGAGCTTGACAGGAGCTTG
GCTACTCCTGATGGCATCATCACACCATATCATCACGAGGCAATCGGCAATTCTACCTGCATGGCTGGCTCCAAG
GTTATGGACAGTTTCAAGCTCTGGATCGCAATGATTGAATCGATTGATCTCTCATATTTAAGCAATATTCTGGGA
ACAAGCAACTTTGATCAGTACAGCATGGCTAAGCAAGGCGTTTACGATGCCATGTCGGATCTCATTCTCGGTTGT
CAGGCGGTTACTGGGCCTTTGGCAGATGAATGGAGTCAAGTACGGGGAGAAAGCTTGAAAAGTCGCCTCGCGTAC
GTGCGGCAATGTGCGCGAACCCTAGAAACAACCTCTTCACATATGCAATACTCGCTGCAGTTGCTATCGGAAGAA
GTACAGCCCATTGGGGTGAAGCAAACACCACAATCGGAAGATGGTCGACCTGGAGACGCCCAGTCGTCACGTGGA
CGCTTCTGGCATGGGGATGGGCAACACGCAGAAAGGCATAATAACAACTCGACGTCTGCACCAGCAGTTCCACGA
CCGCCATTTGTCACAGCACCGACTTTTATGGAGGGCGAGCCTCCGACGGGCAGCTTGCGCAAGGGTGATTATGCC
AAAGTCAAAAAGATATTTGGAGAGGACCCGTCGCCACAAACCAGCACGCAGCCCGACGATACGCCTGATTTTCTC
AGGCTCGATTACGAAGATGACGTGTCTTGGGATACCAAGACGTCACCTCCTACTGTCAGGGGCGGCACACTGCTG
GCGCTTGTTGAGCAACTCACCCGGCATGACAAGCTTGACTCAAGTTTCAATACCACTTTTCTTCTCACGTACCGT
TCCTTCACTTCTGGGCGTGAGCTGTTTGAGTTATTGGTAAAGCGTTTTGGAATCCAGCCACCTGATGGCTTGATA
CAGTCAGACTACGAGACATGGAGGGATCGCAAGCAAAAGCCGATACGATTTCGCGTGGTGAATATATTGAAGAGC
TGGTTCGATAGTTTTTGGACTGAAGAGTTCAACGATGAGTCGAAGCAGCTCATCTGTGACGTTTTTGACTTTGCC
CGGGACAGGGTCAAATCTACGGATACGCCTGGCTCTGGTCCTTTGATGTCGGTCCTTACCCAGAGACTCCAAGGA
AAGGAGGCGGGAGCACGGCGGATGATTCAAACACTCAACCAGAGCACACCATCTCCCATTGTCCCCAAGAACATC
AAGAAGCTCAAATTTCTTGATATCGACTCTACCGAGTTTGCCAGACAGTTGACCATTATCGAATCACGCTTGTAT
GGAAAGATCAAGGCGGCCGAGTGTCTCAATAAGACGTGGCAGAAAAAAGTGGCGAGCAGCGAGCCAGATGCTGCA
CCCAATGTCAAGGCCTTGATTCTGCACTCAAACCAGCTGACCAATTGGGTTGCGGAGATGATATTGGGCCAGATG
GACGTCAAGAAGCGTGTTGTCGTCATTAAACACTTTGTTGCCATTGCTGATAAATGTCGAAGTCTTAACAATTTT
TCGACGCTCACATCGGTAATATCGGCGCTGGGCACGGCCCCAATAGCCCGCCTTAAGAGGACGTGGGAACAGGTG
CCGCAACGAGTGCAGGCTGTTTTGGAGACGATGCGGCGTCTTATGGCCAGCACCAAGAATTTTGGAGAATATCGC
GAGTCGCTCCATGTTGCTAACCCGCCGTGCATACCATTTTTCGGCGTATATCTCACCGACTTGACGTTTATAGAA
GACGGCATCCCATCCGTCATCAAGAAGACCAACTTGATCAACTTTGCAAAGCGGGCAAAGACGGCAGAAGTGATT
CGTGATATTCAACAGTACCAGAACGTGGGCTATTCGCTGCAATCGGTACCAGAGCTGCAGGACTACTTGTTGAGC
AACATGCAGGCCGCGGGGGATGTGCACGAAATGTACGACAAGAGCTTACAAATTGAGCCGCGAGAGCGCGAGGAA
GAAAAGATTGTCAGGGTTCTGGCCGAGTCGGGCTTCCTCTAA
Gene >OphauB2|830
ATGAACGGCAGCATAAGTCCGGCGCCGTCCGGCCCTACTGGTCTATATGTCCGCGCGCTATTTGACTACCATGCA
GACGATGGAACAAGCCTGAGCTTTCAGCATGGCGATATCATCGAAGTTGTGACTCGCCTCGAGAGCGGTTGGTGG
GATGGCATCATAAACGGAGTCCGCGGCTGGTTCCCGAGCAACTATTGCGAGCTCGTTTCTGCTCCTGATGATTCG
GCGGCCAAGGAATTCAGCGCCCCTGCGGTCGACGACAGTCGAGACAGCGCTCAGACCAACAATTCGGTCCAGGAC
AATCTCGATCAAGATGAGGGCTTGGAGGCTAGTAGGCTCAACAGCCTGCCAATTGAGGGTACCGACACTGAAGAC
TATCAGTCGGGCACCGATTTTTGGATTCCTCAAGCCACTTCGGACGGCCGCTTGTACTACTTCAACACTATGACG
GGCGACCGCAGAGCCGAGCTGCCCATGGAATCACCTGTTTCATCAGCAGAAACAGGTCCTCGCGACCGTAACAAT
TTCAAGGTGCCCGACAAAAGTCGCCCTCCTATCGAGCTCATGGCCAGTGGTTTTACCCAGGATGAGGACGACAAA
TCTACAACATCGGTTTCTGAAGCAGAGGATGAGGCATTAACGCGCTCATTCAAAGGTTACACGGTGCGTCTTGCC
CCCTCCCCCTGCATCTTATTTCTCTATTACTTTGTCTCACCTCCCCTCCTTTTTTTTATGTATTTTTTTTTGTAT
ATGAGAAATCAAGTCTGATCAGCCCCTCTGAGAAGCCTCGCCATCGTACTTCACTAAGCGCTGCTCTGTCTCCGT
CGGCATCAATGGATTCGATGAACGGCTCTTCGCCCGGTCGGCGCGCCAGAAAAGACGTCTTGTCTAACGGTAGAT
CGTCGGGCGGCAAGCCACCTAACAATATGGCTTCCGCCACCGCTTTCACAAGCACGACATATCATCTCCCAACAA
CAGCAACTCTTCCTCGCTCGTTTTTTGACGATGGAGCAACGCCGCCACTTACCTGGAGTTTACTCGTCACCAACA
TGAAACTTGCTATTGATCGATATCGCGAGGCTATTGCCAACAACAATCGCTCAGACTTTGTTGCCAGGGCCGAAG
ATATATCCGATCATCTACGTCTTCTTTTGGCCGCCGGGTCCGGTACCACTGATAATCATTCTGGACAACCTTCCA
TTATATCAACTAACAAGGCACTGTATCCTCACTTCCGCGACATGATGTCAAAATTCTCCAAGCTCGTCATATCTT
CCCACATTGCCGCTTCAGACTGGCCTAGTACTGAATCCGTTCAGAAATGCTTGCAGGAAGCTGACGGCGTCTTAC
ATGGCGTTTTTAGCTATGTCGAGGTTGCCAGACAACAACGAGGCGAGGAAATTCCCCGTCTTTTCCCTGGATTCG
TAATTGGCAGCAGCAAAGGCGGAAGCTGGCAAAATAACGGCCTAGGGTCGCAAGATCCCGTGGCGGCAAACTTTT
TGGAGGATGACGACAGCGCCAATGAGCCCACTGCCACCTTGGACGCCGTATTACTTGAAAGTCTTGCAGAGCGTC
GACGCGCAATGATCTCGTCCACCAGGGAGCTTGACAGGAGCTTGGCTACTCCTGATGGCATCATCACACCATATC
ATCACGAGGCAATCGGCAATTCTACCTGCATGGCTGGCTCCAAGGTTATGGACAGTTTCAAGCTCTGGATCGCAA
TGATTGAATCGATTGATCTCTCATATTTAAGCAATATTCTGGGAACAAGCAACTTTGATCAGTACAGCATGGCTA
AGCAAGGCGTTTACGATGCCATGTCGGATCTCATTCTCGGTTGTCAGGCGGTTACTGGGCCTTTGGCAGATGAAT
GGAGTCAAGTACGGGGAGAAAGCTTGAAAAGTCGCCTCGCGTACGTGCGGCAATGTGCGCGAACCCTAGAAACAA
CCTCTTCACATATGCAATACTCGCTGCAGTTGCTATCGGAAGAAGTACAGCCCATTGGGGTGAAGCAAACACCAC
AATCGGAAGATGGTCGACCTGGAGACGCCCAGTCGTCACGTGGACGCTTCTGGCATGGGGATGGGCAACACGCAG
AAAGGCATAATAACAACTCGACGTCTGCACCAGCAGTTCCACGACCGCCATTTGTCACAGCACCGACTTTTATGG
AGGGCGAGCCTCCGACGGGCAGCTTGCGCAAGGGTGATTATGCCAAAGTCAAAAAGATATTTGGAGAGGACCCGT
CGCCACAAACCAGCACGCAGCCCGACGATACGCCTGATTTTCTCAGGCTCGATTACGAAGATGACGTGTCTTGGG
ATACCAAGACGTCACCTCCTACTGTCAGGGGCGGCACACTGCTGGCGCTTGTTGAGCAACTCACCCGGCATGACA
AGCTTGACTCAAGTTTCAATACCACTTTTCTTCTCACGTACCGTTCCTTCACTTCTGGGCGTGAGCTGTTTGAGT
TATTGGTAAAGCGTTTTGGAATCCAGCCACCTGATGGCTTGATACAGTCAGACTACGAGACATGGAGGGATCGCA
AGCAAAAGCCGATACGATTTCGCGTGGTGAATATATTGAAGAGCTGGTTCGATAGTTTTTGGACTGAAGAGTTCA
ACGATGAGTCGAAGCAGCTCATCTGTGACGTTTTTGACTTTGCCCGGGACAGGGTCAAATCTACGGATACGCCTG
GCTCTGGTCCTTTGATGTCGGTCCTTACCCAGAGACTCCAAGGAAAGGAGGCGGGAGCACGGCGGATGATTCAAA
CACTCAACCAGAGCACACCATCTCCCATTGTCCCCAAGAACATCAAGAAGCTCAAATTTCTTGATATCGACTCTA
CCGAGTTTGCCAGACAGTTGACCATTATCGAATCACGCTTGTATGGAAAGATCAAGGCGGCCGAGTGTCTCAATA
AGACGTGGCAGAAAAAAGTGGCGAGCAGCGAGCCAGATGCTGCACCCAATGTCAAGGCCTTGATTCTGCACTCAA
ACCAGCTGACCAATTGGGTTGCGGAGATGATATTGGGCCAGATGGACGTCAAGAAGCGTGTTGTCGTCATTAAAC
ACTTTGTTGCCATTGCTGATGTACGTTTTTGTACCCTTTTGGACTTTGCGAGATTTCTTTGTGCTCATTGGCGAT
TGAACAGAAATGTCGAAGTCTTAACAATTTTTCGACGCTCACATCGGTAATATCGGCGCTGGGCACGGCCCCAAT
AGCCCGCCTTAAGAGGACGTGGGAACAGGTGCCGCAACGAGTGCAGGCTGTTTTGGAGACGATGCGGCGTCTTAT
GGCCAGCACCAAGAATTTTGGAGAATATCGCGAGTCGCTCCATGTTGCTAACCCGCCGTGCATACCATTTTTCGG
TAAATGACCAGTGTGAAGAATCGTCAAGGGTGCAAAGGCTGACTTGCTCGTACACTAGGCGTATATCTCACCGAC
TTGACGTTTATAGAAGACGGCATCCCATCCGTCATCAAGAAGACCAACTTGATCAACTTTGCAAAGCGGGCAAAG
ACGGCAGAAGTGATTCGTGATATTCAACAGTACCAGAACGTGGGCTATTCGCTGCAATCGGTACCAGAGCTGCAG
GACTACTTGTTGAGCAACATGCAGGCCGCGGGGGATGTGCACGAAATGTACGACAAGAGCTTACAAATTGAGCCG
CGAGAGCGCGAGGAAGAAAAGATTGTCAGGTACGTAGCCTTGCGGGATCAGTCGGTGTCCAAGAGCGCGGCACCG
CCTGATTGATAATGGAGAGACCGAGGCTCGTCCCGTCCGCTGAGGACGCACTTTGAACAAGCTCGGAAGCTTACT
TGGGTTTCGTCCCAGGGTTCTGGCCGAGTCGGGCTTCCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail