Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8163
Gene name
LocationContig_99:40467..41306
Strand-
Gene length (bp)839
Transcript length (bp)753
Coding sequence length (bp)753
Protein length (aa) 251

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05739 SNARE SNARE domain 2.3E-08 197 247

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q63635|STX6_RAT Syntaxin-6 OS=Rattus norvegicus GN=Stx6 PE=1 SV=1 41 237 2.0E-07
sp|P83528|STX6_CAEEL Putative syntaxin 6 OS=Caenorhabditis elegans GN=syx-6 PE=3 SV=1 145 238 3.0E-07
sp|O60499|STX10_HUMAN Syntaxin-10 OS=Homo sapiens GN=STX10 PE=1 SV=1 162 235 1.0E-06
sp|Q9JKK1|STX6_MOUSE Syntaxin-6 OS=Mus musculus GN=Stx6 PE=1 SV=1 162 235 2.0E-06
sp|Q946Y7|SYP61_ARATH Syntaxin-61 OS=Arabidopsis thaliana GN=SYP61 PE=1 SV=1 162 249 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q63635|STX6_RAT Syntaxin-6 OS=Rattus norvegicus GN=Stx6 PE=1 SV=1 41 237 2.0E-07
sp|P83528|STX6_CAEEL Putative syntaxin 6 OS=Caenorhabditis elegans GN=syx-6 PE=3 SV=1 145 238 3.0E-07
sp|O60499|STX10_HUMAN Syntaxin-10 OS=Homo sapiens GN=STX10 PE=1 SV=1 162 235 1.0E-06
sp|Q9JKK1|STX6_MOUSE Syntaxin-6 OS=Mus musculus GN=Stx6 PE=1 SV=1 162 235 2.0E-06
sp|Q946Y7|SYP61_ARATH Syntaxin-61 OS=Arabidopsis thaliana GN=SYP61 PE=1 SV=1 162 249 2.0E-06
sp|Q5R6Q2|STX6_PONAB Syntaxin-6 OS=Pongo abelii GN=STX6 PE=2 SV=1 41 235 2.0E-06
sp|O43752|STX6_HUMAN Syntaxin-6 OS=Homo sapiens GN=STX6 PE=1 SV=1 41 235 2.0E-06
sp|Q54IX6|STX8B_DICDI Probable syntaxin-8B OS=Dictyostelium discoideum GN=syn8B PE=3 SV=1 147 227 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 232 249 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8163
MSKANQLFLLADHIKLSLLERQRAQSFELDSDGQDGHLARSLDQFRSGLAALEQELDKTDDEASKSTVASLRKQF
DDLTAQHQGLVDASSQATLEHANSPLLAQDFAHASTRRVSKTVRFSDSPSRNPRPGLVPYRDDPPAAQGDETPDL
SNQQLHEYHSQVLDEQDQQLDRLGESIGRQRELSMQIGHELDNHVAMLDEVDNAANRHQDRLDGARKTLAKVAKG
AGENKQMTAIVVLIIILVVLIALLK*
Coding >OphauB2|8163
ATGTCCAAGGCAAACCAACTCTTTTTGCTGGCAGACCACATCAAACTATCGCTTCTCGAACGGCAGCGAGCCCAG
AGCTTTGAACTTGACAGCGACGGCCAGGATGGACACTTGGCGCGCTCGCTCGACCAGTTCCGCAGCGGCCTCGCC
GCCCTGGAGCAAGAGCTCGACAAGACCGACGACGAAGCCTCAAAGTCAACCGTTGCCTCGCTGCGCAAGCAATTC
GACGACTTGACGGCCCAGCACCAGGGCCTCGTCGACGCATCCTCGCAAGCCACGCTCGAGCACGCAAACTCGCCC
CTCCTCGCCCAAGACTTTGCCCACGCGTCGACGCGCCGCGTCAGCAAGACGGTGCGCTTCAGCGACTCGCCGTCG
CGCAACCCTCGCCCCGGCTTGGTTCCCTATCGCGATGACCCGCCCGCCGCACAGGGCGATGAGACGCCCGACTTG
TCCAACCAGCAACTCCACGAATATCACTCCCAGGTCCTTGACGAACAGGACCAGCAGCTCGACCGACTGGGCGAG
TCAATTGGCAGGCAACGCGAACTGAGCATGCAAATTGGCCATGAGCTCGACAACCACGTCGCCATGCTCGACGAG
GTTGACAATGCCGCAAACCGCCACCAGGACCGTCTAGACGGCGCAAGGAAGACGCTGGCCAAGGTGGCAAAAGGC
GCAGGCGAGAATAAGCAAATGACTGCCATTGTGGTGCTCATCATTATCCTCGTCGTATTGATTGCTCTTCTCAAG
TAA
Transcript >OphauB2|8163
ATGTCCAAGGCAAACCAACTCTTTTTGCTGGCAGACCACATCAAACTATCGCTTCTCGAACGGCAGCGAGCCCAG
AGCTTTGAACTTGACAGCGACGGCCAGGATGGACACTTGGCGCGCTCGCTCGACCAGTTCCGCAGCGGCCTCGCC
GCCCTGGAGCAAGAGCTCGACAAGACCGACGACGAAGCCTCAAAGTCAACCGTTGCCTCGCTGCGCAAGCAATTC
GACGACTTGACGGCCCAGCACCAGGGCCTCGTCGACGCATCCTCGCAAGCCACGCTCGAGCACGCAAACTCGCCC
CTCCTCGCCCAAGACTTTGCCCACGCGTCGACGCGCCGCGTCAGCAAGACGGTGCGCTTCAGCGACTCGCCGTCG
CGCAACCCTCGCCCCGGCTTGGTTCCCTATCGCGATGACCCGCCCGCCGCACAGGGCGATGAGACGCCCGACTTG
TCCAACCAGCAACTCCACGAATATCACTCCCAGGTCCTTGACGAACAGGACCAGCAGCTCGACCGACTGGGCGAG
TCAATTGGCAGGCAACGCGAACTGAGCATGCAAATTGGCCATGAGCTCGACAACCACGTCGCCATGCTCGACGAG
GTTGACAATGCCGCAAACCGCCACCAGGACCGTCTAGACGGCGCAAGGAAGACGCTGGCCAAGGTGGCAAAAGGC
GCAGGCGAGAATAAGCAAATGACTGCCATTGTGGTGCTCATCATTATCCTCGTCGTATTGATTGCTCTTCTCAAG
TAA
Gene >OphauB2|8163
ATGTCCAAGGCAAACCAACTCTTTTTGCTGGCAGACCACATCAAACTATCGCTTCTCGAACGGCAGCGAGCCCAG
AGCTTTGAACTTGACAGCGACGGCCAGGATGGACACTTGGCGCGCTCGCTCGACCAGTTCCGCAGCGGCCTCGCC
GCCCTGGAGCAAGAGCTCGACAAGACCGACGACGAGTACACCTCCCTTTTGTTGCCTTGGCCCAATCATATCATG
CCGCTGACCCATCCGCCGCCGCCGCCGCTCTGCCCCCACTGCTTAGAGCCTCAAAGTCAACCGTTGCCTCGCTGC
GCAAGCAATTCGACGACTTGACGGCCCAGCACCAGGGCCTCGTCGACGCATCCTCGCAAGCCACGCTCGAGCACG
CAAACTCGCCCCTCCTCGCCCAAGACTTTGCCCACGCGTCGACGCGCCGCGTCAGCAAGACGGTGCGCTTCAGCG
ACTCGCCGTCGCGCAACCCTCGCCCCGGCTTGGTTCCCTATCGCGATGACCCGCCCGCCGCACAGGGCGATGAGA
CGCCCGACTTGTCCAACCAGCAACTCCACGAATATCACTCCCAGGTCCTTGACGAACAGGACCAGCAGCTCGACC
GACTGGGCGAGTCAATTGGCAGGCAACGCGAACTGAGCATGCAAATTGGCCATGAGCTCGACAACCACGTCGCCA
TGCTCGACGAGGTTGACAATGCCGCAAACCGCCACCAGGACCGTCTAGACGGCGCAAGGAAGACGCTGGCCAAGG
TGGCAAAAGGCGCAGGCGAGAATAAGCAAATGACTGCCATTGTGGTGCTCATCATTATCCTCGTCGTATTGATTG
CTCTTCTCAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail