Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|819
Gene name
LocationContig_118:24498..26060
Strand+
Gene length (bp)1562
Transcript length (bp)1173
Coding sequence length (bp)1173
Protein length (aa) 391

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05026 DCP2 Dcp2, box A domain 1.5E-31 11 94
PF00293 NUDIX NUDIX domain 3.1E-16 99 221

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13828|DCP2_SCHPO mRNA decapping complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dcp2 PE=1 SV=1 13 248 4.0E-86
sp|Q8GW31|DCP2_ARATH mRNA-decapping enzyme subunit 2 OS=Arabidopsis thaliana GN=DCP2 PE=1 SV=1 13 248 2.0E-63
sp|Q9CYC6|DCP2_MOUSE m7GpppN-mRNA hydrolase OS=Mus musculus GN=Dcp2 PE=1 SV=2 13 274 4.0E-61
sp|Q8IU60|DCP2_HUMAN m7GpppN-mRNA hydrolase OS=Homo sapiens GN=DCP2 PE=1 SV=2 13 274 3.0E-60
sp|Q5REQ8|DCP2_PONAB m7GpppN-mRNA hydrolase OS=Pongo abelii GN=DCP2 PE=2 SV=1 13 274 8.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13828|DCP2_SCHPO mRNA decapping complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dcp2 PE=1 SV=1 13 248 4.0E-86
sp|Q8GW31|DCP2_ARATH mRNA-decapping enzyme subunit 2 OS=Arabidopsis thaliana GN=DCP2 PE=1 SV=1 13 248 2.0E-63
sp|Q9CYC6|DCP2_MOUSE m7GpppN-mRNA hydrolase OS=Mus musculus GN=Dcp2 PE=1 SV=2 13 274 4.0E-61
sp|Q8IU60|DCP2_HUMAN m7GpppN-mRNA hydrolase OS=Homo sapiens GN=DCP2 PE=1 SV=2 13 274 3.0E-60
sp|Q5REQ8|DCP2_PONAB m7GpppN-mRNA hydrolase OS=Pongo abelii GN=DCP2 PE=2 SV=1 13 274 8.0E-60
sp|Q75BK1|DCP2_ASHGO mRNA-decapping enzyme subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DCP2 PE=3 SV=1 7 255 6.0E-59
sp|A6ZRW5|DCP2_YEAS7 mRNA-decapping enzyme subunit 2 OS=Saccharomyces cerevisiae (strain YJM789) GN=DCP2 PE=3 SV=1 13 248 3.0E-51
sp|P53550|DCP2_YEAST mRNA-decapping enzyme subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCP2 PE=1 SV=1 13 248 3.0E-51
sp|O62255|DCP2_CAEEL mRNA-decapping enzyme 2 OS=Caenorhabditis elegans GN=dcap-2 PE=2 SV=4 11 265 2.0E-46
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5182
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2336
Ophiocordyceps australis map64 (Brazil) OphauB2|819 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05659
Ophiocordyceps camponoti-rufipedis Ophun1|815
Ophiocordyceps kimflemingae Ophio5|6272
Ophiocordyceps subramaniannii Hirsu2|3910

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|819
MAQKSQMQLEDWLDDLCVRFIINLPQEDLSSVARICFQVEEAQWFYEDFIRPLDPTLPSMTLRTFCLRIFQHCPL
LASFSIENHTKAFEEFLQYKTRVPVRGAIMLNQAMDSVVLVKGWKKGASWSFPRGKINKDEDDLDCAIREVYEET
GLDLRASNLVPTDKKPKYIEITMREQQLRLYVFRNVPMDTHFQPRTRKEISKIQWYKLSELPSFRKKGAPNQQDT
ASTSQINKFYMVAPFLVPLKKWIASVKKMEERRTVSGFQTNHEQPPRNTSSQHILTQEAPMTEDDTHHHSHKPPT
QGIQPLSQLNAFSQVPQTPLDQIATEPPPPPLNPHHRSNQQPRHEIPQRHADGQSPTQGPLKTGYSQKQPYQAKR
PFNGAPRRIQTRSDK*
Coding >OphauB2|819
ATGGCCCAAAAATCACAAATGCAATTAGAGGACTGGCTGGACGACCTTTGTGTCCGCTTCATAATCAACCTTCCT
CAAGAAGACTTGTCCTCGGTTGCCAGAATATGCTTTCAAGTTGAAGAAGCTCAGTGGTTCTATGAAGACTTTATT
CGACCACTTGACCCTACGCTCCCTTCAATGACCCTGCGCACTTTTTGCCTGCGCATCTTCCAACACTGTCCACTC
CTCGCTTCCTTCTCCATCGAGAACCATACCAAGGCCTTCGAAGAATTCCTACAATATAAGACTCGTGTCCCTGTT
CGAGGCGCCATAATGCTCAATCAAGCCATGGACTCCGTAGTGCTCGTCAAGGGCTGGAAGAAAGGCGCTAGCTGG
AGCTTTCCTCGCGGCAAGATCAACAAGGATGAAGATGACCTTGACTGTGCCATACGAGAAGTCTATGAGGAAACG
GGCCTCGATCTGCGTGCCTCCAACCTGGTACCAACTGACAAGAAGCCCAAGTACATCGAAATCACCATGAGAGAG
CAGCAGCTTCGCCTTTACGTCTTCCGCAACGTTCCAATGGATACTCATTTTCAGCCTCGAACGAGGAAGGAAATC
AGCAAAATCCAGTGGTACAAGCTCTCAGAGCTTCCGTCCTTTCGCAAAAAGGGTGCCCCGAACCAACAGGATACC
GCATCCACCTCACAGATAAACAAATTCTACATGGTTGCCCCGTTTCTTGTCCCACTCAAAAAATGGATTGCTTCC
GTCAAGAAGATGGAGGAGCGTCGAACTGTCAGCGGTTTCCAGACCAACCACGAACAACCGCCTCGCAACACCAGC
AGTCAGCACATTTTGACGCAAGAAGCCCCCATGACGGAAGACGATACACATCACCACTCACATAAACCGCCCACC
CAAGGCATTCAACCCTTATCTCAGCTCAATGCCTTTTCTCAAGTGCCGCAAACGCCGCTGGACCAGATTGCCACA
GAACCACCACCGCCGCCACTTAATCCTCACCATCGCAGCAATCAGCAACCTAGACATGAAATTCCACAACGGCAC
GCTGATGGCCAGAGCCCAACGCAGGGGCCGCTAAAGACAGGCTACAGCCAAAAACAGCCATATCAAGCTAAACGG
CCATTCAATGGCGCTCCTCGACGCATTCAAACGCGATCCGACAAGTAG
Transcript >OphauB2|819
ATGGCCCAAAAATCACAAATGCAATTAGAGGACTGGCTGGACGACCTTTGTGTCCGCTTCATAATCAACCTTCCT
CAAGAAGACTTGTCCTCGGTTGCCAGAATATGCTTTCAAGTTGAAGAAGCTCAGTGGTTCTATGAAGACTTTATT
CGACCACTTGACCCTACGCTCCCTTCAATGACCCTGCGCACTTTTTGCCTGCGCATCTTCCAACACTGTCCACTC
CTCGCTTCCTTCTCCATCGAGAACCATACCAAGGCCTTCGAAGAATTCCTACAATATAAGACTCGTGTCCCTGTT
CGAGGCGCCATAATGCTCAATCAAGCCATGGACTCCGTAGTGCTCGTCAAGGGCTGGAAGAAAGGCGCTAGCTGG
AGCTTTCCTCGCGGCAAGATCAACAAGGATGAAGATGACCTTGACTGTGCCATACGAGAAGTCTATGAGGAAACG
GGCCTCGATCTGCGTGCCTCCAACCTGGTACCAACTGACAAGAAGCCCAAGTACATCGAAATCACCATGAGAGAG
CAGCAGCTTCGCCTTTACGTCTTCCGCAACGTTCCAATGGATACTCATTTTCAGCCTCGAACGAGGAAGGAAATC
AGCAAAATCCAGTGGTACAAGCTCTCAGAGCTTCCGTCCTTTCGCAAAAAGGGTGCCCCGAACCAACAGGATACC
GCATCCACCTCACAGATAAACAAATTCTACATGGTTGCCCCGTTTCTTGTCCCACTCAAAAAATGGATTGCTTCC
GTCAAGAAGATGGAGGAGCGTCGAACTGTCAGCGGTTTCCAGACCAACCACGAACAACCGCCTCGCAACACCAGC
AGTCAGCACATTTTGACGCAAGAAGCCCCCATGACGGAAGACGATACACATCACCACTCACATAAACCGCCCACC
CAAGGCATTCAACCCTTATCTCAGCTCAATGCCTTTTCTCAAGTGCCGCAAACGCCGCTGGACCAGATTGCCACA
GAACCACCACCGCCGCCACTTAATCCTCACCATCGCAGCAATCAGCAACCTAGACATGAAATTCCACAACGGCAC
GCTGATGGCCAGAGCCCAACGCAGGGGCCGCTAAAGACAGGCTACAGCCAAAAACAGCCATATCAAGCTAAACGG
CCATTCAATGGCGCTCCTCGACGCATTCAAACGCGATCCGACAAGTAG
Gene >OphauB2|819
ATGGCCCAAAAATCACAAATGCAATTAGAGGACTGTATGTTGCCCAAGCACCTCTAGAGCGCTTCGTGGCAAACA
TGGTGCTGACCCAACCTGACAGGGCTGGACGACCTTTGTGTCCGCTTCATAATCAACCTTCCTCAAGAAGACTTG
TCCTCGGTTGCCAGAATATGCTTTCAAGTTGAAGAAGCTCAGTGGTTCTATGAAGACTTTATTCGACCACTTGAC
CCTACGCTCCCTTCAATGACCCTGCGCACTTTTTGCCTGCGCATCTTCCAACACTGTCCACTCCTCGCTTCCTTC
TCCATCGAGAACCATACCAAGGCCTTCGAAGAATTCCTACAATATAAGACTCGTGTCCCTGTTCGAGGCGCCATA
ATGCTCAATCAAGCCATGGACTCCGTAGTGCTCGTCAAGGGCTGGAAGAAAGGCGCTAGCTGGAGCTTTCCTCGC
GGCAAGATCAACAAGGATGAAGATGACCTTGACTGTGCCATACGAGAAGTCTATGAGGAAACGGGCCTCGATCTG
CGTGCCTCCAACCTGGTACCAACTGACAAGAAGCCCAAGTACATCGAAATCACCATGAGAGAGCAGCAGCTTCGC
CTTTACGTCTTCCGCAACGTTCCAATGGATACTCATTTTCAGCCTCGAACGAGGAAGGAAATCAGCAAAATCCAG
TGGTACAAGCTCTCAGAGCTTCCGTCCTTTCGCAAAAAGGGTGCCCCGAACCAACAGGATACCGCATCCACCTCA
CAGATAAACAAATTCTACATGGTTGCCCCGTTTCTTGTCCCACTCAAAAAATGGATTGCTTCCGTCAAGAAGATG
GAGGAGCGTCGAACTGTCAGCGGTTTCCAGACCAACCACGAACAACCGCCTCGCAACACCAGCAGTCAGCACATT
TTGACGCAAGAAGCCCCCATGACGGAAGACGATACACATCACCACTCACATAAAGTTCCCGCTATTGATACTCTT
GACGGTGCCACTAAAGAGCTTCAGCGCTTGTTGAAAGGGCAGCCGCCCACCCAAGGCATTCAACCCTTATCTCAG
CTCAATGTTCAACCTGAAGACAAAGGCAGCGCACTTCTATCGTTACTAAAAGCCAACGACGGTCAAAATCCAAAG
GCCTTTTCTCAAGTGCCGCAAACGCCGCTGGACCAGATTGCCACAGAACCACCACCGCCGCCACTTAATCCTCAC
CATCGCAGCAATCAGCAACCTGTCTTGTGGGAATCCTACGCCCATCAATCCCCTCGGGCTTTCAACCAAAACCAC
ACAGCCTCATCTGTGACCCATCCCCAGAGACATGTCAGCGATTCACAGATTCCCACCAAGACTTCTTACCCATCA
CAGCAACTCAACCTTATACAGGAAATTCCACAACGGCACGCTGATGGCCAGAGCCCAACGCAGGGGCCGCTAAAG
ACAGGCTACAGCCAAAAACAGCCATATCAAGGTCAAATGCCACACCGAACAGTCAGCGCTTTGAGACCTTTACCA
CTACAGCTAAACGGCCATTCAATGGCGCTCCTCGACGCATTCAAACGCGATCCGACAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail