Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|828
Gene name
LocationContig_118:42354..43309
Strand-
Gene length (bp)955
Transcript length (bp)879
Coding sequence length (bp)879
Protein length (aa) 293

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16 1.9E-10 59 195

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P23904|GUB_PAEMA Beta-glucanase OS=Paenibacillus macerans PE=1 SV=2 24 194 1.0E-08
sp|Q53317|XYND_RUMFL Xylanase/beta-glucanase OS=Ruminococcus flavefaciens GN=xynD PE=3 SV=2 69 193 7.0E-07
sp|P37073|GUB_BREBE Beta-glucanase OS=Brevibacillus brevis GN=bglBB PE=1 SV=1 6 193 3.0E-06
sp|P27051|GUB_BACLI Beta-glucanase OS=Bacillus licheniformis GN=bg1 PE=1 SV=1 70 217 4.0E-06
sp|P04957|GUB_BACSU Beta-glucanase OS=Bacillus subtilis (strain 168) GN=bglS PE=1 SV=2 70 194 6.0E-06

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|828
MKEVGDDERWVRQEFDVSAAAGRGKYGKAFRADKVQIGGSGLELGVGSQLVQGEAVPVAEVDSARADVHWGSYRA
GIKLTAVPGTCSAFFWYFNDTQEIDMEFLSHEYEARLGQWPVNLVVQSRKSQEAGYDARKTGLFRRVMLGFDPTA
GFHEYRFDYLADRVVFYADGNKLADMAGGDLPSSPGHLVLQHWSNGNPLWSGGPPREEALMTVSYVKAYFNSTAS
RPGRPGCVSDAVCRVEGVTAANASTGGAFLTDDGRRGGSRSGQQDSGAARQDVALVLLLALALMLLL*
Coding >OphauB2|828
ATGAAGGAGGTTGGAGACGACGAGAGATGGGTGCGGCAAGAGTTTGACGTGTCGGCAGCAGCAGGACGAGGCAAG
TATGGCAAGGCGTTTAGGGCAGACAAGGTGCAGATTGGGGGCTCGGGGCTGGAGCTGGGCGTGGGCAGCCAGCTG
GTGCAAGGCGAGGCGGTGCCAGTGGCCGAAGTGGACTCTGCGCGGGCCGACGTGCACTGGGGCTCGTACCGGGCG
GGCATCAAGTTGACGGCGGTGCCTGGGACATGCAGCGCCTTTTTCTGGTACTTCAACGACACGCAGGAAATCGAC
ATGGAGTTTCTGTCGCACGAGTATGAGGCGCGTCTGGGCCAGTGGCCCGTCAACCTGGTGGTGCAGAGCCGCAAG
TCGCAAGAGGCGGGCTACGATGCTCGCAAGACGGGCCTCTTTCGGCGCGTCATGCTGGGCTTCGACCCGACGGCT
GGCTTCCACGAGTACCGCTTCGACTACCTGGCGGACCGCGTCGTCTTCTACGCCGACGGCAACAAGCTGGCCGAC
ATGGCGGGCGGCGACTTGCCCTCGAGCCCGGGGCATTTGGTGCTGCAGCATTGGAGCAATGGAAACCCGCTGTGG
TCGGGCGGGCCGCCACGCGAGGAGGCCCTCATGACTGTCAGCTACGTCAAGGCCTACTTCAACTCGACTGCCAGC
AGACCTGGCCGCCCGGGGTGCGTGTCCGATGCTGTGTGTAGAGTCGAGGGCGTGACGGCGGCCAATGCCAGCACT
GGCGGAGCCTTTTTGACAGATGATGGCAGACGGGGAGGGTCACGCAGCGGCCAACAAGACAGTGGCGCTGCCAGG
CAAGACGTGGCCCTGGTGCTGCTCTTGGCCTTGGCCTTGATGCTCTTGCTCTAG
Transcript >OphauB2|828
ATGAAGGAGGTTGGAGACGACGAGAGATGGGTGCGGCAAGAGTTTGACGTGTCGGCAGCAGCAGGACGAGGCAAG
TATGGCAAGGCGTTTAGGGCAGACAAGGTGCAGATTGGGGGCTCGGGGCTGGAGCTGGGCGTGGGCAGCCAGCTG
GTGCAAGGCGAGGCGGTGCCAGTGGCCGAAGTGGACTCTGCGCGGGCCGACGTGCACTGGGGCTCGTACCGGGCG
GGCATCAAGTTGACGGCGGTGCCTGGGACATGCAGCGCCTTTTTCTGGTACTTCAACGACACGCAGGAAATCGAC
ATGGAGTTTCTGTCGCACGAGTATGAGGCGCGTCTGGGCCAGTGGCCCGTCAACCTGGTGGTGCAGAGCCGCAAG
TCGCAAGAGGCGGGCTACGATGCTCGCAAGACGGGCCTCTTTCGGCGCGTCATGCTGGGCTTCGACCCGACGGCT
GGCTTCCACGAGTACCGCTTCGACTACCTGGCGGACCGCGTCGTCTTCTACGCCGACGGCAACAAGCTGGCCGAC
ATGGCGGGCGGCGACTTGCCCTCGAGCCCGGGGCATTTGGTGCTGCAGCATTGGAGCAATGGAAACCCGCTGTGG
TCGGGCGGGCCGCCACGCGAGGAGGCCCTCATGACTGTCAGCTACGTCAAGGCCTACTTCAACTCGACTGCCAGC
AGACCTGGCCGCCCGGGGTGCGTGTCCGATGCTGTGTGTAGAGTCGAGGGCGTGACGGCGGCCAATGCCAGCACT
GGCGGAGCCTTTTTGACAGATGATGGCAGACGGGGAGGGTCACGCAGCGGCCAACAAGACAGTGGCGCTGCCAGG
CAAGACGTGGCCCTGGTGCTGCTCTTGGCCTTGGCCTTGATGCTCTTGCTCTAG
Gene >OphauB2|828
ATGAAGGAGGTTGGAGACGACGAGAGATGGGTGCGGCAAGAGTTTGACGTGTCGGCAGCAGCAGGACGAGGCAAG
TATGGCAAGGCGTTTAGGGCAGACAAGGTGCAGATTGGGGGCTCGGGGCTGGAGCTGGGCGTGGGCAGCCAGCTG
GTGCAAGGCGAGGCGGTGCCAGTGGCCGAAGTGGACTCTGCGCGGGCCGACGTGCACTGGGGCTCGTACCGGGCG
GGCATCAAGTTGACGGCGGTGCCTGGGACATGCAGCGCCTTTTTCTGGGTATGTTTTTGCAGAGGCCATTTGGCG
GCTAGGATAAGTGGTATGCAGCAAGGGCTGACGCGGGCGGGGGGAGCAGTACTTCAACGACACGCAGGAAATCGA
CATGGAGTTTCTGTCGCACGAGTATGAGGCGCGTCTGGGCCAGTGGCCCGTCAACCTGGTGGTGCAGAGCCGCAA
GTCGCAAGAGGCGGGCTACGATGCTCGCAAGACGGGCCTCTTTCGGCGCGTCATGCTGGGCTTCGACCCGACGGC
TGGCTTCCACGAGTACCGCTTCGACTACCTGGCGGACCGCGTCGTCTTCTACGCCGACGGCAACAAGCTGGCCGA
CATGGCGGGCGGCGACTTGCCCTCGAGCCCGGGGCATTTGGTGCTGCAGCATTGGAGCAATGGAAACCCGCTGTG
GTCGGGCGGGCCGCCACGCGAGGAGGCCCTCATGACTGTCAGCTACGTCAAGGCCTACTTCAACTCGACTGCCAG
CAGACCTGGCCGCCCGGGGTGCGTGTCCGATGCTGTGTGTAGAGTCGAGGGCGTGACGGCGGCCAATGCCAGCAC
TGGCGGAGCCTTTTTGACAGATGATGGCAGACGGGGAGGGTCACGCAGCGGCCAACAAGACAGTGGCGCTGCCAG
GCAAGACGTGGCCCTGGTGCTGCTCTTGGCCTTGGCCTTGATGCTCTTGCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail