Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|830
Gene name
LocationContig_118:50557..54425
Strand+
Gene length (bp)3868
Transcript length (bp)3492
Coding sequence length (bp)3492
Protein length (aa) 1164

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00617 RasGEF RasGEF domain 5.9E-58 912 1093
PF00618 RasGEF_N RasGEF N-terminal motif 3.7E-28 744 842
PF00018 SH3_1 SH3 domain 4.2E-13 18 63
PF07653 SH3_2 Variant SH3 domain 1.5E-12 16 68
PF14604 SH3_9 Variant SH3 domain 8.0E-12 19 65

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P43069|CDC25_CANAL Cell division control protein 25 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC25 PE=3 SV=1 720 1148 2.0E-90
sp|Q02342|CDC25_LACKL Cell division control protein 25 (Fragment) OS=Lachancea kluyveri GN=CDC25 PE=3 SV=1 720 1146 6.0E-88
sp|P04821|CDC25_YEAST Cell division control protein 25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC25 PE=1 SV=1 720 1146 2.0E-85
sp|C8ZCV7|SDC25_YEAS8 Guanine nucleotide exchange factor SDC25 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=SDC25 PE=3 SV=1 722 1150 9.0E-66
sp|P0CF34|YL016_YEAST Putative truncated guanine nucleotide exchange factor SDC25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDC25 PE=5 SV=1 722 1150 2.0E-65
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P43069|CDC25_CANAL Cell division control protein 25 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC25 PE=3 SV=1 720 1148 2.0E-90
sp|Q02342|CDC25_LACKL Cell division control protein 25 (Fragment) OS=Lachancea kluyveri GN=CDC25 PE=3 SV=1 720 1146 6.0E-88
sp|P04821|CDC25_YEAST Cell division control protein 25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC25 PE=1 SV=1 720 1146 2.0E-85
sp|C8ZCV7|SDC25_YEAS8 Guanine nucleotide exchange factor SDC25 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=SDC25 PE=3 SV=1 722 1150 9.0E-66
sp|P0CF34|YL016_YEAST Putative truncated guanine nucleotide exchange factor SDC25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDC25 PE=5 SV=1 722 1150 2.0E-65
sp|P0CF32|SDC25_YEASX Guanine nucleotide exchange factor SDC25 OS=Saccharomyces cerevisiae GN=SDC25 PE=3 SV=1 722 1150 2.0E-65
sp|A7A0P0|SDC25_YEAS7 Guanine nucleotide exchange factor SDC25 OS=Saccharomyces cerevisiae (strain YJM789) GN=SDC25 PE=3 SV=2 722 1150 2.0E-64
sp|B3LTF3|SDC25_YEAS1 Guanine nucleotide exchange factor SDC25 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SDC25 PE=3 SV=1 722 1150 2.0E-64
sp|B5VMS9|SDC25_YEAS6 Guanine nucleotide exchange factor SDC25 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=SDC25 PE=3 SV=1 722 1150 2.0E-64
sp|Q8IS14|GEFJ_DICDI Ras guanine nucleotide exchange factor J OS=Dictyostelium discoideum GN=gefJ PE=2 SV=1 738 1154 4.0E-64
sp|Q8IS15|GEFI_DICDI Ras guanine nucleotide exchange factor I OS=Dictyostelium discoideum GN=gefI PE=2 SV=1 733 1154 1.0E-62
sp|Q9USU1|EFC25_SCHPO Ras guanine nucleotide exchange factor efc25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=efc25 PE=1 SV=1 371 1146 1.0E-61
sp|Q62245|SOS1_MOUSE Son of sevenless homolog 1 OS=Mus musculus GN=Sos1 PE=1 SV=2 724 1146 2.0E-60
sp|Q07889|SOS1_HUMAN Son of sevenless homolog 1 OS=Homo sapiens GN=SOS1 PE=1 SV=1 720 1146 2.0E-59
sp|P26675|SOS_DROME Protein son of sevenless OS=Drosophila melanogaster GN=Sos PE=1 SV=2 742 1146 2.0E-59
sp|Q54PQ4|GEFA_DICDI Ras guanine nucleotide exchange factor A OS=Dictyostelium discoideum GN=gefA PE=2 SV=1 743 1147 5.0E-58
sp|Q07890|SOS2_HUMAN Son of sevenless homolog 2 OS=Homo sapiens GN=SOS2 PE=1 SV=2 724 1146 2.0E-57
sp|Q02384|SOS2_MOUSE Son of sevenless homolog 2 OS=Mus musculus GN=Sos2 PE=1 SV=2 721 1146 2.0E-57
sp|P26674|STE6_SCHPO Protein ste6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ste6 PE=3 SV=1 744 1161 3.0E-52
sp|Q8IS18|GEFE_DICDI Ras guanine nucleotide exchange factor E OS=Dictyostelium discoideum GN=gefE PE=2 SV=1 809 1149 4.0E-51
sp|Q55GH9|GEFW_DICDI Ras guanine nucleotide exchange factor W OS=Dictyostelium discoideum GN=gefW PE=2 SV=1 697 1111 8.0E-51
sp|Q8SSQ0|GEFR_DICDI Ras guanine nucleotide exchange factor R OS=Dictyostelium discoideum GN=gefR PE=1 SV=1 728 1147 7.0E-49
sp|Q552M5|GEFY_DICDI Ras guanine nucleotide exchange factor Y OS=Dictyostelium discoideum GN=gefY PE=1 SV=2 744 1145 2.0E-48
sp|Q54TK8|GEFP_DICDI Ras guanine nucleotide exchange factor P OS=Dictyostelium discoideum GN=gefP PE=2 SV=1 730 1147 4.0E-46
sp|A2CEA7|RGRF2_DANRE Ras-specific guanine nucleotide-releasing factor 2 OS=Danio rerio GN=rasgrf2 PE=3 SV=1 818 1146 5.0E-44
sp|Q13972|RGRF1_HUMAN Ras-specific guanine nucleotide-releasing factor 1 OS=Homo sapiens GN=RASGRF1 PE=1 SV=2 818 1146 1.0E-42
sp|Q54FF3|GEFK_DICDI Ras guanine nucleotide exchange factor K OS=Dictyostelium discoideum GN=gefK PE=2 SV=1 897 1146 1.0E-40
sp|Q8SSQ3|GEFM_DICDI Ras guanine nucleotide exchange factor M OS=Dictyostelium discoideum GN=gefM PE=2 SV=1 895 1123 2.0E-40
sp|P70392|RGRF2_MOUSE Ras-specific guanine nucleotide-releasing factor 2 OS=Mus musculus GN=Rasgrf2 PE=1 SV=2 818 1146 5.0E-40
sp|Q99JE4|RGRF2_RAT Ras-specific guanine nucleotide-releasing factor 2 OS=Rattus norvegicus GN=Rasgrf2 PE=1 SV=1 818 1146 6.0E-40
sp|O14827|RGRF2_HUMAN Ras-specific guanine nucleotide-releasing factor 2 OS=Homo sapiens GN=RASGRF2 PE=1 SV=2 818 1146 2.0E-39
sp|P27671|RGRF1_MOUSE Ras-specific guanine nucleotide-releasing factor 1 OS=Mus musculus GN=Rasgrf1 PE=1 SV=2 818 1146 3.0E-39
sp|P28818|RGRF1_RAT Ras-specific guanine nucleotide-releasing factor 1 OS=Rattus norvegicus GN=Rasgrf1 PE=1 SV=1 818 1146 2.0E-38
sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 740 1146 1.0E-37
sp|Q8ST25|GEFG_DICDI Ras guanine nucleotide exchange factor G OS=Dictyostelium discoideum GN=gefG PE=2 SV=1 771 1154 4.0E-37
sp|Q55FD8|GEFV_DICDI Ras guanine nucleotide exchange factor V OS=Dictyostelium discoideum GN=gefV PE=2 SV=1 714 1153 2.0E-36
sp|Q86G47|GEFQ_DICDI Ras guanine nucleotide exchange factor Q OS=Dictyostelium discoideum GN=gefQ PE=2 SV=1 888 1148 2.0E-36
sp|Q8IS20|GEFC_DICDI Ras guanine nucleotide exchange factor C OS=Dictyostelium discoideum GN=gefC PE=2 SV=1 894 1125 1.0E-35
sp|Q8SSW7|GEFS_DICDI Ras guanine nucleotide exchange factor S OS=Dictyostelium discoideum GN=gefS PE=2 SV=1 735 1146 3.0E-34
sp|Q8IS16|GEFH_DICDI Ras guanine nucleotide exchange factor H OS=Dictyostelium discoideum GN=gefH PE=2 SV=1 836 1123 1.0E-32
sp|Q9NZL6|RGL1_HUMAN Ral guanine nucleotide dissociation stimulator-like 1 OS=Homo sapiens GN=RGL1 PE=1 SV=1 743 1144 2.0E-32
sp|Q6P112|RGL1_DANRE Ral guanine nucleotide dissociation stimulator-like 1 OS=Danio rerio GN=rgl1 PE=2 SV=1 743 1144 1.0E-31
sp|Q13905|RPGF1_HUMAN Rap guanine nucleotide exchange factor 1 OS=Homo sapiens GN=RAPGEF1 PE=1 SV=3 742 1146 1.0E-31
sp|Q60695|RGL1_MOUSE Ral guanine nucleotide dissociation stimulator-like 1 OS=Mus musculus GN=Rgl1 PE=1 SV=2 743 1144 2.0E-31
sp|B0UXH6|RGPS1_DANRE Ras-specific guanine nucleotide-releasing factor RalGPS1 OS=Danio rerio GN=ralgps1 PE=2 SV=1 905 1145 2.0E-30
sp|O77086|C3G_DROME Guanine nucleotide-releasing factor 2 OS=Drosophila melanogaster GN=C3G PE=1 SV=4 742 1148 7.0E-30
sp|Q8IS21|GEFB_DICDI Ras guanine nucleotide exchange factor B OS=Dictyostelium discoideum GN=gefB PE=2 SV=1 910 1146 1.0E-29
sp|Q5ZJK0|RGPS1_CHICK Ras-specific guanine nucleotide-releasing factor RalGPS1 OS=Gallus gallus GN=RALGPS1 PE=2 SV=1 906 1145 2.0E-29
sp|Q4R7W3|RGPS2_MACFA Ras-specific guanine nucleotide-releasing factor RalGPS2 OS=Macaca fascicularis GN=RALGPS2 PE=2 SV=1 906 1145 2.0E-28
sp|Q86X27|RGPS2_HUMAN Ras-specific guanine nucleotide-releasing factor RalGPS2 OS=Homo sapiens GN=RALGPS2 PE=1 SV=1 906 1145 3.0E-28
sp|Q9ERD6|RGPS2_MOUSE Ras-specific guanine nucleotide-releasing factor RalGPS2 OS=Mus musculus GN=Ralgps2 PE=1 SV=2 906 1145 3.0E-28
sp|F1MSG6|RPGF2_BOVIN Rap guanine nucleotide exchange factor 2 OS=Bos taurus GN=RAPGEF2 PE=1 SV=2 902 1109 4.0E-28
sp|Q55EC7|GEFX_DICDI RasGEF domain-containing serine/threonine-protein kinase X OS=Dictyostelium discoideum GN=gefX PE=2 SV=1 897 1145 4.0E-28
sp|F1PBJ0|RPGF2_CANLF Rap guanine nucleotide exchange factor 2 OS=Canis lupus familiaris GN=RAPGEF2 PE=1 SV=2 902 1109 4.0E-28
sp|F1M386|RPGF2_RAT Rap guanine nucleotide exchange factor 2 OS=Rattus norvegicus GN=Rapgef2 PE=1 SV=2 902 1109 8.0E-28
sp|Q8CHG7|RPGF2_MOUSE Rap guanine nucleotide exchange factor 2 OS=Mus musculus GN=Rapgef2 PE=1 SV=2 902 1109 9.0E-28
sp|Q9Y4G8|RPGF2_HUMAN Rap guanine nucleotide exchange factor 2 OS=Homo sapiens GN=RAPGEF2 PE=1 SV=1 902 1109 1.0E-27
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 723 1123 3.0E-27
sp|Q5JS13|RGPS1_HUMAN Ras-specific guanine nucleotide-releasing factor RalGPS1 OS=Homo sapiens GN=RALGPS1 PE=1 SV=1 906 1145 4.0E-27
sp|Q8IS11|GEFO_DICDI Ras guanine nucleotide exchange factor O OS=Dictyostelium discoideum GN=gefO PE=2 SV=1 901 1123 4.0E-27
sp|Q3UYI5|RGL3_MOUSE Ral guanine nucleotide dissociation stimulator-like 3 OS=Mus musculus GN=Rgl3 PE=1 SV=2 904 1145 5.0E-27
sp|A2AR50|RGPS1_MOUSE Ras-specific guanine nucleotide-releasing factor RalGPS1 OS=Mus musculus GN=Ralgps1 PE=1 SV=2 906 1145 1.0E-26
sp|O15211|RGL2_HUMAN Ral guanine nucleotide dissociation stimulator-like 2 OS=Homo sapiens GN=RGL2 PE=1 SV=1 744 1157 2.0E-25
sp|Q54S40|GBPD_DICDI Cyclic GMP-binding protein D OS=Dictyostelium discoideum GN=gbpD PE=2 SV=1 914 1160 4.0E-25
sp|Q3MIN7|RGL3_HUMAN Ral guanine nucleotide dissociation stimulator-like 3 OS=Homo sapiens GN=RGL3 PE=1 SV=2 904 1145 1.0E-24
sp|Q03386|GNDS_RAT Ral guanine nucleotide dissociation stimulator OS=Rattus norvegicus GN=Ralgds PE=1 SV=1 914 1145 2.0E-24
sp|Q8IZJ4|RGDSR_HUMAN Ral-GDS-related protein OS=Homo sapiens GN=RGL4 PE=2 SV=1 913 1145 3.0E-24
sp|Q8IS12|GEFN_DICDI Ras guanine nucleotide exchange factor N OS=Dictyostelium discoideum GN=gefN PE=2 SV=1 732 1123 4.0E-24
sp|Q61193|RGL2_MOUSE Ral guanine nucleotide dissociation stimulator-like 2 OS=Mus musculus GN=Rgl2 PE=1 SV=2 744 1145 8.0E-24
sp|Q5TJE5|RGL2_CANLF Ral guanine nucleotide dissociation stimulator-like 2 OS=Canis lupus familiaris GN=RGL2 PE=3 SV=1 739 1157 2.0E-23
sp|Q12967|GNDS_HUMAN Ral guanine nucleotide dissociation stimulator OS=Homo sapiens GN=RALGDS PE=1 SV=2 884 1145 2.0E-23
sp|Q32N25|GRP2A_XENLA RAS guanyl-releasing protein 2-A OS=Xenopus laevis GN=rasgrp2-a PE=2 SV=1 903 1148 3.0E-23
sp|Q92565|RPGF5_HUMAN Rap guanine nucleotide exchange factor 5 OS=Homo sapiens GN=RAPGEF5 PE=1 SV=1 901 1146 5.0E-23
sp|Q8TEU7|RPGF6_HUMAN Rap guanine nucleotide exchange factor 6 OS=Homo sapiens GN=RAPGEF6 PE=1 SV=2 902 1103 6.0E-23
sp|Q03385|GNDS_MOUSE Ral guanine nucleotide dissociation stimulator OS=Mus musculus GN=Ralgds PE=1 SV=2 914 1118 1.0E-22
sp|P83900|RPGF5_RAT Rap guanine nucleotide exchange factor 5 OS=Rattus norvegicus GN=Rapgef5 PE=2 SV=1 901 1146 1.0E-22
sp|Q6DCK3|GRP2B_XENLA RAS guanyl-releasing protein 2-B OS=Xenopus laevis GN=rasgrp2-b PE=2 SV=1 903 1148 3.0E-22
sp|Q8C0Q9|RPGF5_MOUSE Rap guanine nucleotide exchange factor 5 OS=Mus musculus GN=Rapgef5 PE=2 SV=2 901 1146 5.0E-22
sp|Q6NTL4|GRP1_XENLA RAS guanyl-releasing protein 1 OS=Xenopus laevis GN=rasgrp1 PE=2 SV=1 782 1146 1.0E-21
sp|Q7LDG7|GRP2_HUMAN RAS guanyl-releasing protein 2 OS=Homo sapiens GN=RASGRP2 PE=1 SV=1 903 1146 2.0E-21
sp|Q9R1K8|GRP1_RAT RAS guanyl-releasing protein 1 OS=Rattus norvegicus GN=Rasgrp1 PE=1 SV=1 799 1146 2.0E-21
sp|A4IJ06|GRP1_XENTR RAS guanyl-releasing protein 1 OS=Xenopus tropicalis GN=rasgrp1 PE=2 SV=1 903 1146 3.0E-21
sp|G5EDB9|RPGF_CAEEL Rap guanine nucleotide exchange factor OS=Caenorhabditis elegans GN=pxf-1 PE=1 SV=1 888 1118 3.0E-21
sp|O95267|GRP1_HUMAN RAS guanyl-releasing protein 1 OS=Homo sapiens GN=RASGRP1 PE=1 SV=2 799 1146 5.0E-21
sp|A6N9I4|GRP2_BOVIN RAS guanyl-releasing protein 2 OS=Bos taurus GN=RASGRP2 PE=2 SV=1 893 1148 1.0E-20
sp|Q8IS19|GEFD_DICDI Ras guanine nucleotide exchange factor D OS=Dictyostelium discoideum GN=gefD PE=2 SV=1 907 1151 2.0E-20
sp|Q9Z1S3|GRP1_MOUSE RAS guanyl-releasing protein 1 OS=Mus musculus GN=Rasgrp1 PE=1 SV=1 799 1146 2.0E-20
sp|P0C643|GRP2_RAT RAS guanyl-releasing protein 2 OS=Rattus norvegicus GN=Rasgrp2 PE=1 SV=1 903 1146 3.0E-20
sp|Q5RC04|RGF1B_PONAB Ras-GEF domain-containing family member 1B OS=Pongo abelii GN=RASGEF1B PE=2 SV=2 746 1125 7.0E-20
sp|Q9QUG9|GRP2_MOUSE RAS guanyl-releasing protein 2 OS=Mus musculus GN=Rasgrp2 PE=1 SV=2 903 1146 9.0E-20
sp|Q0VAM2|RGF1B_HUMAN Ras-GEF domain-containing family member 1B OS=Homo sapiens GN=RASGEF1B PE=1 SV=2 746 1125 1.0E-19
sp|Q68EF8|RPGFL_MOUSE Rap guanine nucleotide exchange factor-like 1 OS=Mus musculus GN=Rapgefl1 PE=1 SV=2 908 1108 1.0E-19
sp|Q9UHV5|RPGFL_HUMAN Rap guanine nucleotide exchange factor-like 1 OS=Homo sapiens GN=RAPGEFL1 PE=1 SV=2 908 1108 2.0E-19
sp|Q8JZL7|RGF1B_MOUSE Ras-GEF domain-containing family member 1B OS=Mus musculus GN=Rasgef1b PE=1 SV=1 746 1125 3.0E-19
sp|Q5R9B2|RPGFL_PONPY Rap guanine nucleotide exchange factor-like 1 OS=Pongo pygmaeus GN=RAPGEFL1 PE=2 SV=1 908 1108 6.0E-19
sp|Q8IV61|GRP3_HUMAN Ras guanyl-releasing protein 3 OS=Homo sapiens GN=RASGRP3 PE=1 SV=1 749 1146 9.0E-19
sp|Q6DHR3|RG1BA_DANRE Ras-GEF domain-containing family member 1B-A OS=Danio rerio GN=rasgef1ba PE=2 SV=2 746 1125 1.0E-18
sp|Q8WZA2|RPGF4_HUMAN Rap guanine nucleotide exchange factor 4 OS=Homo sapiens GN=RAPGEF4 PE=1 SV=1 908 1108 1.0E-18
sp|Q9D300|RGF1C_MOUSE Ras-GEF domain-containing family member 1C OS=Mus musculus GN=Rasgef1c PE=2 SV=1 763 1152 1.0E-18
sp|A4IFE4|RGF1B_BOVIN Ras-GEF domain-containing family member 1B OS=Bos taurus GN=RASGEF1B PE=2 SV=1 746 1125 5.0E-18
sp|Q95KH6|RGF1C_MACFA Ras-GEF domain-containing family member 1C OS=Macaca fascicularis GN=RASGEF1C PE=2 SV=1 763 1123 6.0E-18
sp|Q8N431|RGF1C_HUMAN Ras-GEF domain-containing family member 1C OS=Homo sapiens GN=RASGEF1C PE=2 SV=2 763 1152 2.0E-17
sp|Q9EQZ6|RPGF4_MOUSE Rap guanine nucleotide exchange factor 4 OS=Mus musculus GN=Rapgef4 PE=1 SV=1 908 1108 2.0E-17
sp|Q9Z1C8|RPGF3_RAT Rap guanine nucleotide exchange factor 3 OS=Rattus norvegicus GN=Rapgef3 PE=2 SV=2 885 1108 6.0E-17
sp|Q9Z1C7|RPGF4_RAT Rap guanine nucleotide exchange factor 4 (Fragment) OS=Rattus norvegicus GN=Rapgef4 PE=2 SV=1 908 1108 7.0E-16
sp|Q8VCC8|RPGF3_MOUSE Rap guanine nucleotide exchange factor 3 OS=Mus musculus GN=Rapgef3 PE=1 SV=2 952 1108 8.0E-16
sp|O95398|RPGF3_HUMAN Rap guanine nucleotide exchange factor 3 OS=Homo sapiens GN=RAPGEF3 PE=1 SV=6 908 1092 3.0E-15
sp|A0JM95|RGF1A_XENTR Ras-GEF domain-containing family member 1A OS=Xenopus tropicalis GN=rasgef1a PE=2 SV=1 746 1125 7.0E-15
sp|Q28EC1|RGF1B_XENTR Ras-GEF domain-containing family member 1B OS=Xenopus tropicalis GN=rasgef1b PE=2 SV=1 746 1125 3.0E-14
sp|Q6CY10|LTE1_KLULA Guanine nucleotide exchange factor LTE1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LTE1 PE=3 SV=1 909 1105 4.0E-14
sp|Q6FT12|LTE1_CANGA Guanine nucleotide exchange factor LTE1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LTE1 PE=3 SV=1 905 1107 4.0E-14
sp|Q6DBW1|RG1BB_DANRE Ras-GEF domain-containing family member 1B-B OS=Danio rerio GN=rasgef1bb PE=2 SV=1 746 1125 7.0E-14
sp|P07866|LTE1_YEAST Guanine nucleotide exchange factor LTE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LTE1 PE=1 SV=2 905 1107 1.0E-13
sp|Q8MVR1|GBPC_DICDI Cyclic GMP-binding protein C OS=Dictyostelium discoideum GN=gbpC PE=1 SV=1 905 1161 1.0E-12
sp|Q8N9B8|RGF1A_HUMAN Ras-GEF domain-containing family member 1A OS=Homo sapiens GN=RASGEF1A PE=2 SV=2 746 1125 1.0E-12
sp|Q75BH9|LTE1_ASHGO Guanine nucleotide exchange factor LTE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LTE1 PE=3 SV=1 899 1107 2.0E-12
sp|P25300|BUD5_YEAST Bud site selection protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD5 PE=1 SV=2 906 1111 1.0E-10
sp|P34578|RPGF1_CAEEL Rap guanine nucleotide exchange factor 1 OS=Caenorhabditis elegans GN=epac-1 PE=3 SV=3 888 1154 1.0E-10
sp|A6QLK6|GRAP_BOVIN GRB2-related adapter protein OS=Bos taurus GN=GRAP PE=2 SV=1 7 69 3.0E-10
sp|Q8TDF6|GRP4_HUMAN RAS guanyl-releasing protein 4 OS=Homo sapiens GN=RASGRP4 PE=1 SV=2 893 1079 1.0E-09
sp|Q1LZ97|GRP4_BOVIN RAS guanyl-releasing protein 4 OS=Bos taurus GN=RASGRP4 PE=2 SV=1 893 1079 1.0E-09
sp|Q14155|ARHG7_HUMAN Rho guanine nucleotide exchange factor 7 OS=Homo sapiens GN=ARHGEF7 PE=1 SV=2 15 71 2.0E-09
sp|Q8R5I4|GRP4_RAT RAS guanyl-releasing protein 4 OS=Rattus norvegicus GN=Rasgrp4 PE=1 SV=1 903 1079 5.0E-09
sp|Q8BTM9|GRP4_MOUSE RAS guanyl-releasing protein 4 OS=Mus musculus GN=Rasgrp4 PE=1 SV=1 903 1079 7.0E-09
sp|O55043|ARHG7_RAT Rho guanine nucleotide exchange factor 7 OS=Rattus norvegicus GN=Arhgef7 PE=1 SV=1 15 65 8.0E-09
sp|Q9P212|PLCE1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Homo sapiens GN=PLCE1 PE=1 SV=3 933 1083 1.0E-08
sp|Q5ZLR6|ARHG6_CHICK Rho guanine nucleotide exchange factor 6 OS=Gallus gallus GN=ARHGEF6 PE=2 SV=1 10 116 1.0E-08
sp|Q9VU84|DBNL_DROME Drebrin-like protein OS=Drosophila melanogaster GN=Abp1 PE=1 SV=1 11 70 1.0E-08
sp|P62484|ABI2_MOUSE Abl interactor 2 OS=Mus musculus GN=Abi2 PE=1 SV=1 17 69 1.0E-08
sp|Q9NYB9|ABI2_HUMAN Abl interactor 2 OS=Homo sapiens GN=ABI2 PE=1 SV=1 17 69 1.0E-08
sp|Q9ES28|ARHG7_MOUSE Rho guanine nucleotide exchange factor 7 OS=Mus musculus GN=Arhgef7 PE=1 SV=2 15 65 1.0E-08
sp|P19706|MYSB_ACACA Myosin heavy chain IB OS=Acanthamoeba castellanii GN=MIB PE=1 SV=2 17 67 2.0E-08
sp|P27870|VAV_MOUSE Proto-oncogene vav OS=Mus musculus GN=Vav1 PE=1 SV=1 4 67 4.0E-08
sp|Q15052|ARHG6_HUMAN Rho guanine nucleotide exchange factor 6 OS=Homo sapiens GN=ARHGEF6 PE=1 SV=2 10 118 4.0E-08
sp|A8MVU1|NCF1C_HUMAN Putative neutrophil cytosol factor 1C OS=Homo sapiens GN=NCF1C PE=5 SV=1 10 79 4.0E-08
sp|Q5XXR3|ARHG6_RAT Rho guanine nucleotide exchange factor 6 OS=Rattus norvegicus GN=Arhgef6 PE=1 SV=1 10 65 5.0E-08
sp|Q8K4I3|ARHG6_MOUSE Rho guanine nucleotide exchange factor 6 OS=Mus musculus GN=Arhgef6 PE=1 SV=1 10 65 6.0E-08
sp|Q99962|SH3G2_HUMAN Endophilin-A1 OS=Homo sapiens GN=SH3GL2 PE=1 SV=1 2 71 6.0E-08
sp|Q09822|CDC15_SCHPO Cell division control protein 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc15 PE=1 SV=2 16 69 6.0E-08
sp|Q8AXV1|SH3G2_CHICK Endophilin-A1 OS=Gallus gallus GN=SH3GL2 PE=1 SV=1 2 69 9.0E-08
sp|O35179|SH3G2_RAT Endophilin-A1 OS=Rattus norvegicus GN=Sh3gl2 PE=1 SV=2 2 71 9.0E-08
sp|Q8IS20|GEFC_DICDI Ras guanine nucleotide exchange factor C OS=Dictyostelium discoideum GN=gefC PE=2 SV=1 742 874 1.0E-07
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 17 75 1.0E-07
sp|Q09014|NCF1_MOUSE Neutrophil cytosol factor 1 OS=Mus musculus GN=Ncf1 PE=1 SV=3 10 75 1.0E-07
sp|Q8AXV0|SH3G1_CHICK Endophilin-A2 OS=Gallus gallus GN=SH3GL1 PE=1 SV=1 17 69 1.0E-07
sp|Q6CVA8|HSE1_KLULA Class E vacuolar protein-sorting machinery protein HSE1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HSE1 PE=3 SV=1 17 96 1.0E-07
sp|Q62420|SH3G2_MOUSE Endophilin-A1 OS=Mus musculus GN=Sh3gl2 PE=1 SV=2 17 71 2.0E-07
sp|Q96B97|SH3K1_HUMAN SH3 domain-containing kinase-binding protein 1 OS=Homo sapiens GN=SH3KBP1 PE=1 SV=2 21 74 2.0E-07
sp|Q8R550|SH3K1_MOUSE SH3 domain-containing kinase-binding protein 1 OS=Mus musculus GN=Sh3kbp1 PE=1 SV=1 21 74 2.0E-07
sp|P14598|NCF1_HUMAN Neutrophil cytosol factor 1 OS=Homo sapiens GN=NCF1 PE=1 SV=3 10 79 2.0E-07
sp|P54100|VAV_RAT Proto-oncogene vav OS=Rattus norvegicus GN=Vav1 PE=2 SV=1 4 67 2.0E-07
sp|Q925Q9|SH3K1_RAT SH3 domain-containing kinase-binding protein 1 OS=Rattus norvegicus GN=Sh3kbp1 PE=1 SV=2 21 74 2.0E-07
sp|Q75DS3|HSE1_ASHGO Class E vacuolar protein-sorting machinery protein HSE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HSE1 PE=3 SV=1 17 96 2.0E-07
sp|A6NI72|NCF1B_HUMAN Putative neutrophil cytosol factor 1B OS=Homo sapiens GN=NCF1B PE=5 SV=2 10 79 2.0E-07
sp|Q9P7E8|APP1_SCHPO Protein app1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=app1 PE=2 SV=1 2 69 2.0E-07
sp|Q555L8|Y4695_DICDI SH3 and F-BAR domain-containing protein DDB_G0274695 OS=Dictyostelium discoideum GN=DDB_G0274695 PE=3 SV=1 6 67 3.0E-07
sp|Q6GM14|DBNLB_XENLA Drebrin-like protein B OS=Xenopus laevis GN=dbnl-b PE=2 SV=1 13 69 3.0E-07
sp|Q09746|BZZ1_SCHPO Protein BZZ1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bzz1 PE=3 SV=1 16 65 4.0E-07
sp|O74352|HOB1_SCHPO Protein hob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hob1 PE=1 SV=1 16 68 4.0E-07
sp|O74749|HSE1_SCHPO Class E vacuolar protein-sorting machinery protein hse1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hse1 PE=3 SV=1 2 109 4.0E-07
sp|A1DFN5|HSE1_NEOFI Class E vacuolar protein-sorting machinery protein hse1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hse1 PE=3 SV=1 4 72 4.0E-07
sp|Q8AXU9|SH3G3_CHICK Endophilin-A3 OS=Gallus gallus GN=SH3GL3 PE=1 SV=1 17 69 4.0E-07
sp|P29355|SEM5_CAEEL Sex muscle abnormal protein 5 OS=Caenorhabditis elegans GN=sem-5 PE=1 SV=1 16 65 4.0E-07
sp|Q2GT05|HSE1_CHAGB Class E vacuolar protein-sorting machinery protein HSE1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HSE1 PE=3 SV=1 5 72 5.0E-07
sp|Q4WHP5|HSE1_ASPFU Class E vacuolar protein-sorting machinery protein hse1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hse1 PE=3 SV=1 4 72 5.0E-07
sp|Q13588|GRAP_HUMAN GRB2-related adapter protein OS=Homo sapiens GN=GRAP PE=1 SV=1 7 69 6.0E-07
sp|F1M707|NCF1_RAT Neutrophil cytosolic factor 1 OS=Rattus norvegicus GN=Ncf1 PE=1 SV=2 10 75 7.0E-07
sp|Q1E878|HSE1_COCIM Class E vacuolar protein-sorting machinery protein HSE1 OS=Coccidioides immitis (strain RS) GN=HSE1 PE=3 SV=1 9 72 1.0E-06
sp|O77774|NCF1_BOVIN Neutrophil cytosol factor 1 OS=Bos taurus GN=NCF1 PE=2 SV=1 10 79 1.0E-06
sp|Q75JD4|Y1676_DICDI SH3 and F-BAR domain-containing protein DDB_G0271676 OS=Dictyostelium discoideum GN=DDB_G0271676 PE=3 SV=1 14 65 1.0E-06
sp|O43125|CSH3_SCHPO Protein csh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csh3 PE=2 SV=1 17 78 1.0E-06
sp|O42287|ITSN1_XENLA Intersectin-1 OS=Xenopus laevis GN=itsn1 PE=1 SV=1 2 75 2.0E-06
sp|Q0U6X7|HSE1_PHANO Class E vacuolar protein-sorting machinery protein HSE1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HSE1 PE=3 SV=1 17 72 2.0E-06
sp|P34109|MYOD_DICDI Myosin ID heavy chain OS=Dictyostelium discoideum GN=myoD PE=1 SV=2 1 69 2.0E-06
sp|P10569|MYSC_ACACA Myosin IC heavy chain OS=Acanthamoeba castellanii GN=MIC PE=1 SV=1 18 69 2.0E-06
sp|F1LRS8|CD2AP_RAT CD2-associated protein OS=Rattus norvegicus GN=Cd2ap PE=1 SV=2 17 74 2.0E-06
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus GN=Itsn2 PE=1 SV=2 17 75 2.0E-06
sp|Q07883|GRB2_CHICK Growth factor receptor-bound protein 2 OS=Gallus gallus GN=GRB2 PE=1 SV=1 5 70 2.0E-06
sp|Q96HU1|SGSM3_HUMAN Small G protein signaling modulator 3 OS=Homo sapiens GN=SGSM3 PE=1 SV=1 18 95 3.0E-06
sp|Q7T2D0|SGSM3_DANRE Small G protein signaling modulator 3 OS=Danio rerio GN=sgsm3 PE=2 SV=1 18 102 3.0E-06
sp|Q55EC7|GEFX_DICDI RasGEF domain-containing serine/threonine-protein kinase X OS=Dictyostelium discoideum GN=gefX PE=2 SV=1 752 848 4.0E-06
sp|Q6P6R7|SGSM3_RAT Small G protein signaling modulator 3 OS=Rattus norvegicus GN=Sgsm3 PE=1 SV=1 18 95 4.0E-06
sp|P62994|GRB2_RAT Growth factor receptor-bound protein 2 OS=Rattus norvegicus GN=Grb2 PE=1 SV=1 5 70 4.0E-06
sp|Q5R4J7|GRB2_PONAB Growth factor receptor-bound protein 2 OS=Pongo abelii GN=GRB2 PE=2 SV=1 5 70 4.0E-06
sp|P62993|GRB2_HUMAN Growth factor receptor-bound protein 2 OS=Homo sapiens GN=GRB2 PE=1 SV=1 5 70 4.0E-06
sp|Q8VCZ6|SGSM3_MOUSE Small G protein signaling modulator 3 OS=Mus musculus GN=Sgsm3 PE=1 SV=1 18 88 4.0E-06
sp|A6H8I2|SGSM3_XENLA Small G protein signaling modulator 3 homolog OS=Xenopus laevis GN=sgsm3 PE=2 SV=1 18 88 4.0E-06
sp|Q60631|GRB2_MOUSE Growth factor receptor-bound protein 2 OS=Mus musculus GN=Grb2 PE=1 SV=1 5 70 5.0E-06
sp|P34092|MYOB_DICDI Myosin IB heavy chain OS=Dictyostelium discoideum GN=myoB PE=1 SV=2 6 67 6.0E-06
sp|Q2KI13|SGSM3_BOVIN Small G protein signaling modulator 3 OS=Bos taurus GN=SGSM3 PE=2 SV=1 18 95 6.0E-06
sp|Q76NI1|VKIND_HUMAN Protein very KIND OS=Homo sapiens GN=KNDC1 PE=2 SV=2 916 1123 8.0E-06
sp|Q6C2N2|HSE1_YARLI Class E vacuolar protein-sorting machinery protein HSE1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HSE1 PE=3 SV=1 7 72 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005085 guanyl-nucleotide exchange factor activity Yes
GO:0007264 small GTPase mediated signal transduction Yes
GO:0065007 biological regulation No
GO:0030695 GTPase regulator activity No
GO:0098772 molecular function regulator activity No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0050789 regulation of biological process No
GO:0035556 intracellular signal transduction No
GO:0007165 signal transduction No
GO:0050794 regulation of cellular process No
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0030234 enzyme regulator activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5062
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5864
Ophiocordyceps australis map64 (Brazil) OphauB2|830 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05650
Ophiocordyceps camponoti-rufipedis Ophun1|3054
Ophiocordyceps kimflemingae Ophio5|1946
Ophiocordyceps subramaniannii Hirsu2|2800

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|830
MNGSISPAPSGPTGLYVRALFDYHADDGTSLSFQHGDIIEVVTRLESGWWDGIINGVRGWFPSNYCELVSAPDDS
AAKEFSAPAVDDSRDSAQTNNSVQDNLDQDEGLEASRLNSLPIEGTDTEDYQSGTDFWIPQATSDGRLYYFNTMT
GDRRAELPMESPVSSAETGPRDRNNFKVPDKSRPPIELMASGFTQDEDDKSTTSVSEAEDEALTRSFKGYTKPRH
RTSLSAALSPSASMDSMNGSSPGRRARKDVLSNGRSSGGKPPNNMASATAFTSTTYHLPTTATLPRSFFDDGATP
PLTWSLLVTNMKLAIDRYREAIANNNRSDFVARAEDISDHLRLLLAAGSGTTDNHSGQPSIISTNKALYPHFRDM
MSKFSKLVISSHIAASDWPSTESVQKCLQEADGVLHGVFSYVEVARQQRGEEIPRLFPGFVIGSSKGGSWQNNGL
GSQDPVAANFLEDDDSANEPTATLDAVLLESLAERRRAMISSTRELDRSLATPDGIITPYHHEAIGNSTCMAGSK
VMDSFKLWIAMIESIDLSYLSNILGTSNFDQYSMAKQGVYDAMSDLILGCQAVTGPLADEWSQVRGESLKSRLAY
VRQCARTLETTSSHMQYSLQLLSEEVQPIGVKQTPQSEDGRPGDAQSSRGRFWHGDGQHAERHNNNSTSAPAVPR
PPFVTAPTFMEGEPPTGSLRKGDYAKVKKIFGEDPSPQTSTQPDDTPDFLRLDYEDDVSWDTKTSPPTVRGGTLL
ALVEQLTRHDKLDSSFNTTFLLTYRSFTSGRELFELLVKRFGIQPPDGLIQSDYETWRDRKQKPIRFRVVNILKS
WFDSFWTEEFNDESKQLICDVFDFARDRVKSTDTPGSGPLMSVLTQRLQGKEAGARRMIQTLNQSTPSPIVPKNI
KKLKFLDIDSTEFARQLTIIESRLYGKIKAAECLNKTWQKKVASSEPDAAPNVKALILHSNQLTNWVAEMILGQM
DVKKRVVVIKHFVAIADKCRSLNNFSTLTSVISALGTAPIARLKRTWEQVPQRVQAVLETMRRLMASTKNFGEYR
ESLHVANPPCIPFFGVYLTDLTFIEDGIPSVIKKTNLINFAKRAKTAEVIRDIQQYQNVGYSLQSVPELQDYLLS
NMQAAGDVHEMYDKSLQIEPREREEEKIVRVLAESGFL*
Coding >OphauB2|830
ATGAACGGCAGCATAAGTCCGGCGCCGTCCGGCCCTACTGGTCTATATGTCCGCGCGCTATTTGACTACCATGCA
GACGATGGAACAAGCCTGAGCTTTCAGCATGGCGATATCATCGAAGTTGTGACTCGCCTCGAGAGCGGTTGGTGG
GATGGCATCATAAACGGAGTCCGCGGCTGGTTCCCGAGCAACTATTGCGAGCTCGTTTCTGCTCCTGATGATTCG
GCGGCCAAGGAATTCAGCGCCCCTGCGGTCGACGACAGTCGAGACAGCGCTCAGACCAACAATTCGGTCCAGGAC
AATCTCGATCAAGATGAGGGCTTGGAGGCTAGTAGGCTCAACAGCCTGCCAATTGAGGGTACCGACACTGAAGAC
TATCAGTCGGGCACCGATTTTTGGATTCCTCAAGCCACTTCGGACGGCCGCTTGTACTACTTCAACACTATGACG
GGCGACCGCAGAGCCGAGCTGCCCATGGAATCACCTGTTTCATCAGCAGAAACAGGTCCTCGCGACCGTAACAAT
TTCAAGGTGCCCGACAAAAGTCGCCCTCCTATCGAGCTCATGGCCAGTGGTTTTACCCAGGATGAGGACGACAAA
TCTACAACATCGGTTTCTGAAGCAGAGGATGAGGCATTAACGCGCTCATTCAAAGGTTACACGAAGCCTCGCCAT
CGTACTTCACTAAGCGCTGCTCTGTCTCCGTCGGCATCAATGGATTCGATGAACGGCTCTTCGCCCGGTCGGCGC
GCCAGAAAAGACGTCTTGTCTAACGGTAGATCGTCGGGCGGCAAGCCACCTAACAATATGGCTTCCGCCACCGCT
TTCACAAGCACGACATATCATCTCCCAACAACAGCAACTCTTCCTCGCTCGTTTTTTGACGATGGAGCAACGCCG
CCACTTACCTGGAGTTTACTCGTCACCAACATGAAACTTGCTATTGATCGATATCGCGAGGCTATTGCCAACAAC
AATCGCTCAGACTTTGTTGCCAGGGCCGAAGATATATCCGATCATCTACGTCTTCTTTTGGCCGCCGGGTCCGGT
ACCACTGATAATCATTCTGGACAACCTTCCATTATATCAACTAACAAGGCACTGTATCCTCACTTCCGCGACATG
ATGTCAAAATTCTCCAAGCTCGTCATATCTTCCCACATTGCCGCTTCAGACTGGCCTAGTACTGAATCCGTTCAG
AAATGCTTGCAGGAAGCTGACGGCGTCTTACATGGCGTTTTTAGCTATGTCGAGGTTGCCAGACAACAACGAGGC
GAGGAAATTCCCCGTCTTTTCCCTGGATTCGTAATTGGCAGCAGCAAAGGCGGAAGCTGGCAAAATAACGGCCTA
GGGTCGCAAGATCCCGTGGCGGCAAACTTTTTGGAGGATGACGACAGCGCCAATGAGCCCACTGCCACCTTGGAC
GCCGTATTACTTGAAAGTCTTGCAGAGCGTCGACGCGCAATGATCTCGTCCACCAGGGAGCTTGACAGGAGCTTG
GCTACTCCTGATGGCATCATCACACCATATCATCACGAGGCAATCGGCAATTCTACCTGCATGGCTGGCTCCAAG
GTTATGGACAGTTTCAAGCTCTGGATCGCAATGATTGAATCGATTGATCTCTCATATTTAAGCAATATTCTGGGA
ACAAGCAACTTTGATCAGTACAGCATGGCTAAGCAAGGCGTTTACGATGCCATGTCGGATCTCATTCTCGGTTGT
CAGGCGGTTACTGGGCCTTTGGCAGATGAATGGAGTCAAGTACGGGGAGAAAGCTTGAAAAGTCGCCTCGCGTAC
GTGCGGCAATGTGCGCGAACCCTAGAAACAACCTCTTCACATATGCAATACTCGCTGCAGTTGCTATCGGAAGAA
GTACAGCCCATTGGGGTGAAGCAAACACCACAATCGGAAGATGGTCGACCTGGAGACGCCCAGTCGTCACGTGGA
CGCTTCTGGCATGGGGATGGGCAACACGCAGAAAGGCATAATAACAACTCGACGTCTGCACCAGCAGTTCCACGA
CCGCCATTTGTCACAGCACCGACTTTTATGGAGGGCGAGCCTCCGACGGGCAGCTTGCGCAAGGGTGATTATGCC
AAAGTCAAAAAGATATTTGGAGAGGACCCGTCGCCACAAACCAGCACGCAGCCCGACGATACGCCTGATTTTCTC
AGGCTCGATTACGAAGATGACGTGTCTTGGGATACCAAGACGTCACCTCCTACTGTCAGGGGCGGCACACTGCTG
GCGCTTGTTGAGCAACTCACCCGGCATGACAAGCTTGACTCAAGTTTCAATACCACTTTTCTTCTCACGTACCGT
TCCTTCACTTCTGGGCGTGAGCTGTTTGAGTTATTGGTAAAGCGTTTTGGAATCCAGCCACCTGATGGCTTGATA
CAGTCAGACTACGAGACATGGAGGGATCGCAAGCAAAAGCCGATACGATTTCGCGTGGTGAATATATTGAAGAGC
TGGTTCGATAGTTTTTGGACTGAAGAGTTCAACGATGAGTCGAAGCAGCTCATCTGTGACGTTTTTGACTTTGCC
CGGGACAGGGTCAAATCTACGGATACGCCTGGCTCTGGTCCTTTGATGTCGGTCCTTACCCAGAGACTCCAAGGA
AAGGAGGCGGGAGCACGGCGGATGATTCAAACACTCAACCAGAGCACACCATCTCCCATTGTCCCCAAGAACATC
AAGAAGCTCAAATTTCTTGATATCGACTCTACCGAGTTTGCCAGACAGTTGACCATTATCGAATCACGCTTGTAT
GGAAAGATCAAGGCGGCCGAGTGTCTCAATAAGACGTGGCAGAAAAAAGTGGCGAGCAGCGAGCCAGATGCTGCA
CCCAATGTCAAGGCCTTGATTCTGCACTCAAACCAGCTGACCAATTGGGTTGCGGAGATGATATTGGGCCAGATG
GACGTCAAGAAGCGTGTTGTCGTCATTAAACACTTTGTTGCCATTGCTGATAAATGTCGAAGTCTTAACAATTTT
TCGACGCTCACATCGGTAATATCGGCGCTGGGCACGGCCCCAATAGCCCGCCTTAAGAGGACGTGGGAACAGGTG
CCGCAACGAGTGCAGGCTGTTTTGGAGACGATGCGGCGTCTTATGGCCAGCACCAAGAATTTTGGAGAATATCGC
GAGTCGCTCCATGTTGCTAACCCGCCGTGCATACCATTTTTCGGCGTATATCTCACCGACTTGACGTTTATAGAA
GACGGCATCCCATCCGTCATCAAGAAGACCAACTTGATCAACTTTGCAAAGCGGGCAAAGACGGCAGAAGTGATT
CGTGATATTCAACAGTACCAGAACGTGGGCTATTCGCTGCAATCGGTACCAGAGCTGCAGGACTACTTGTTGAGC
AACATGCAGGCCGCGGGGGATGTGCACGAAATGTACGACAAGAGCTTACAAATTGAGCCGCGAGAGCGCGAGGAA
GAAAAGATTGTCAGGGTTCTGGCCGAGTCGGGCTTCCTCTAA
Transcript >OphauB2|830
ATGAACGGCAGCATAAGTCCGGCGCCGTCCGGCCCTACTGGTCTATATGTCCGCGCGCTATTTGACTACCATGCA
GACGATGGAACAAGCCTGAGCTTTCAGCATGGCGATATCATCGAAGTTGTGACTCGCCTCGAGAGCGGTTGGTGG
GATGGCATCATAAACGGAGTCCGCGGCTGGTTCCCGAGCAACTATTGCGAGCTCGTTTCTGCTCCTGATGATTCG
GCGGCCAAGGAATTCAGCGCCCCTGCGGTCGACGACAGTCGAGACAGCGCTCAGACCAACAATTCGGTCCAGGAC
AATCTCGATCAAGATGAGGGCTTGGAGGCTAGTAGGCTCAACAGCCTGCCAATTGAGGGTACCGACACTGAAGAC
TATCAGTCGGGCACCGATTTTTGGATTCCTCAAGCCACTTCGGACGGCCGCTTGTACTACTTCAACACTATGACG
GGCGACCGCAGAGCCGAGCTGCCCATGGAATCACCTGTTTCATCAGCAGAAACAGGTCCTCGCGACCGTAACAAT
TTCAAGGTGCCCGACAAAAGTCGCCCTCCTATCGAGCTCATGGCCAGTGGTTTTACCCAGGATGAGGACGACAAA
TCTACAACATCGGTTTCTGAAGCAGAGGATGAGGCATTAACGCGCTCATTCAAAGGTTACACGAAGCCTCGCCAT
CGTACTTCACTAAGCGCTGCTCTGTCTCCGTCGGCATCAATGGATTCGATGAACGGCTCTTCGCCCGGTCGGCGC
GCCAGAAAAGACGTCTTGTCTAACGGTAGATCGTCGGGCGGCAAGCCACCTAACAATATGGCTTCCGCCACCGCT
TTCACAAGCACGACATATCATCTCCCAACAACAGCAACTCTTCCTCGCTCGTTTTTTGACGATGGAGCAACGCCG
CCACTTACCTGGAGTTTACTCGTCACCAACATGAAACTTGCTATTGATCGATATCGCGAGGCTATTGCCAACAAC
AATCGCTCAGACTTTGTTGCCAGGGCCGAAGATATATCCGATCATCTACGTCTTCTTTTGGCCGCCGGGTCCGGT
ACCACTGATAATCATTCTGGACAACCTTCCATTATATCAACTAACAAGGCACTGTATCCTCACTTCCGCGACATG
ATGTCAAAATTCTCCAAGCTCGTCATATCTTCCCACATTGCCGCTTCAGACTGGCCTAGTACTGAATCCGTTCAG
AAATGCTTGCAGGAAGCTGACGGCGTCTTACATGGCGTTTTTAGCTATGTCGAGGTTGCCAGACAACAACGAGGC
GAGGAAATTCCCCGTCTTTTCCCTGGATTCGTAATTGGCAGCAGCAAAGGCGGAAGCTGGCAAAATAACGGCCTA
GGGTCGCAAGATCCCGTGGCGGCAAACTTTTTGGAGGATGACGACAGCGCCAATGAGCCCACTGCCACCTTGGAC
GCCGTATTACTTGAAAGTCTTGCAGAGCGTCGACGCGCAATGATCTCGTCCACCAGGGAGCTTGACAGGAGCTTG
GCTACTCCTGATGGCATCATCACACCATATCATCACGAGGCAATCGGCAATTCTACCTGCATGGCTGGCTCCAAG
GTTATGGACAGTTTCAAGCTCTGGATCGCAATGATTGAATCGATTGATCTCTCATATTTAAGCAATATTCTGGGA
ACAAGCAACTTTGATCAGTACAGCATGGCTAAGCAAGGCGTTTACGATGCCATGTCGGATCTCATTCTCGGTTGT
CAGGCGGTTACTGGGCCTTTGGCAGATGAATGGAGTCAAGTACGGGGAGAAAGCTTGAAAAGTCGCCTCGCGTAC
GTGCGGCAATGTGCGCGAACCCTAGAAACAACCTCTTCACATATGCAATACTCGCTGCAGTTGCTATCGGAAGAA
GTACAGCCCATTGGGGTGAAGCAAACACCACAATCGGAAGATGGTCGACCTGGAGACGCCCAGTCGTCACGTGGA
CGCTTCTGGCATGGGGATGGGCAACACGCAGAAAGGCATAATAACAACTCGACGTCTGCACCAGCAGTTCCACGA
CCGCCATTTGTCACAGCACCGACTTTTATGGAGGGCGAGCCTCCGACGGGCAGCTTGCGCAAGGGTGATTATGCC
AAAGTCAAAAAGATATTTGGAGAGGACCCGTCGCCACAAACCAGCACGCAGCCCGACGATACGCCTGATTTTCTC
AGGCTCGATTACGAAGATGACGTGTCTTGGGATACCAAGACGTCACCTCCTACTGTCAGGGGCGGCACACTGCTG
GCGCTTGTTGAGCAACTCACCCGGCATGACAAGCTTGACTCAAGTTTCAATACCACTTTTCTTCTCACGTACCGT
TCCTTCACTTCTGGGCGTGAGCTGTTTGAGTTATTGGTAAAGCGTTTTGGAATCCAGCCACCTGATGGCTTGATA
CAGTCAGACTACGAGACATGGAGGGATCGCAAGCAAAAGCCGATACGATTTCGCGTGGTGAATATATTGAAGAGC
TGGTTCGATAGTTTTTGGACTGAAGAGTTCAACGATGAGTCGAAGCAGCTCATCTGTGACGTTTTTGACTTTGCC
CGGGACAGGGTCAAATCTACGGATACGCCTGGCTCTGGTCCTTTGATGTCGGTCCTTACCCAGAGACTCCAAGGA
AAGGAGGCGGGAGCACGGCGGATGATTCAAACACTCAACCAGAGCACACCATCTCCCATTGTCCCCAAGAACATC
AAGAAGCTCAAATTTCTTGATATCGACTCTACCGAGTTTGCCAGACAGTTGACCATTATCGAATCACGCTTGTAT
GGAAAGATCAAGGCGGCCGAGTGTCTCAATAAGACGTGGCAGAAAAAAGTGGCGAGCAGCGAGCCAGATGCTGCA
CCCAATGTCAAGGCCTTGATTCTGCACTCAAACCAGCTGACCAATTGGGTTGCGGAGATGATATTGGGCCAGATG
GACGTCAAGAAGCGTGTTGTCGTCATTAAACACTTTGTTGCCATTGCTGATAAATGTCGAAGTCTTAACAATTTT
TCGACGCTCACATCGGTAATATCGGCGCTGGGCACGGCCCCAATAGCCCGCCTTAAGAGGACGTGGGAACAGGTG
CCGCAACGAGTGCAGGCTGTTTTGGAGACGATGCGGCGTCTTATGGCCAGCACCAAGAATTTTGGAGAATATCGC
GAGTCGCTCCATGTTGCTAACCCGCCGTGCATACCATTTTTCGGCGTATATCTCACCGACTTGACGTTTATAGAA
GACGGCATCCCATCCGTCATCAAGAAGACCAACTTGATCAACTTTGCAAAGCGGGCAAAGACGGCAGAAGTGATT
CGTGATATTCAACAGTACCAGAACGTGGGCTATTCGCTGCAATCGGTACCAGAGCTGCAGGACTACTTGTTGAGC
AACATGCAGGCCGCGGGGGATGTGCACGAAATGTACGACAAGAGCTTACAAATTGAGCCGCGAGAGCGCGAGGAA
GAAAAGATTGTCAGGGTTCTGGCCGAGTCGGGCTTCCTCTAA
Gene >OphauB2|830
ATGAACGGCAGCATAAGTCCGGCGCCGTCCGGCCCTACTGGTCTATATGTCCGCGCGCTATTTGACTACCATGCA
GACGATGGAACAAGCCTGAGCTTTCAGCATGGCGATATCATCGAAGTTGTGACTCGCCTCGAGAGCGGTTGGTGG
GATGGCATCATAAACGGAGTCCGCGGCTGGTTCCCGAGCAACTATTGCGAGCTCGTTTCTGCTCCTGATGATTCG
GCGGCCAAGGAATTCAGCGCCCCTGCGGTCGACGACAGTCGAGACAGCGCTCAGACCAACAATTCGGTCCAGGAC
AATCTCGATCAAGATGAGGGCTTGGAGGCTAGTAGGCTCAACAGCCTGCCAATTGAGGGTACCGACACTGAAGAC
TATCAGTCGGGCACCGATTTTTGGATTCCTCAAGCCACTTCGGACGGCCGCTTGTACTACTTCAACACTATGACG
GGCGACCGCAGAGCCGAGCTGCCCATGGAATCACCTGTTTCATCAGCAGAAACAGGTCCTCGCGACCGTAACAAT
TTCAAGGTGCCCGACAAAAGTCGCCCTCCTATCGAGCTCATGGCCAGTGGTTTTACCCAGGATGAGGACGACAAA
TCTACAACATCGGTTTCTGAAGCAGAGGATGAGGCATTAACGCGCTCATTCAAAGGTTACACGGTGCGTCTTGCC
CCCTCCCCCTGCATCTTATTTCTCTATTACTTTGTCTCACCTCCCCTCCTTTTTTTTATGTATTTTTTTTTGTAT
ATGAGAAATCAAGTCTGATCAGCCCCTCTGAGAAGCCTCGCCATCGTACTTCACTAAGCGCTGCTCTGTCTCCGT
CGGCATCAATGGATTCGATGAACGGCTCTTCGCCCGGTCGGCGCGCCAGAAAAGACGTCTTGTCTAACGGTAGAT
CGTCGGGCGGCAAGCCACCTAACAATATGGCTTCCGCCACCGCTTTCACAAGCACGACATATCATCTCCCAACAA
CAGCAACTCTTCCTCGCTCGTTTTTTGACGATGGAGCAACGCCGCCACTTACCTGGAGTTTACTCGTCACCAACA
TGAAACTTGCTATTGATCGATATCGCGAGGCTATTGCCAACAACAATCGCTCAGACTTTGTTGCCAGGGCCGAAG
ATATATCCGATCATCTACGTCTTCTTTTGGCCGCCGGGTCCGGTACCACTGATAATCATTCTGGACAACCTTCCA
TTATATCAACTAACAAGGCACTGTATCCTCACTTCCGCGACATGATGTCAAAATTCTCCAAGCTCGTCATATCTT
CCCACATTGCCGCTTCAGACTGGCCTAGTACTGAATCCGTTCAGAAATGCTTGCAGGAAGCTGACGGCGTCTTAC
ATGGCGTTTTTAGCTATGTCGAGGTTGCCAGACAACAACGAGGCGAGGAAATTCCCCGTCTTTTCCCTGGATTCG
TAATTGGCAGCAGCAAAGGCGGAAGCTGGCAAAATAACGGCCTAGGGTCGCAAGATCCCGTGGCGGCAAACTTTT
TGGAGGATGACGACAGCGCCAATGAGCCCACTGCCACCTTGGACGCCGTATTACTTGAAAGTCTTGCAGAGCGTC
GACGCGCAATGATCTCGTCCACCAGGGAGCTTGACAGGAGCTTGGCTACTCCTGATGGCATCATCACACCATATC
ATCACGAGGCAATCGGCAATTCTACCTGCATGGCTGGCTCCAAGGTTATGGACAGTTTCAAGCTCTGGATCGCAA
TGATTGAATCGATTGATCTCTCATATTTAAGCAATATTCTGGGAACAAGCAACTTTGATCAGTACAGCATGGCTA
AGCAAGGCGTTTACGATGCCATGTCGGATCTCATTCTCGGTTGTCAGGCGGTTACTGGGCCTTTGGCAGATGAAT
GGAGTCAAGTACGGGGAGAAAGCTTGAAAAGTCGCCTCGCGTACGTGCGGCAATGTGCGCGAACCCTAGAAACAA
CCTCTTCACATATGCAATACTCGCTGCAGTTGCTATCGGAAGAAGTACAGCCCATTGGGGTGAAGCAAACACCAC
AATCGGAAGATGGTCGACCTGGAGACGCCCAGTCGTCACGTGGACGCTTCTGGCATGGGGATGGGCAACACGCAG
AAAGGCATAATAACAACTCGACGTCTGCACCAGCAGTTCCACGACCGCCATTTGTCACAGCACCGACTTTTATGG
AGGGCGAGCCTCCGACGGGCAGCTTGCGCAAGGGTGATTATGCCAAAGTCAAAAAGATATTTGGAGAGGACCCGT
CGCCACAAACCAGCACGCAGCCCGACGATACGCCTGATTTTCTCAGGCTCGATTACGAAGATGACGTGTCTTGGG
ATACCAAGACGTCACCTCCTACTGTCAGGGGCGGCACACTGCTGGCGCTTGTTGAGCAACTCACCCGGCATGACA
AGCTTGACTCAAGTTTCAATACCACTTTTCTTCTCACGTACCGTTCCTTCACTTCTGGGCGTGAGCTGTTTGAGT
TATTGGTAAAGCGTTTTGGAATCCAGCCACCTGATGGCTTGATACAGTCAGACTACGAGACATGGAGGGATCGCA
AGCAAAAGCCGATACGATTTCGCGTGGTGAATATATTGAAGAGCTGGTTCGATAGTTTTTGGACTGAAGAGTTCA
ACGATGAGTCGAAGCAGCTCATCTGTGACGTTTTTGACTTTGCCCGGGACAGGGTCAAATCTACGGATACGCCTG
GCTCTGGTCCTTTGATGTCGGTCCTTACCCAGAGACTCCAAGGAAAGGAGGCGGGAGCACGGCGGATGATTCAAA
CACTCAACCAGAGCACACCATCTCCCATTGTCCCCAAGAACATCAAGAAGCTCAAATTTCTTGATATCGACTCTA
CCGAGTTTGCCAGACAGTTGACCATTATCGAATCACGCTTGTATGGAAAGATCAAGGCGGCCGAGTGTCTCAATA
AGACGTGGCAGAAAAAAGTGGCGAGCAGCGAGCCAGATGCTGCACCCAATGTCAAGGCCTTGATTCTGCACTCAA
ACCAGCTGACCAATTGGGTTGCGGAGATGATATTGGGCCAGATGGACGTCAAGAAGCGTGTTGTCGTCATTAAAC
ACTTTGTTGCCATTGCTGATGTACGTTTTTGTACCCTTTTGGACTTTGCGAGATTTCTTTGTGCTCATTGGCGAT
TGAACAGAAATGTCGAAGTCTTAACAATTTTTCGACGCTCACATCGGTAATATCGGCGCTGGGCACGGCCCCAAT
AGCCCGCCTTAAGAGGACGTGGGAACAGGTGCCGCAACGAGTGCAGGCTGTTTTGGAGACGATGCGGCGTCTTAT
GGCCAGCACCAAGAATTTTGGAGAATATCGCGAGTCGCTCCATGTTGCTAACCCGCCGTGCATACCATTTTTCGG
TAAATGACCAGTGTGAAGAATCGTCAAGGGTGCAAAGGCTGACTTGCTCGTACACTAGGCGTATATCTCACCGAC
TTGACGTTTATAGAAGACGGCATCCCATCCGTCATCAAGAAGACCAACTTGATCAACTTTGCAAAGCGGGCAAAG
ACGGCAGAAGTGATTCGTGATATTCAACAGTACCAGAACGTGGGCTATTCGCTGCAATCGGTACCAGAGCTGCAG
GACTACTTGTTGAGCAACATGCAGGCCGCGGGGGATGTGCACGAAATGTACGACAAGAGCTTACAAATTGAGCCG
CGAGAGCGCGAGGAAGAAAAGATTGTCAGGTACGTAGCCTTGCGGGATCAGTCGGTGTCCAAGAGCGCGGCACCG
CCTGATTGATAATGGAGAGACCGAGGCTCGTCCCGTCCGCTGAGGACGCACTTTGAACAAGCTCGGAAGCTTACT
TGGGTTTCGTCCCAGGGTTCTGGCCGAGTCGGGCTTCCTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail