Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8154
Gene name
LocationContig_99:23528..24239
Strand-
Gene length (bp)711
Transcript length (bp)711
Coding sequence length (bp)711
Protein length (aa) 237

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17242 DUF5315 Disordered region of unknown function (DUF5315) 1.7E-23 100 164

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5317
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|395
Ophiocordyceps australis map64 (Brazil) OphauB2|8154 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|592
Ophiocordyceps kimflemingae Ophio5|1865
Ophiocordyceps subramaniannii Hirsu2|4937

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8154
MTASQPADNRGNNQEADGRTLAESLSKTRSKQRVPPPRLFLRPSPGTSHVSLPSILSSGAPALGYHNGERLGSGN
DGNATLNPGLIAPVSLERGKRALQTAGSTRSTDRTDALWAEMQATLEEVELSASGDTHVFGPGHDGKLAELRKAQ
IELAHACAKYKVDDSTLPTGGNLATEDEPQEPDILLAREKRREANNEYFRCVNEGVVAVVAKLEDVAVAMREVEK
ESKEVWSEGTA*
Coding >OphauB2|8154
ATGACTGCCAGTCAGCCTGCAGATAACCGCGGCAATAACCAAGAAGCCGATGGTCGAACACTAGCCGAATCGTTA
TCAAAGACAAGAAGCAAGCAACGGGTCCCGCCACCAAGGCTCTTTTTGCGTCCGTCGCCTGGGACTTCCCATGTC
TCCCTCCCCAGCATCCTTTCATCCGGAGCGCCTGCGCTGGGTTATCATAATGGGGAACGGCTCGGATCTGGGAAT
GATGGGAATGCGACTCTCAACCCAGGGCTAATAGCTCCAGTCAGCCTTGAGCGCGGAAAGCGGGCGCTACAGACT
GCTGGCAGTACGCGTAGCACCGACAGGACAGATGCTCTCTGGGCTGAGATGCAGGCTACACTAGAAGAGGTTGAG
CTTTCTGCCTCGGGTGACACACACGTCTTTGGCCCAGGTCATGACGGCAAATTAGCAGAGCTTCGAAAGGCGCAA
ATTGAGCTGGCGCATGCGTGCGCCAAGTATAAAGTGGATGATTCCACACTACCAACAGGAGGCAACTTGGCTACA
GAGGATGAGCCACAGGAGCCTGACATCTTGCTCGCCCGCGAAAAAAGGCGCGAGGCAAACAATGAATACTTCCGA
TGCGTCAACGAGGGCGTTGTGGCCGTCGTGGCCAAGCTCGAAGATGTGGCGGTGGCGATGCGAGAGGTCGAAAAG
GAGAGCAAGGAAGTATGGAGTGAAGGTACCGCTTGA
Transcript >OphauB2|8154
ATGACTGCCAGTCAGCCTGCAGATAACCGCGGCAATAACCAAGAAGCCGATGGTCGAACACTAGCCGAATCGTTA
TCAAAGACAAGAAGCAAGCAACGGGTCCCGCCACCAAGGCTCTTTTTGCGTCCGTCGCCTGGGACTTCCCATGTC
TCCCTCCCCAGCATCCTTTCATCCGGAGCGCCTGCGCTGGGTTATCATAATGGGGAACGGCTCGGATCTGGGAAT
GATGGGAATGCGACTCTCAACCCAGGGCTAATAGCTCCAGTCAGCCTTGAGCGCGGAAAGCGGGCGCTACAGACT
GCTGGCAGTACGCGTAGCACCGACAGGACAGATGCTCTCTGGGCTGAGATGCAGGCTACACTAGAAGAGGTTGAG
CTTTCTGCCTCGGGTGACACACACGTCTTTGGCCCAGGTCATGACGGCAAATTAGCAGAGCTTCGAAAGGCGCAA
ATTGAGCTGGCGCATGCGTGCGCCAAGTATAAAGTGGATGATTCCACACTACCAACAGGAGGCAACTTGGCTACA
GAGGATGAGCCACAGGAGCCTGACATCTTGCTCGCCCGCGAAAAAAGGCGCGAGGCAAACAATGAATACTTCCGA
TGCGTCAACGAGGGCGTTGTGGCCGTCGTGGCCAAGCTCGAAGATGTGGCGGTGGCGATGCGAGAGGTCGAAAAG
GAGAGCAAGGAAGTATGGAGTGAAGGTACCGCTTGA
Gene >OphauB2|8154
ATGACTGCCAGTCAGCCTGCAGATAACCGCGGCAATAACCAAGAAGCCGATGGTCGAACACTAGCCGAATCGTTA
TCAAAGACAAGAAGCAAGCAACGGGTCCCGCCACCAAGGCTCTTTTTGCGTCCGTCGCCTGGGACTTCCCATGTC
TCCCTCCCCAGCATCCTTTCATCCGGAGCGCCTGCGCTGGGTTATCATAATGGGGAACGGCTCGGATCTGGGAAT
GATGGGAATGCGACTCTCAACCCAGGGCTAATAGCTCCAGTCAGCCTTGAGCGCGGAAAGCGGGCGCTACAGACT
GCTGGCAGTACGCGTAGCACCGACAGGACAGATGCTCTCTGGGCTGAGATGCAGGCTACACTAGAAGAGGTTGAG
CTTTCTGCCTCGGGTGACACACACGTCTTTGGCCCAGGTCATGACGGCAAATTAGCAGAGCTTCGAAAGGCGCAA
ATTGAGCTGGCGCATGCGTGCGCCAAGTATAAAGTGGATGATTCCACACTACCAACAGGAGGCAACTTGGCTACA
GAGGATGAGCCACAGGAGCCTGACATCTTGCTCGCCCGCGAAAAAAGGCGCGAGGCAAACAATGAATACTTCCGA
TGCGTCAACGAGGGCGTTGTGGCCGTCGTGGCCAAGCTCGAAGATGTGGCGGTGGCGATGCGAGAGGTCGAAAAG
GAGAGCAAGGAAGTATGGAGTGAAGGTACCGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail