Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|819
Gene name
LocationContig_118:24498..26060
Strand+
Gene length (bp)1562
Transcript length (bp)1173
Coding sequence length (bp)1173
Protein length (aa) 391

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05026 DCP2 Dcp2, box A domain 1.5E-31 11 94
PF00293 NUDIX NUDIX domain 3.1E-16 99 221

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13828|DCP2_SCHPO mRNA decapping complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dcp2 PE=1 SV=1 13 248 4.0E-86
sp|Q8GW31|DCP2_ARATH mRNA-decapping enzyme subunit 2 OS=Arabidopsis thaliana GN=DCP2 PE=1 SV=1 13 248 2.0E-63
sp|Q9CYC6|DCP2_MOUSE m7GpppN-mRNA hydrolase OS=Mus musculus GN=Dcp2 PE=1 SV=2 13 274 4.0E-61
sp|Q8IU60|DCP2_HUMAN m7GpppN-mRNA hydrolase OS=Homo sapiens GN=DCP2 PE=1 SV=2 13 274 3.0E-60
sp|Q5REQ8|DCP2_PONAB m7GpppN-mRNA hydrolase OS=Pongo abelii GN=DCP2 PE=2 SV=1 13 274 8.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13828|DCP2_SCHPO mRNA decapping complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dcp2 PE=1 SV=1 13 248 4.0E-86
sp|Q8GW31|DCP2_ARATH mRNA-decapping enzyme subunit 2 OS=Arabidopsis thaliana GN=DCP2 PE=1 SV=1 13 248 2.0E-63
sp|Q9CYC6|DCP2_MOUSE m7GpppN-mRNA hydrolase OS=Mus musculus GN=Dcp2 PE=1 SV=2 13 274 4.0E-61
sp|Q8IU60|DCP2_HUMAN m7GpppN-mRNA hydrolase OS=Homo sapiens GN=DCP2 PE=1 SV=2 13 274 3.0E-60
sp|Q5REQ8|DCP2_PONAB m7GpppN-mRNA hydrolase OS=Pongo abelii GN=DCP2 PE=2 SV=1 13 274 8.0E-60
sp|Q75BK1|DCP2_ASHGO mRNA-decapping enzyme subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DCP2 PE=3 SV=1 7 255 6.0E-59
sp|A6ZRW5|DCP2_YEAS7 mRNA-decapping enzyme subunit 2 OS=Saccharomyces cerevisiae (strain YJM789) GN=DCP2 PE=3 SV=1 13 248 3.0E-51
sp|P53550|DCP2_YEAST mRNA-decapping enzyme subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCP2 PE=1 SV=1 13 248 3.0E-51
sp|O62255|DCP2_CAEEL mRNA-decapping enzyme 2 OS=Caenorhabditis elegans GN=dcap-2 PE=2 SV=4 11 265 2.0E-46
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|819
MAQKSQMQLEDWLDDLCVRFIINLPQEDLSSVARICFQVEEAQWFYEDFIRPLDPTLPSMTLRTFCLRIFQHCPL
LASFSIENHTKAFEEFLQYKTRVPVRGAIMLNQAMDSVVLVKGWKKGASWSFPRGKINKDEDDLDCAIREVYEET
GLDLRASNLVPTDKKPKYIEITMREQQLRLYVFRNVPMDTHFQPRTRKEISKIQWYKLSELPSFRKKGAPNQQDT
ASTSQINKFYMVAPFLVPLKKWIASVKKMEERRTVSGFQTNHEQPPRNTSSQHILTQEAPMTEDDTHHHSHKPPT
QGIQPLSQLNAFSQVPQTPLDQIATEPPPPPLNPHHRSNQQPRHEIPQRHADGQSPTQGPLKTGYSQKQPYQAKR
PFNGAPRRIQTRSDK*
Coding >OphauB2|819
ATGGCCCAAAAATCACAAATGCAATTAGAGGACTGGCTGGACGACCTTTGTGTCCGCTTCATAATCAACCTTCCT
CAAGAAGACTTGTCCTCGGTTGCCAGAATATGCTTTCAAGTTGAAGAAGCTCAGTGGTTCTATGAAGACTTTATT
CGACCACTTGACCCTACGCTCCCTTCAATGACCCTGCGCACTTTTTGCCTGCGCATCTTCCAACACTGTCCACTC
CTCGCTTCCTTCTCCATCGAGAACCATACCAAGGCCTTCGAAGAATTCCTACAATATAAGACTCGTGTCCCTGTT
CGAGGCGCCATAATGCTCAATCAAGCCATGGACTCCGTAGTGCTCGTCAAGGGCTGGAAGAAAGGCGCTAGCTGG
AGCTTTCCTCGCGGCAAGATCAACAAGGATGAAGATGACCTTGACTGTGCCATACGAGAAGTCTATGAGGAAACG
GGCCTCGATCTGCGTGCCTCCAACCTGGTACCAACTGACAAGAAGCCCAAGTACATCGAAATCACCATGAGAGAG
CAGCAGCTTCGCCTTTACGTCTTCCGCAACGTTCCAATGGATACTCATTTTCAGCCTCGAACGAGGAAGGAAATC
AGCAAAATCCAGTGGTACAAGCTCTCAGAGCTTCCGTCCTTTCGCAAAAAGGGTGCCCCGAACCAACAGGATACC
GCATCCACCTCACAGATAAACAAATTCTACATGGTTGCCCCGTTTCTTGTCCCACTCAAAAAATGGATTGCTTCC
GTCAAGAAGATGGAGGAGCGTCGAACTGTCAGCGGTTTCCAGACCAACCACGAACAACCGCCTCGCAACACCAGC
AGTCAGCACATTTTGACGCAAGAAGCCCCCATGACGGAAGACGATACACATCACCACTCACATAAACCGCCCACC
CAAGGCATTCAACCCTTATCTCAGCTCAATGCCTTTTCTCAAGTGCCGCAAACGCCGCTGGACCAGATTGCCACA
GAACCACCACCGCCGCCACTTAATCCTCACCATCGCAGCAATCAGCAACCTAGACATGAAATTCCACAACGGCAC
GCTGATGGCCAGAGCCCAACGCAGGGGCCGCTAAAGACAGGCTACAGCCAAAAACAGCCATATCAAGCTAAACGG
CCATTCAATGGCGCTCCTCGACGCATTCAAACGCGATCCGACAAGTAG
Transcript >OphauB2|819
ATGGCCCAAAAATCACAAATGCAATTAGAGGACTGGCTGGACGACCTTTGTGTCCGCTTCATAATCAACCTTCCT
CAAGAAGACTTGTCCTCGGTTGCCAGAATATGCTTTCAAGTTGAAGAAGCTCAGTGGTTCTATGAAGACTTTATT
CGACCACTTGACCCTACGCTCCCTTCAATGACCCTGCGCACTTTTTGCCTGCGCATCTTCCAACACTGTCCACTC
CTCGCTTCCTTCTCCATCGAGAACCATACCAAGGCCTTCGAAGAATTCCTACAATATAAGACTCGTGTCCCTGTT
CGAGGCGCCATAATGCTCAATCAAGCCATGGACTCCGTAGTGCTCGTCAAGGGCTGGAAGAAAGGCGCTAGCTGG
AGCTTTCCTCGCGGCAAGATCAACAAGGATGAAGATGACCTTGACTGTGCCATACGAGAAGTCTATGAGGAAACG
GGCCTCGATCTGCGTGCCTCCAACCTGGTACCAACTGACAAGAAGCCCAAGTACATCGAAATCACCATGAGAGAG
CAGCAGCTTCGCCTTTACGTCTTCCGCAACGTTCCAATGGATACTCATTTTCAGCCTCGAACGAGGAAGGAAATC
AGCAAAATCCAGTGGTACAAGCTCTCAGAGCTTCCGTCCTTTCGCAAAAAGGGTGCCCCGAACCAACAGGATACC
GCATCCACCTCACAGATAAACAAATTCTACATGGTTGCCCCGTTTCTTGTCCCACTCAAAAAATGGATTGCTTCC
GTCAAGAAGATGGAGGAGCGTCGAACTGTCAGCGGTTTCCAGACCAACCACGAACAACCGCCTCGCAACACCAGC
AGTCAGCACATTTTGACGCAAGAAGCCCCCATGACGGAAGACGATACACATCACCACTCACATAAACCGCCCACC
CAAGGCATTCAACCCTTATCTCAGCTCAATGCCTTTTCTCAAGTGCCGCAAACGCCGCTGGACCAGATTGCCACA
GAACCACCACCGCCGCCACTTAATCCTCACCATCGCAGCAATCAGCAACCTAGACATGAAATTCCACAACGGCAC
GCTGATGGCCAGAGCCCAACGCAGGGGCCGCTAAAGACAGGCTACAGCCAAAAACAGCCATATCAAGCTAAACGG
CCATTCAATGGCGCTCCTCGACGCATTCAAACGCGATCCGACAAGTAG
Gene >OphauB2|819
ATGGCCCAAAAATCACAAATGCAATTAGAGGACTGTATGTTGCCCAAGCACCTCTAGAGCGCTTCGTGGCAAACA
TGGTGCTGACCCAACCTGACAGGGCTGGACGACCTTTGTGTCCGCTTCATAATCAACCTTCCTCAAGAAGACTTG
TCCTCGGTTGCCAGAATATGCTTTCAAGTTGAAGAAGCTCAGTGGTTCTATGAAGACTTTATTCGACCACTTGAC
CCTACGCTCCCTTCAATGACCCTGCGCACTTTTTGCCTGCGCATCTTCCAACACTGTCCACTCCTCGCTTCCTTC
TCCATCGAGAACCATACCAAGGCCTTCGAAGAATTCCTACAATATAAGACTCGTGTCCCTGTTCGAGGCGCCATA
ATGCTCAATCAAGCCATGGACTCCGTAGTGCTCGTCAAGGGCTGGAAGAAAGGCGCTAGCTGGAGCTTTCCTCGC
GGCAAGATCAACAAGGATGAAGATGACCTTGACTGTGCCATACGAGAAGTCTATGAGGAAACGGGCCTCGATCTG
CGTGCCTCCAACCTGGTACCAACTGACAAGAAGCCCAAGTACATCGAAATCACCATGAGAGAGCAGCAGCTTCGC
CTTTACGTCTTCCGCAACGTTCCAATGGATACTCATTTTCAGCCTCGAACGAGGAAGGAAATCAGCAAAATCCAG
TGGTACAAGCTCTCAGAGCTTCCGTCCTTTCGCAAAAAGGGTGCCCCGAACCAACAGGATACCGCATCCACCTCA
CAGATAAACAAATTCTACATGGTTGCCCCGTTTCTTGTCCCACTCAAAAAATGGATTGCTTCCGTCAAGAAGATG
GAGGAGCGTCGAACTGTCAGCGGTTTCCAGACCAACCACGAACAACCGCCTCGCAACACCAGCAGTCAGCACATT
TTGACGCAAGAAGCCCCCATGACGGAAGACGATACACATCACCACTCACATAAAGTTCCCGCTATTGATACTCTT
GACGGTGCCACTAAAGAGCTTCAGCGCTTGTTGAAAGGGCAGCCGCCCACCCAAGGCATTCAACCCTTATCTCAG
CTCAATGTTCAACCTGAAGACAAAGGCAGCGCACTTCTATCGTTACTAAAAGCCAACGACGGTCAAAATCCAAAG
GCCTTTTCTCAAGTGCCGCAAACGCCGCTGGACCAGATTGCCACAGAACCACCACCGCCGCCACTTAATCCTCAC
CATCGCAGCAATCAGCAACCTGTCTTGTGGGAATCCTACGCCCATCAATCCCCTCGGGCTTTCAACCAAAACCAC
ACAGCCTCATCTGTGACCCATCCCCAGAGACATGTCAGCGATTCACAGATTCCCACCAAGACTTCTTACCCATCA
CAGCAACTCAACCTTATACAGGAAATTCCACAACGGCACGCTGATGGCCAGAGCCCAACGCAGGGGCCGCTAAAG
ACAGGCTACAGCCAAAAACAGCCATATCAAGGTCAAATGCCACACCGAACAGTCAGCGCTTTGAGACCTTTACCA
CTACAGCTAAACGGCCATTCAATGGCGCTCCTCGACGCATTCAAACGCGATCCGACAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail