Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|825
Gene name
LocationContig_118:35431..37432
Strand-
Gene length (bp)2001
Transcript length (bp)1614
Coding sequence length (bp)1614
Protein length (aa) 538

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06814 Lung_7-TM_R Lung seven transmembrane receptor 2.1E-70 145 434

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32857|PTM1_YEAST Membrane protein PTM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTM1 PE=1 SV=2 27 463 1.0E-81
sp|A6ZZS6|PTM1_YEAS7 Membrane protein PTM1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PTM1 PE=3 SV=1 27 463 1.0E-81
sp|O13989|YEG7_SCHPO Uncharacterized protein C26H5.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.07c PE=3 SV=2 32 537 4.0E-68
sp|P38745|YHB7_YEAST Uncharacterized membrane protein YHL071W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHL017W PE=1 SV=1 34 501 1.0E-63
sp|Q9Y7Y9|YOD2_SCHPO Uncharacterized membrane protein C18A7.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC18A7.02c PE=3 SV=1 32 433 1.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32857|PTM1_YEAST Membrane protein PTM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTM1 PE=1 SV=2 27 463 1.0E-81
sp|A6ZZS6|PTM1_YEAS7 Membrane protein PTM1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PTM1 PE=3 SV=1 27 463 1.0E-81
sp|O13989|YEG7_SCHPO Uncharacterized protein C26H5.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.07c PE=3 SV=2 32 537 4.0E-68
sp|P38745|YHB7_YEAST Uncharacterized membrane protein YHL071W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHL017W PE=1 SV=1 34 501 1.0E-63
sp|Q9Y7Y9|YOD2_SCHPO Uncharacterized membrane protein C18A7.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC18A7.02c PE=3 SV=1 32 433 1.0E-39
sp|Q28EW0|TM87A_XENTR Transmembrane protein 87A OS=Xenopus tropicalis GN=tmem87a PE=2 SV=1 169 491 4.0E-26
sp|Q8BKU8|TM87B_MOUSE Transmembrane protein 87B OS=Mus musculus GN=Tmem87b PE=2 SV=1 173 447 3.0E-22
sp|Q96K49|TM87B_HUMAN Transmembrane protein 87B OS=Homo sapiens GN=TMEM87B PE=1 SV=1 173 506 5.0E-22
sp|Q8NBN3|TM87A_HUMAN Transmembrane protein 87A OS=Homo sapiens GN=TMEM87A PE=1 SV=3 160 439 8.0E-18
sp|Q8BXN9|TM87A_MOUSE Transmembrane protein 87A OS=Mus musculus GN=Tmem87a PE=1 SV=1 160 439 1.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 184 206 22
2 218 237 19
3 252 274 22
4 295 314 19
5 324 346 22
6 367 389 22
7 404 426 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|825
MRLLPGLVGLGLTIGTAQALEVGMDQTEARRQYCTGMYSRSTWGGPIDPFILVKFINSTAPQIDDPIASIIIFEW
RDRNLVGVADPDFQGTQLEICRQDSVEKGHCNSTNLGEFILAPNATAESSDDIITRAVHLKTPEPIHYSIKKTGY
YCVVTDSFTADQYKAITEFRNAYGELPATQIPKLPFYGGMTILYALVSVFWGFLYYQHRHDILTVQKYITTILLF
LVVEMLMTWGFYDYQNRSGSNVGAKIFLIIVGILNAARNSFSFFLLLIVCMGYGVVKSTLGQTMVHVRWLAAAHF
VFGLVYAIASLLVSPESAGPFVLLIVLPLAGTLTAFYVWTLNSLSLTLKDLRERKQHAKEAMYKKLWWSILISVI
VIFGFFFFNSFTFASVGDPDFVPFHWKTRWFILDGWLNIVYFADVVWIAYLWRPTANNRRFAMSDEIAQDDDGNF
EIGDIGVPGDSDDDEEAQVGKPQRHEPPITGVTAAEPVPSTSGRPQGRSNLRQSLEGETIFAVGEEGDKFSDDGS
DEDANLVQANKK*
Coding >OphauB2|825
ATGAGGCTGCTTCCTGGCCTCGTTGGCCTGGGCTTGACTATAGGGACAGCCCAGGCTCTAGAAGTTGGCATGGAC
CAAACGGAAGCTCGCCGCCAATATTGCACTGGAATGTATAGCCGAAGCACTTGGGGAGGTCCCATCGATCCATTC
ATTCTCGTCAAGTTTATCAACTCTACCGCCCCTCAAATAGATGATCCAATAGCCAGCATCATAATCTTCGAATGG
CGCGACAGGAACTTGGTTGGCGTTGCAGATCCTGACTTTCAGGGAACTCAACTCGAAATCTGTCGCCAAGACTCG
GTTGAAAAGGGCCATTGCAACTCGACTAATCTCGGCGAGTTCATTCTTGCTCCAAACGCCACGGCAGAGTCCAGC
GATGATATTATTACCAGAGCCGTCCATCTCAAAACCCCGGAACCGATTCACTACTCAATCAAAAAGACAGGCTAT
TACTGTGTCGTCACTGATTCATTCACCGCTGACCAGTATAAAGCTATTACTGAATTCCGCAATGCCTACGGCGAG
CTGCCAGCAACACAGATCCCGAAACTTCCTTTCTATGGCGGTATGACCATACTGTACGCACTAGTGTCCGTCTTC
TGGGGCTTCTTATACTACCAACACCGCCATGACATTTTGACTGTCCAGAAATACATCACCACCATACTCCTGTTT
CTAGTCGTCGAAATGCTCATGACGTGGGGCTTCTATGACTATCAGAATCGCAGCGGCTCCAATGTAGGCGCCAAA
ATCTTCCTCATCATTGTTGGCATTCTCAACGCAGCCCGGAATTCCTTCTCCTTCTTTCTGCTCCTCATTGTATGC
ATGGGCTACGGCGTGGTCAAGTCAACACTGGGTCAAACCATGGTACATGTAAGATGGTTGGCTGCAGCACACTTT
GTCTTTGGGCTCGTGTATGCCATTGCCAGTCTCTTGGTCTCTCCAGAAAGCGCAGGGCCCTTTGTTCTGTTAATT
GTACTGCCTCTTGCCGGAACACTGACGGCTTTTTATGTCTGGACACTCAACTCTCTTAGCTTGACGCTCAAGGAT
CTAAGGGAGCGAAAGCAACACGCCAAAGAAGCCATGTATAAGAAACTCTGGTGGTCAATTCTTATCAGCGTCATC
GTCATTTTCGGCTTCTTTTTCTTCAACAGCTTTACTTTTGCCTCGGTCGGCGACCCAGACTTTGTACCATTTCAT
TGGAAGACGAGATGGTTTATCCTCGATGGCTGGCTAAATATTGTATACTTTGCCGATGTCGTCTGGATCGCCTAC
CTGTGGCGGCCAACAGCGAACAATCGCCGCTTTGCTATGAGCGATGAGATTGCACAAGACGACGACGGTAATTTC
GAAATTGGCGACATTGGCGTTCCTGGAGATTCAGACGATGACGAAGAGGCCCAAGTTGGGAAGCCACAGAGACAT
GAGCCTCCCATTACCGGTGTCACGGCAGCAGAGCCAGTGCCAAGTACTTCGGGACGGCCTCAAGGTCGCAGCAAT
CTGCGCCAGTCGCTCGAGGGAGAGACAATATTTGCCGTGGGTGAGGAAGGCGACAAGTTTTCCGATGATGGCAGC
GACGAGGATGCCAATTTAGTACAGGCCAATAAGAAGTGA
Transcript >OphauB2|825
ATGAGGCTGCTTCCTGGCCTCGTTGGCCTGGGCTTGACTATAGGGACAGCCCAGGCTCTAGAAGTTGGCATGGAC
CAAACGGAAGCTCGCCGCCAATATTGCACTGGAATGTATAGCCGAAGCACTTGGGGAGGTCCCATCGATCCATTC
ATTCTCGTCAAGTTTATCAACTCTACCGCCCCTCAAATAGATGATCCAATAGCCAGCATCATAATCTTCGAATGG
CGCGACAGGAACTTGGTTGGCGTTGCAGATCCTGACTTTCAGGGAACTCAACTCGAAATCTGTCGCCAAGACTCG
GTTGAAAAGGGCCATTGCAACTCGACTAATCTCGGCGAGTTCATTCTTGCTCCAAACGCCACGGCAGAGTCCAGC
GATGATATTATTACCAGAGCCGTCCATCTCAAAACCCCGGAACCGATTCACTACTCAATCAAAAAGACAGGCTAT
TACTGTGTCGTCACTGATTCATTCACCGCTGACCAGTATAAAGCTATTACTGAATTCCGCAATGCCTACGGCGAG
CTGCCAGCAACACAGATCCCGAAACTTCCTTTCTATGGCGGTATGACCATACTGTACGCACTAGTGTCCGTCTTC
TGGGGCTTCTTATACTACCAACACCGCCATGACATTTTGACTGTCCAGAAATACATCACCACCATACTCCTGTTT
CTAGTCGTCGAAATGCTCATGACGTGGGGCTTCTATGACTATCAGAATCGCAGCGGCTCCAATGTAGGCGCCAAA
ATCTTCCTCATCATTGTTGGCATTCTCAACGCAGCCCGGAATTCCTTCTCCTTCTTTCTGCTCCTCATTGTATGC
ATGGGCTACGGCGTGGTCAAGTCAACACTGGGTCAAACCATGGTACATGTAAGATGGTTGGCTGCAGCACACTTT
GTCTTTGGGCTCGTGTATGCCATTGCCAGTCTCTTGGTCTCTCCAGAAAGCGCAGGGCCCTTTGTTCTGTTAATT
GTACTGCCTCTTGCCGGAACACTGACGGCTTTTTATGTCTGGACACTCAACTCTCTTAGCTTGACGCTCAAGGAT
CTAAGGGAGCGAAAGCAACACGCCAAAGAAGCCATGTATAAGAAACTCTGGTGGTCAATTCTTATCAGCGTCATC
GTCATTTTCGGCTTCTTTTTCTTCAACAGCTTTACTTTTGCCTCGGTCGGCGACCCAGACTTTGTACCATTTCAT
TGGAAGACGAGATGGTTTATCCTCGATGGCTGGCTAAATATTGTATACTTTGCCGATGTCGTCTGGATCGCCTAC
CTGTGGCGGCCAACAGCGAACAATCGCCGCTTTGCTATGAGCGATGAGATTGCACAAGACGACGACGGTAATTTC
GAAATTGGCGACATTGGCGTTCCTGGAGATTCAGACGATGACGAAGAGGCCCAAGTTGGGAAGCCACAGAGACAT
GAGCCTCCCATTACCGGTGTCACGGCAGCAGAGCCAGTGCCAAGTACTTCGGGACGGCCTCAAGGTCGCAGCAAT
CTGCGCCAGTCGCTCGAGGGAGAGACAATATTTGCCGTGGGTGAGGAAGGCGACAAGTTTTCCGATGATGGCAGC
GACGAGGATGCCAATTTAGTACAGGCCAATAAGAAGTGA
Gene >OphauB2|825
ATGAGGCTGCTTCCTGGCCTCGTTGGCCTGGGCTTGACTATAGGGACAGCCCAGGCTCTAGAAGTTGGCATGGTC
TGCGAACCCTTGCATTCTGTTTCCCGGCTCTTGTGAATGCTTTCTGACTTCTCATAAAGGACCAAACGGAAGCTC
GCCGCCAATATTGCACTGGTTCGTTTCCTTCATGTCCTTGCGACACACTACCTGCCACTCTCGAGTCAAGCACAC
TCTGATGCCGTTGTTGCTCTCCAGGAATGTATAGCCGAAGCACTTGGGGAGGTCCCATCGATCCATTCATTCTCG
TCAAGTTTATCAACTCTACCGCCCCTCAAATAGATGATCCAATAGCCAGCATCATAATCTTCGAATGGCGCGACA
GGAACTTGGTTGGCGTTGCAGATCCTGACTTTCAGGGAACTGTAGGTCCTTTGCATTCTTGTTTTTTGAAAAGAA
ATGAACTGGAACCCGCTAACACGCCCTTTCCAGCAACTCGAAATCTGTCGCCAAGACTCGGTTGAAAAGGGCCAT
TGCAACTCGACTAATCTCGGCGAGTTCATTCTTGCTCCAAACGCCACGGCAGAGTCCAGCGATGATATTATTACC
AGAGCCGTCCATCTCAAAACCCCGGAACCGATTCACTACTCAATCAAAAAGACAGGCTATTACTGTGTCGTCACT
GATTCATTCACCGCTGACCAGTATAAAGCTATTACTGAATTCCGCAATGCCTACGGCGAGCTGCCAGCAACACAG
ATCCCGAAACTTCCTTTCTATGGCGGTATGACCATACTGTACGCACTAGTGTCCGTCTTCTGGGGCTTCTTATAC
TACCAACACCGCCATGACATTTGTGAGATGATTCACGTCCGCCCGTCAATGTCGTACAACCTACTCATCAGATTA
TAGTGACTGTCCAGAAATACATCACCACCATACTCCTGTTTCTAGTCGTCGAAATGCTCATGACGTGGGGCTTCT
ATGGTAAGCTTTTGTCCAATCGTGGGTAAATGGAGCACTAATATTTTTACTTGATTCATAGACTATCAGAATCGC
AGCGGCTCCAATGTAGGCGCCAAAATCTTCCTCATCATTGTTGGCATTCTCAACGCAGCCCGGAATTCCTTCTCC
TTCTTTCTGCTCCTCATTGTATGCATGGGCTACGGCGTGGTCAAGTCAACACTGGGTCAAACCATGGTACATGTA
AGATGGTTGGCTGCAGCACACTTTGTCTTTGGGCTCGTGTATGCCATTGCCAGTCTCTTGGTCTCTCCAGAAAGC
GCAGGTAGGTGCCGGTCATCACAGATTATACGAGAAACTCAAAACGCTGACCGCGTTCTTGTCGCAGGGCCCTTT
GTTCTGTTAATTGTACTGCCTCTTGCCGGAACACTGACGGCTTTTTATGTCTGGACACTCAACTCTCTTAGCTTG
ACGCTCAAGGATCTAAGGGAGCGAAAGCAACACGCCAAAGAAGCCATGTATAAGAAACTCTGGTGGTCAATTCTT
ATCAGCGTCATCGTCATTTTCGGCTTCTTTTTCTTCAACAGCTTTACTTTTGCCTCGGTCGGCGACCCAGACTTT
GTACCATTTCATTGGAAGACGAGATGGTTTATCCTCGATGGCTGGCTAAATATTGTATACTTTGCCGATGTCGTC
TGGATCGCCTACCTGTGGCGGCCAACAGCGAACAATCGCCGCTTTGCTATGAGCGATGAGATTGCACAAGACGAC
GACGGTAATTTCGAAATTGGCGACATTGGCGTTCCTGGAGATTCAGACGATGACGAAGAGGCCCAAGTTGGGAAG
CCACAGAGACATGAGCCTCCCATTACCGGTGTCACGGCAGCAGAGCCAGTGCCAAGTACTTCGGGACGGCCTCAA
GGTCGCAGCAATCTGCGCCAGTCGCTCGAGGGAGAGACAATATTTGCCGTGGGTGAGGAAGGCGACAAGTTTTCC
GATGATGGCAGCGACGAGGATGCCAATTTAGTACAGGCCAATAAGAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail