Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8151
Gene name
LocationContig_99:17747..18763
Strand+
Gene length (bp)1016
Transcript length (bp)819
Coding sequence length (bp)819
Protein length (aa) 273

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00406 ADK Adenylate kinase 5.6E-58 45 231
PF13207 AAA_17 AAA domain 1.2E-21 46 178
PF05191 ADK_lid Adenylate kinase, active site lid 2.2E-16 168 203

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4RD93|KAD2_MAGO7 Adenylate kinase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ADK1 PE=3 SV=1 1 269 5.0E-154
sp|Q2GVK6|KAD2_CHAGB Adenylate kinase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ADK1 PE=3 SV=1 1 272 3.0E-153
sp|B2B0E2|KAD2_PODAN Adenylate kinase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=ADK1 PE=3 SV=1 1 272 3.0E-150
sp|Q9HE76|KAD2_NEUCR Adenylate kinase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=adk-1 PE=1 SV=2 1 269 7.0E-148
sp|A7E8H8|KAD2_SCLS1 Adenylate kinase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=adk1 PE=3 SV=1 5 272 3.0E-145
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4RD93|KAD2_MAGO7 Adenylate kinase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ADK1 PE=3 SV=1 1 269 5.0E-154
sp|Q2GVK6|KAD2_CHAGB Adenylate kinase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ADK1 PE=3 SV=1 1 272 3.0E-153
sp|B2B0E2|KAD2_PODAN Adenylate kinase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=ADK1 PE=3 SV=1 1 272 3.0E-150
sp|Q9HE76|KAD2_NEUCR Adenylate kinase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=adk-1 PE=1 SV=2 1 269 7.0E-148
sp|A7E8H8|KAD2_SCLS1 Adenylate kinase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=adk1 PE=3 SV=1 5 272 3.0E-145
sp|A6RPU0|KAD2_BOTFB Adenylate kinase OS=Botryotinia fuckeliana (strain B05.10) GN=adk1 PE=3 SV=1 11 272 1.0E-142
sp|A6RHI1|KAD2_AJECN Adenylate kinase OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=ADK1 PE=3 SV=1 1 268 2.0E-137
sp|Q4WJ21|KAD2_ASPFU Adenylate kinase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=adk1 PE=3 SV=1 1 254 1.0E-134
sp|B0XPW9|KAD2_ASPFC Adenylate kinase OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=adk1 PE=3 SV=1 1 254 1.0E-134
sp|A2QPN9|KAD2_ASPNC Adenylate kinase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=adk1 PE=3 SV=1 1 253 5.0E-134
sp|Q5B2V8|KAD2_EMENI Adenylate kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=adk1 PE=3 SV=1 3 253 2.0E-133
sp|Q2UBH0|KAD2_ASPOR Adenylate kinase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=adk1 PE=3 SV=2 3 254 2.0E-133
sp|A1D3M8|KAD2_NEOFI Adenylate kinase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=adk1 PE=3 SV=1 1 254 3.0E-133
sp|B2CNY4|KAD2_TALMA Adenylate kinase OS=Talaromyces marneffei GN=adk1 PE=1 SV=1 11 268 4.0E-133
sp|A1CQR5|KAD2_ASPCL Adenylate kinase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=adk1 PE=3 SV=1 1 254 6.0E-133
sp|Q0C7Y1|KAD2_ASPTN Adenylate kinase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=adk1 PE=3 SV=1 3 254 2.0E-132
sp|Q1E4I8|KAD2_COCIM Adenylate kinase OS=Coccidioides immitis (strain RS) GN=ADK1 PE=3 SV=1 1 254 3.0E-128
sp|B2W0K4|KAD2_PYRTR Adenylate kinase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=adk1 PE=3 SV=2 11 268 4.0E-126
sp|Q0V3D5|KAD2_PHANO Adenylate kinase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ADK1 PE=3 SV=1 10 268 5.0E-123
sp|Q5A4Q1|KAD2_CANAL Adenylate kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADK1 PE=3 SV=2 11 253 2.0E-122
sp|Q6BLN9|KAD2_DEBHA Adenylate kinase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ADK1 PE=3 SV=1 11 253 3.0E-121
sp|A3LV51|KAD2_PICST Adenylate kinase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ADK1 PE=3 SV=1 11 253 6.0E-121
sp|A5DC72|KAD2_PICGU Adenylate kinase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ADK1 PE=3 SV=1 11 253 2.0E-118
sp|Q6CG57|KAD2_YARLI Adenylate kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ADK1 PE=3 SV=2 1 253 4.0E-117
sp|A6ZYI0|KAD2_YEAS7 Adenylate kinase OS=Saccharomyces cerevisiae (strain YJM789) GN=ADK1 PE=3 SV=1 36 253 6.0E-117
sp|P07170|KAD2_YEAST Adenylate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADK1 PE=1 SV=2 36 253 7.0E-117
sp|B3LG61|KAD2_YEAS1 Adenylate kinase OS=Saccharomyces cerevisiae (strain RM11-1a) GN=ADK1 PE=3 SV=1 36 253 7.0E-117
sp|Q4PCS5|KAD2_USTMA Adenylate kinase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ADK1 PE=3 SV=3 7 254 4.0E-116
sp|A5E598|KAD2_LODEL Adenylate kinase OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=ADK1 PE=3 SV=1 10 253 2.0E-115
sp|P0CO42|KAD2_CRYNJ Adenylate kinase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ADK1 PE=3 SV=1 7 257 3.0E-115
sp|P0CO43|KAD2_CRYNB Adenylate kinase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ADK1 PE=3 SV=1 7 257 3.0E-115
sp|B0D360|KAD2_LACBS Adenylate kinase OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=ADK1 PE=3 SV=1 6 253 6.0E-115
sp|A8PAA1|KAD2_COPC7 Adenylate kinase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ADK1 PE=3 SV=1 1 257 1.0E-114
sp|Q6FM32|KAD2_CANGA Adenylate kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ADK1 PE=3 SV=1 36 253 3.0E-114
sp|A8PR17|KAD2_MALGO Adenylate kinase OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=ADK1 PE=3 SV=1 7 256 3.0E-114
sp|Q74ZL1|KAD2_ASHGO Adenylate kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ADK1 PE=3 SV=1 39 253 2.0E-112
sp|Q6CK57|KAD2_KLULA Adenylate kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADK1 PE=3 SV=1 39 253 7.0E-112
sp|A7THY5|KAD2_VANPO Adenylate kinase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ADK1 PE=3 SV=1 37 253 1.0E-111
sp|P33075|KAD2_SCHPO Adenylate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=adk1 PE=1 SV=1 41 254 5.0E-110
sp|Q9WTP6|KAD2_MOUSE Adenylate kinase 2, mitochondrial OS=Mus musculus GN=Ak2 PE=1 SV=5 32 250 2.0E-93
sp|P29410|KAD2_RAT Adenylate kinase 2, mitochondrial OS=Rattus norvegicus GN=Ak2 PE=2 SV=2 32 250 1.0E-91
sp|Q5REI7|KAD2_PONAB Adenylate kinase 2, mitochondrial OS=Pongo abelii GN=AK2 PE=2 SV=3 32 250 3.0E-91
sp|P54819|KAD2_HUMAN Adenylate kinase 2, mitochondrial OS=Homo sapiens GN=AK2 PE=1 SV=2 32 250 3.0E-91
sp|P08166|KAD2_BOVIN Adenylate kinase 2, mitochondrial OS=Bos taurus GN=AK2 PE=1 SV=2 35 250 4.0E-91
sp|Q8AVD3|KAD2_XENLA Adenylate kinase 2, mitochondrial OS=Xenopus laevis GN=ak2 PE=2 SV=1 39 250 2.0E-90
sp|Q54QJ9|KAD2_DICDI Adenylate kinase OS=Dictyostelium discoideum GN=adkA PE=3 SV=1 39 265 1.0E-89
sp|Q28F55|KAD2_XENTR Adenylate kinase 2, mitochondrial OS=Xenopus tropicalis GN=ak2 PE=2 SV=1 39 250 6.0E-89
sp|B4MQT3|KAD2_DROWI Adenylate kinase OS=Drosophila willistoni GN=Adk2 PE=3 SV=1 41 259 4.0E-88
sp|B5XCA1|KAD2_SALSA Adenylate kinase 2, mitochondrial OS=Salmo salar GN=ak2 PE=2 SV=1 41 250 5.0E-88
sp|Q9U915|KAD2_DROME Adenylate kinase OS=Drosophila melanogaster GN=Adk2 PE=1 SV=1 41 254 8.0E-88
sp|B4KLY1|KAD2_DROMO Adenylate kinase OS=Drosophila mojavensis GN=Adk2 PE=3 SV=1 44 254 9.0E-88
sp|B4PAR6|KAD2_DROYA Adenylate kinase OS=Drosophila yakuba GN=Adk2 PE=3 SV=1 41 260 3.0E-87
sp|B4QBH8|KAD2_DROSI Adenylate kinase OS=Drosophila simulans GN=Adk2 PE=3 SV=1 41 254 4.0E-87
sp|B4I2A8|KAD2_DROSE Adenylate kinase OS=Drosophila sechellia GN=Adk2-1 PE=3 SV=1 41 254 4.0E-87
sp|B3MCQ5|KAD2_DROAN Adenylate kinase OS=Drosophila ananassae GN=Adk2 PE=3 SV=1 41 249 4.0E-87
sp|B4J672|KAD2_DROGR Adenylate kinase OS=Drosophila grimshawi GN=Adk2 PE=3 SV=1 44 263 1.0E-86
sp|Q290A8|KAD2_DROPS Adenylate kinase OS=Drosophila pseudoobscura pseudoobscura GN=Adk2 PE=3 SV=2 17 254 5.0E-86
sp|B3NQ53|KAD2_DROER Adenylate kinase OS=Drosophila erecta GN=Adk2 PE=3 SV=1 41 254 6.0E-86
sp|Q1L8L9|KAD2_DANRE Adenylate kinase 2, mitochondrial OS=Danio rerio GN=ak2 PE=2 SV=1 41 250 2.0E-85
sp|B0X5E3|KAD2_CULQU Adenylate kinase OS=Culex quinquefasciatus GN=Adk2 PE=3 SV=1 41 249 2.0E-85
sp|B4LP08|KAD2_DROVI Adenylate kinase OS=Drosophila virilis GN=Adk2 PE=3 SV=1 44 254 4.0E-85
sp|Q1HQK0|KAD2_AEDAE Adenylate kinase OS=Aedes aegypti GN=Adk2 PE=2 SV=1 41 259 6.0E-85
sp|Q7QJX9|KAD2_ANOGA Adenylate kinase OS=Anopheles gambiae GN=Adk2 PE=3 SV=2 35 249 2.0E-84
sp|O82514|KAD4_ARATH Adenylate kinase 4 OS=Arabidopsis thaliana GN=ADK1 PE=1 SV=2 42 253 6.0E-84
sp|Q08480|KAD4_ORYSJ Adenylate kinase 4 OS=Oryza sativa subsp. japonica GN=ADK-B PE=2 SV=1 22 253 2.0E-83
sp|Q9FK35|KAD3_ARATH Adenylate kinase 3 OS=Arabidopsis thaliana GN=ADK2 PE=1 SV=1 4 242 4.0E-82
sp|Q08479|KAD3_ORYSJ Adenylate kinase 3 OS=Oryza sativa subsp. japonica GN=ADK-A PE=2 SV=1 25 245 2.0E-81
sp|P34346|KAD2_CAEEL Adenylate kinase OS=Caenorhabditis elegans GN=let-754 PE=3 SV=2 27 271 4.0E-79
sp|A8XZJ0|KAD2_CAEBR Adenylate kinase OS=Caenorhabditis briggsae GN=let-754 PE=3 SV=2 41 271 5.0E-79
sp|Q0BMG1|KAD_FRATO Adenylate kinase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=adk PE=3 SV=1 41 228 7.0E-68
sp|Q2A425|KAD_FRATH Adenylate kinase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=adk PE=3 SV=1 41 228 7.0E-68
sp|A4IYJ6|KAD_FRATW Adenylate kinase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=adk PE=3 SV=1 41 228 8.0E-68
sp|Q5NFR4|KAD_FRATT Adenylate kinase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=adk PE=1 SV=1 41 228 8.0E-68
sp|A0Q713|KAD_FRATN Adenylate kinase OS=Francisella tularensis subsp. novicida (strain U112) GN=adk PE=3 SV=1 41 228 8.0E-68
sp|B2SGC2|KAD_FRATM Adenylate kinase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=adk PE=3 SV=1 41 228 8.0E-68
sp|Q14H66|KAD_FRAT1 Adenylate kinase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=adk PE=3 SV=1 41 228 8.0E-68
sp|A9IQ39|KAD_BORPD Adenylate kinase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=adk PE=3 SV=1 41 227 1.0E-67
sp|Q9HXV4|KAD_PSEAE Adenylate kinase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=adk PE=3 SV=1 41 235 2.0E-67
sp|Q02RF8|KAD_PSEAB Adenylate kinase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=adk PE=3 SV=1 41 235 2.0E-67
sp|B7V109|KAD_PSEA8 Adenylate kinase OS=Pseudomonas aeruginosa (strain LESB58) GN=adk PE=3 SV=1 41 235 2.0E-67
sp|A7NBG3|KAD_FRATF Adenylate kinase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=adk PE=3 SV=1 41 228 2.0E-67
sp|A6V1A1|KAD_PSEA7 Adenylate kinase OS=Pseudomonas aeruginosa (strain PA7) GN=adk PE=3 SV=1 41 235 2.0E-67
sp|A4XXP5|KAD_PSEMY Adenylate kinase OS=Pseudomonas mendocina (strain ymp) GN=adk PE=3 SV=1 41 235 4.0E-67
sp|Q606F1|KAD_METCA Adenylate kinase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=adk PE=3 SV=1 41 243 1.0E-66
sp|Q1QZ94|KAD_CHRSD Adenylate kinase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=adk PE=3 SV=1 41 255 1.0E-66
sp|A1WXY6|KAD_HALHL Adenylate kinase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=adk PE=3 SV=1 41 238 1.0E-66
sp|Q0VRB0|KAD_ALCBS Adenylate kinase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=adk PE=3 SV=1 41 228 5.0E-66
sp|J7RC67|KAD_BORP1 Adenylate kinase OS=Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) GN=adk PE=1 SV=1 41 242 1.0E-65
sp|Q7WKU8|KAD_BORBR Adenylate kinase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=adk PE=3 SV=1 41 242 1.0E-65
sp|B0TXR2|KAD_FRAP2 Adenylate kinase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=adk PE=3 SV=1 41 254 1.0E-65
sp|Q5P106|KAD_AROAE Adenylate kinase OS=Aromatoleum aromaticum (strain EbN1) GN=adk PE=3 SV=1 41 243 1.0E-65
sp|Q0A982|KAD_ALKEH Adenylate kinase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=adk PE=3 SV=1 41 227 2.0E-65
sp|A6T169|KAD_JANMA Adenylate kinase OS=Janthinobacterium sp. (strain Marseille) GN=adk PE=3 SV=1 41 243 2.0E-65
sp|Q3SIR8|KAD_THIDA Adenylate kinase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=adk PE=3 SV=1 41 233 2.0E-65
sp|Q7NSS7|KAD_CHRVO Adenylate kinase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=adk PE=3 SV=1 41 229 2.0E-65
sp|Q7W7G0|KAD_BORPA Adenylate kinase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=adk PE=3 SV=1 41 242 4.0E-65
sp|A1AVD5|KAD_RUTMC Adenylate kinase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=adk PE=3 SV=1 41 251 6.0E-65
sp|A4SEQ7|KAD_CHLPM Adenylate kinase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=adk PE=3 SV=1 41 227 6.0E-65
sp|Q4KHK4|KAD_PSEF5 Adenylate kinase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=adk PE=3 SV=1 41 235 1.0E-64
sp|C3KEC6|KAD_PSEFS Adenylate kinase OS=Pseudomonas fluorescens (strain SBW25) GN=adk PE=3 SV=1 41 235 1.0E-64
sp|P0DKX8|KAD_BORPE Adenylate kinase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=adk PE=3 SV=1 41 242 2.0E-64
sp|A1K5I5|KAD_AZOSB Adenylate kinase OS=Azoarcus sp. (strain BH72) GN=adk PE=3 SV=1 41 227 2.0E-64
sp|A4G7X8|KAD_HERAR Adenylate kinase OS=Herminiimonas arsenicoxydans GN=adk PE=3 SV=1 41 243 4.0E-64
sp|Q2SL21|KAD_HAHCH Adenylate kinase OS=Hahella chejuensis (strain KCTC 2396) GN=adk PE=3 SV=1 41 242 4.0E-64
sp|A0L8G8|KAD_MAGMM Adenylate kinase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=adk PE=3 SV=1 41 253 4.0E-64
sp|C5BRP4|KAD_TERTT Adenylate kinase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=adk PE=3 SV=1 41 229 5.0E-64
sp|P49979|KAD_NEIGO Adenylate kinase OS=Neisseria gonorrhoeae GN=adk PE=3 SV=1 41 229 7.0E-64
sp|B4RKA2|KAD_NEIG2 Adenylate kinase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=adk PE=3 SV=1 41 229 7.0E-64
sp|Q5F9J3|KAD_NEIG1 Adenylate kinase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=adk PE=3 SV=1 41 229 7.0E-64
sp|A5CXT4|KAD_VESOH Adenylate kinase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=adk PE=3 SV=1 41 239 7.0E-64
sp|C1D6J0|KAD_LARHH Adenylate kinase OS=Laribacter hongkongensis (strain HLHK9) GN=adk PE=3 SV=1 41 227 1.0E-63
sp|B4S810|KAD_PROA2 Adenylate kinase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=adk PE=3 SV=1 41 242 2.0E-63
sp|E6MY99|KAD_NEIMH Adenylate kinase OS=Neisseria meningitidis serogroup B / serotype 15 (strain H44/76) GN=adk PE=3 SV=1 41 229 3.0E-63
sp|P0A0U7|KAD_NEIMB Adenylate kinase OS=Neisseria meningitidis serogroup B (strain MC58) GN=adk PE=3 SV=1 41 229 3.0E-63
sp|A0PXW7|KAD_CLONN Adenylate kinase OS=Clostridium novyi (strain NT) GN=adk PE=3 SV=1 41 257 3.0E-63
sp|Q5X5F4|KAD_LEGPA Adenylate kinase OS=Legionella pneumophila (strain Paris) GN=adk PE=3 SV=1 41 254 3.0E-63
sp|Q48F36|KAD_PSE14 Adenylate kinase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=adk PE=3 SV=1 41 229 3.0E-63
sp|B3QS41|KAD_CHLT3 Adenylate kinase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=adk PE=3 SV=1 41 258 3.0E-63
sp|Q15RT7|KAD_PSEA6 Adenylate kinase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=adk PE=3 SV=1 41 228 3.0E-63
sp|A1KT73|KAD_NEIMF Adenylate kinase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=adk PE=3 SV=1 41 229 4.0E-63
sp|P0DH56|KAD_NEIME Adenylate kinase OS=Neisseria meningitidis GN=adk PE=3 SV=1 41 229 4.0E-63
sp|P0A0U6|KAD_NEIMA Adenylate kinase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=adk PE=3 SV=1 41 229 4.0E-63
sp|A9M3Q2|KAD_NEIM0 Adenylate kinase OS=Neisseria meningitidis serogroup C (strain 053442) GN=adk PE=3 SV=1 41 229 4.0E-63
sp|A1S566|KAD_SHEAM Adenylate kinase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=adk PE=3 SV=1 41 249 4.0E-63
sp|A1RIQ3|KAD_SHESW Adenylate kinase OS=Shewanella sp. (strain W3-18-1) GN=adk PE=3 SV=1 41 254 4.0E-63
sp|A4Y7T5|KAD_SHEPC Adenylate kinase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=adk PE=3 SV=1 41 254 4.0E-63
sp|A5IBQ3|KAD_LEGPC Adenylate kinase OS=Legionella pneumophila (strain Corby) GN=adk PE=3 SV=1 41 254 4.0E-63
sp|Q5WWT7|KAD_LEGPL Adenylate kinase OS=Legionella pneumophila (strain Lens) GN=adk PE=3 SV=1 41 254 5.0E-63
sp|A9L567|KAD_SHEB9 Adenylate kinase OS=Shewanella baltica (strain OS195) GN=adk PE=3 SV=1 41 254 5.0E-63
sp|A6WPI0|KAD_SHEB8 Adenylate kinase OS=Shewanella baltica (strain OS185) GN=adk PE=3 SV=1 41 254 5.0E-63
sp|A3D5M6|KAD_SHEB5 Adenylate kinase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=adk PE=3 SV=1 41 254 5.0E-63
sp|B8E732|KAD_SHEB2 Adenylate kinase OS=Shewanella baltica (strain OS223) GN=adk PE=3 SV=1 41 254 5.0E-63
sp|Q4ZWV2|KAD_PSEU2 Adenylate kinase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=adk PE=3 SV=1 41 229 6.0E-63
sp|C6DB87|KAD_PECCP Adenylate kinase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=adk PE=3 SV=1 41 229 6.0E-63
sp|Q3IKQ1|KAD_PSEHT Adenylate kinase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=adk PE=3 SV=1 41 228 6.0E-63
sp|B1KSK4|KAD_CLOBM Adenylate kinase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=adk PE=3 SV=1 41 253 1.0E-62
sp|Q1GZB7|KAD_METFK Adenylate kinase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=adk PE=3 SV=1 41 227 2.0E-62
sp|Q2NV57|KAD_SODGM Adenylate kinase OS=Sodalis glossinidius (strain morsitans) GN=adk PE=3 SV=1 41 229 2.0E-62
sp|A7GJ53|KAD_CLOBL Adenylate kinase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=adk PE=3 SV=1 41 253 3.0E-62
sp|B1IGD3|KAD_CLOBK Adenylate kinase OS=Clostridium botulinum (strain Okra / Type B1) GN=adk PE=3 SV=1 41 253 3.0E-62
sp|Q8EFF5|KAD_SHEON Adenylate kinase OS=Shewanella oneidensis (strain MR-1) GN=adk PE=3 SV=1 41 254 4.0E-62
sp|Q084C4|KAD_SHEFN Adenylate kinase OS=Shewanella frigidimarina (strain NCIMB 400) GN=adk PE=3 SV=1 41 254 4.0E-62
sp|C5CKV9|KAD_VARPS Adenylate kinase OS=Variovorax paradoxus (strain S110) GN=adk PE=3 SV=1 41 242 5.0E-62
sp|C1DSX5|KAD_AZOVD Adenylate kinase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=adk PE=3 SV=1 41 235 5.0E-62
sp|Q8XWE1|KAD_RALSO Adenylate kinase OS=Ralstonia solanacearum (strain GMI1000) GN=adk PE=3 SV=1 41 227 6.0E-62
sp|C1FMT0|KAD_CLOBJ Adenylate kinase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=adk PE=3 SV=1 41 253 6.0E-62
sp|A5I7I5|KAD_CLOBH Adenylate kinase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=adk PE=3 SV=1 41 253 6.0E-62
sp|A7FZ52|KAD_CLOB1 Adenylate kinase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=adk PE=3 SV=1 41 253 6.0E-62
sp|C3KVN0|KAD_CLOB6 Adenylate kinase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=adk PE=3 SV=1 41 253 6.0E-62
sp|A2SIQ4|KAD_METPP Adenylate kinase OS=Methylibium petroleiphilum (strain PM1) GN=adk PE=3 SV=1 41 227 7.0E-62
sp|B3PIE4|KAD_CELJU Adenylate kinase OS=Cellvibrio japonicus (strain Ueda107) GN=adk PE=3 SV=1 41 229 7.0E-62
sp|Q0SQG5|KAD_CLOPS Adenylate kinase OS=Clostridium perfringens (strain SM101 / Type A) GN=adk PE=3 SV=1 41 253 7.0E-62
sp|Q0TMR7|KAD_CLOP1 Adenylate kinase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=adk PE=3 SV=1 41 253 7.0E-62
sp|Q0HU97|KAD_SHESR Adenylate kinase OS=Shewanella sp. (strain MR-7) GN=adk PE=3 SV=1 41 254 8.0E-62
sp|Q0HHZ7|KAD_SHESM Adenylate kinase OS=Shewanella sp. (strain MR-4) GN=adk PE=3 SV=1 41 254 8.0E-62
sp|A0KY01|KAD_SHESA Adenylate kinase OS=Shewanella sp. (strain ANA-3) GN=adk PE=3 SV=1 41 254 8.0E-62
sp|A6VUQ6|KAD_MARMS Adenylate kinase OS=Marinomonas sp. (strain MWYL1) GN=adk PE=3 SV=1 41 242 8.0E-62
sp|P49981|KAD_NEIMU Adenylate kinase OS=Neisseria mucosa GN=adk PE=3 SV=1 41 229 9.0E-62
sp|A8AJW9|KAD_CITK8 Adenylate kinase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=adk PE=3 SV=1 41 229 1.0E-61
sp|Q3KHE3|KAD_PSEPF Adenylate kinase OS=Pseudomonas fluorescens (strain Pf0-1) GN=adk PE=3 SV=1 41 235 1.0E-61
sp|B1Y6I7|KAD_LEPCP Adenylate kinase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=adk PE=3 SV=1 41 227 1.0E-61
sp|B3EJF7|KAD_CHLPB Adenylate kinase OS=Chlorobium phaeobacteroides (strain BS1) GN=adk PE=3 SV=1 41 229 1.0E-61
sp|Q47B46|KAD_DECAR Adenylate kinase OS=Dechloromonas aromatica (strain RCB) GN=adk PE=3 SV=1 41 229 1.0E-61
sp|A1W895|KAD_ACISJ Adenylate kinase OS=Acidovorax sp. (strain JS42) GN=adk PE=3 SV=1 41 242 1.0E-61
sp|B9MI80|KAD_ACIET Adenylate kinase OS=Acidovorax ebreus (strain TPSY) GN=adk PE=3 SV=1 41 242 1.0E-61
sp|Q8XHU4|KAD_CLOPE Adenylate kinase OS=Clostridium perfringens (strain 13 / Type A) GN=adk PE=3 SV=1 41 253 1.0E-61
sp|A3QF48|KAD_SHELP Adenylate kinase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=adk PE=3 SV=1 41 253 2.0E-61
sp|Q0KE20|KAD_CUPNH Adenylate kinase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=adk PE=3 SV=1 41 252 2.0E-61
sp|B3QNN0|KAD_CHLP8 Adenylate kinase OS=Chlorobaculum parvum (strain NCIB 8327) GN=adk PE=3 SV=1 41 238 2.0E-61
sp|Q6D7Z5|KAD_PECAS Adenylate kinase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=adk PE=3 SV=1 41 229 2.0E-61
sp|Q475G1|KAD_CUPPJ Adenylate kinase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=adk PE=3 SV=1 41 227 2.0E-61
sp|B3R0X7|KAD_CUPTR Adenylate kinase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=adk PE=3 SV=1 41 227 3.0E-61
sp|Q8KD69|KAD_CHLTE Adenylate kinase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=adk PE=3 SV=1 41 240 3.0E-61
sp|Q3ASD2|KAD_CHLCH Adenylate kinase OS=Chlorobium chlorochromatii (strain CaD3) GN=adk PE=3 SV=1 41 227 3.0E-61
sp|A1JNB1|KAD_YERE8 Adenylate kinase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=adk PE=3 SV=1 41 229 3.0E-61
sp|Q21TN6|KAD_RHOFT Adenylate kinase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=adk PE=3 SV=1 41 227 4.0E-61
sp|Q1LR08|KAD_CUPMC Adenylate kinase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=adk PE=3 SV=1 41 227 4.0E-61
sp|P0A1V4|KAD_SALTY Adenylate kinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=adk PE=3 SV=1 41 253 4.0E-61
sp|P0A1V5|KAD_SALTI Adenylate kinase OS=Salmonella typhi GN=adk PE=3 SV=1 41 253 4.0E-61
sp|B4TMG6|KAD_SALSV Adenylate kinase OS=Salmonella schwarzengrund (strain CVM19633) GN=adk PE=3 SV=1 41 253 4.0E-61
sp|B5BD44|KAD_SALPK Adenylate kinase OS=Salmonella paratyphi A (strain AKU_12601) GN=adk PE=3 SV=1 41 253 4.0E-61
sp|C0Q812|KAD_SALPC Adenylate kinase OS=Salmonella paratyphi C (strain RKS4594) GN=adk PE=3 SV=1 41 253 4.0E-61
sp|Q5PFK8|KAD_SALPA Adenylate kinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=adk PE=3 SV=1 41 253 4.0E-61
sp|B4SWY1|KAD_SALNS Adenylate kinase OS=Salmonella newport (strain SL254) GN=adk PE=3 SV=1 41 253 4.0E-61
sp|B4T9I1|KAD_SALHS Adenylate kinase OS=Salmonella heidelberg (strain SL476) GN=adk PE=3 SV=1 41 253 4.0E-61
sp|B5R612|KAD_SALG2 Adenylate kinase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=adk PE=3 SV=1 41 253 4.0E-61
sp|B5QU77|KAD_SALEP Adenylate kinase OS=Salmonella enteritidis PT4 (strain P125109) GN=adk PE=3 SV=1 41 253 4.0E-61
sp|B5FLJ7|KAD_SALDC Adenylate kinase OS=Salmonella dublin (strain CT_02021853) GN=adk PE=3 SV=1 41 253 4.0E-61
sp|Q57S76|KAD_SALCH Adenylate kinase OS=Salmonella choleraesuis (strain SC-B67) GN=adk PE=3 SV=1 41 253 4.0E-61
sp|B5EXN0|KAD_SALA4 Adenylate kinase OS=Salmonella agona (strain SL483) GN=adk PE=3 SV=1 41 253 4.0E-61
sp|B2UB85|KAD_RALPJ Adenylate kinase OS=Ralstonia pickettii (strain 12J) GN=adk PE=3 SV=1 41 229 5.0E-61
sp|C3LTN4|KAD_VIBCM Adenylate kinase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=adk PE=3 SV=1 41 229 5.0E-61
sp|Q9KTB7|KAD_VIBCH Adenylate kinase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=adk PE=1 SV=1 41 229 5.0E-61
sp|A5F2U0|KAD_VIBC3 Adenylate kinase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=adk PE=3 SV=1 41 229 5.0E-61
sp|P38372|KAD_BACHD Adenylate kinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=adk PE=3 SV=2 41 255 5.0E-61
sp|B1JHN1|KAD_YERPY Adenylate kinase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=adk PE=3 SV=1 41 229 6.0E-61
sp|Q66DP7|KAD_YERPS Adenylate kinase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=adk PE=3 SV=1 41 229 6.0E-61
sp|A4TPA4|KAD_YERPP Adenylate kinase OS=Yersinia pestis (strain Pestoides F) GN=adk PE=3 SV=1 41 229 6.0E-61
sp|Q1CL27|KAD_YERPN Adenylate kinase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=adk PE=3 SV=1 41 229 6.0E-61
sp|A9R0Q7|KAD_YERPG Adenylate kinase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=adk PE=3 SV=1 41 229 6.0E-61
sp|O69172|KAD_YERPE Adenylate kinase OS=Yersinia pestis GN=adk PE=3 SV=1 41 229 6.0E-61
sp|B2K6Z6|KAD_YERPB Adenylate kinase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=adk PE=3 SV=1 41 229 6.0E-61
sp|Q1C4P9|KAD_YERPA Adenylate kinase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=adk PE=3 SV=1 41 229 6.0E-61
sp|A7FL86|KAD_YERP3 Adenylate kinase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=adk PE=3 SV=1 41 229 6.0E-61
sp|B1HMV9|KAD_LYSSC Adenylate kinase OS=Lysinibacillus sphaericus (strain C3-41) GN=adk PE=3 SV=1 41 253 6.0E-61
sp|Q87RH4|KAD_VIBPA Adenylate kinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=adk PE=3 SV=1 41 229 7.0E-61
sp|B7VII5|KAD_VIBTL Adenylate kinase OS=Vibrio tasmaniensis (strain LGP32) GN=adk PE=3 SV=1 41 229 7.0E-61
sp|Q6LTE1|KAD_PHOPR Adenylate kinase OS=Photobacterium profundum GN=adk PE=1 SV=1 41 229 7.0E-61
sp|A5N4R8|KAD_CLOK5 Adenylate kinase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=adk PE=3 SV=1 41 247 8.0E-61
sp|B9DYD0|KAD_CLOK1 Adenylate kinase OS=Clostridium kluyveri (strain NBRC 12016) GN=adk PE=3 SV=1 41 247 8.0E-61
sp|A1U2U2|KAD_MARHV Adenylate kinase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=adk PE=3 SV=1 41 228 1.0E-60
sp|B4F1Q2|KAD_PROMH Adenylate kinase OS=Proteus mirabilis (strain HI4320) GN=adk PE=3 SV=1 41 253 1.0E-60
sp|Q1IDV1|KAD_PSEE4 Adenylate kinase OS=Pseudomonas entomophila (strain L48) GN=adk PE=3 SV=1 41 229 1.0E-60
sp|Q2KZE4|KAD_BORA1 Adenylate kinase OS=Bordetella avium (strain 197N) GN=adk PE=3 SV=1 41 242 1.0E-60
sp|B1JD29|KAD_PSEPW Adenylate kinase OS=Pseudomonas putida (strain W619) GN=adk PE=3 SV=1 41 229 1.0E-60
sp|B0KS64|KAD_PSEPG Adenylate kinase OS=Pseudomonas putida (strain GB-1) GN=adk PE=3 SV=1 41 229 1.0E-60
sp|Q886R8|KAD_PSESM Adenylate kinase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=adk PE=3 SV=1 41 229 1.0E-60
sp|Q7MMR5|KAD_VIBVY Adenylate kinase OS=Vibrio vulnificus (strain YJ016) GN=adk PE=3 SV=1 41 249 1.0E-60
sp|B4RU55|KAD_ALTMD Adenylate kinase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=adk PE=3 SV=1 41 227 2.0E-60
sp|Q8DFM1|KAD_VIBVU Adenylate kinase OS=Vibrio vulnificus (strain CMCP6) GN=adk PE=3 SV=1 41 249 2.0E-60
sp|B2JDV1|KAD_BURP8 Adenylate kinase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=adk PE=3 SV=1 41 228 3.0E-60
sp|B3ED51|KAD_CHLL2 Adenylate kinase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=adk PE=3 SV=1 41 227 4.0E-60
sp|B5FBZ5|KAD_VIBFM Adenylate kinase OS=Vibrio fischeri (strain MJ11) GN=adk PE=3 SV=1 41 229 4.0E-60
sp|Q5E6Q8|KAD_VIBF1 Adenylate kinase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=adk PE=3 SV=1 41 229 4.0E-60
sp|A6T5N7|KAD_KLEP7 Adenylate kinase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=adk PE=3 SV=1 41 229 5.0E-60
sp|B5Y0N3|KAD_KLEP3 Adenylate kinase OS=Klebsiella pneumoniae (strain 342) GN=adk PE=3 SV=1 41 229 5.0E-60
sp|A6LPT2|KAD_CLOB8 Adenylate kinase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=adk PE=3 SV=1 41 257 5.0E-60
sp|Q31DX5|KAD_THICR Adenylate kinase OS=Thiomicrospira crunogena (strain XCL-2) GN=adk PE=3 SV=1 41 254 5.0E-60
sp|A7MT47|KAD_VIBCB Adenylate kinase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=adk PE=3 SV=1 41 229 5.0E-60
sp|A4W7F8|KAD_ENT38 Adenylate kinase OS=Enterobacter sp. (strain 638) GN=adk PE=3 SV=1 41 229 5.0E-60
sp|A0B9A2|KAD_METTP Adenylate kinase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=adk PE=3 SV=1 41 253 6.0E-60
sp|Q83M40|KAD_SHIFL Adenylate kinase OS=Shigella flexneri GN=adk PE=3 SV=4 41 253 6.0E-60
sp|P0A137|KAD_PSEPU Adenylate kinase OS=Pseudomonas putida GN=adk PE=3 SV=1 41 235 7.0E-60
sp|P0A136|KAD_PSEPK Adenylate kinase OS=Pseudomonas putida (strain KT2440) GN=adk PE=3 SV=1 41 235 7.0E-60
sp|A5W880|KAD_PSEP1 Adenylate kinase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=adk PE=3 SV=1 41 235 7.0E-60
sp|C5BD16|KAD_EDWI9 Adenylate kinase OS=Edwardsiella ictaluri (strain 93-146) GN=adk PE=3 SV=1 41 227 9.0E-60
sp|A9BWI1|KAD_DELAS Adenylate kinase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=adk PE=3 SV=1 41 228 9.0E-60
sp|B1XTC5|KAD_POLNS Adenylate kinase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=adk PE=3 SV=1 41 227 1.0E-59
sp|Q2T0K4|KAD_BURTA Adenylate kinase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=adk PE=3 SV=1 41 233 1.0E-59
sp|P24323|KAD_HAEIN Adenylate kinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=adk PE=3 SV=2 41 228 1.0E-59
sp|A5UGF8|KAD_HAEIG Adenylate kinase OS=Haemophilus influenzae (strain PittGG) GN=adk PE=3 SV=1 41 228 1.0E-59
sp|Q4QNJ1|KAD_HAEI8 Adenylate kinase OS=Haemophilus influenzae (strain 86-028NP) GN=adk PE=3 SV=1 41 228 1.0E-59
sp|B0TP07|KAD_SHEHH Adenylate kinase OS=Shewanella halifaxensis (strain HAW-EB4) GN=adk PE=3 SV=1 41 253 1.0E-59
sp|A8GAV3|KAD_SERP5 Adenylate kinase OS=Serratia proteamaculans (strain 568) GN=adk PE=3 SV=1 41 253 2.0E-59
sp|Q63WL6|KAD_BURPS Adenylate kinase OS=Burkholderia pseudomallei (strain K96243) GN=adk PE=3 SV=1 41 233 2.0E-59
sp|A3N6K4|KAD_BURP6 Adenylate kinase OS=Burkholderia pseudomallei (strain 668) GN=adk PE=3 SV=1 41 233 2.0E-59
sp|Q3JVB1|KAD_BURP1 Adenylate kinase OS=Burkholderia pseudomallei (strain 1710b) GN=adk PE=1 SV=1 41 233 2.0E-59
sp|A3NS87|KAD_BURP0 Adenylate kinase OS=Burkholderia pseudomallei (strain 1106a) GN=adk PE=3 SV=1 41 233 2.0E-59
sp|A1V117|KAD_BURMS Adenylate kinase OS=Burkholderia mallei (strain SAVP1) GN=adk PE=3 SV=1 41 233 2.0E-59
sp|Q62HI0|KAD_BURMA Adenylate kinase OS=Burkholderia mallei (strain ATCC 23344) GN=adk PE=3 SV=1 41 233 2.0E-59
sp|A2S516|KAD_BURM9 Adenylate kinase OS=Burkholderia mallei (strain NCTC 10229) GN=adk PE=3 SV=1 41 233 2.0E-59
sp|A3MN48|KAD_BURM7 Adenylate kinase OS=Burkholderia mallei (strain NCTC 10247) GN=adk PE=3 SV=1 41 233 2.0E-59
sp|B2VHX2|KAD_ERWT9 Adenylate kinase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=adk PE=3 SV=1 41 253 2.0E-59
sp|A1TQ96|KAD_ACIAC Adenylate kinase OS=Acidovorax citrulli (strain AAC00-1) GN=adk PE=3 SV=1 41 242 2.0E-59
sp|Q3ACG0|KAD_CARHZ Adenylate kinase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=adk PE=3 SV=1 41 254 2.0E-59
sp|Q5WLP1|KAD_BACSK Adenylate kinase OS=Bacillus clausii (strain KSM-K16) GN=adk PE=3 SV=1 41 253 2.0E-59
sp|C4L8U2|KAD_TOLAT Adenylate kinase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=adk PE=3 SV=1 41 255 2.0E-59
sp|Q3B4C0|KAD_CHLL7 Adenylate kinase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=adk PE=3 SV=1 41 229 2.0E-59
sp|Q8FK84|KAD_ECOL6 Adenylate kinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=adk PE=3 SV=2 41 229 2.0E-59
sp|Q0TKG7|KAD_ECOL5 Adenylate kinase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=adk PE=3 SV=1 41 229 2.0E-59
sp|B7MQI9|KAD_ECO81 Adenylate kinase OS=Escherichia coli O81 (strain ED1a) GN=adk PE=3 SV=1 41 229 2.0E-59
sp|B7NIF6|KAD_ECO7I Adenylate kinase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=adk PE=3 SV=1 41 229 2.0E-59
sp|B7UKF4|KAD_ECO27 Adenylate kinase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=adk PE=3 SV=1 41 229 2.0E-59
sp|Q0T7B1|KAD_SHIF8 Adenylate kinase OS=Shigella flexneri serotype 5b (strain 8401) GN=adk PE=3 SV=1 41 229 3.0E-59
sp|Q325C2|KAD_SHIBS Adenylate kinase OS=Shigella boydii serotype 4 (strain Sb227) GN=adk PE=3 SV=1 41 229 3.0E-59
sp|B2U4S7|KAD_SHIB3 Adenylate kinase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=adk PE=3 SV=1 41 229 3.0E-59
sp|B7LV13|KAD_ESCF3 Adenylate kinase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=adk PE=3 SV=1 41 229 3.0E-59
sp|B1LJN2|KAD_ECOSM Adenylate kinase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=adk PE=3 SV=1 41 229 3.0E-59
sp|B6I0C6|KAD_ECOSE Adenylate kinase OS=Escherichia coli (strain SE11) GN=adk PE=3 SV=1 41 229 3.0E-59
sp|B7N927|KAD_ECOLU Adenylate kinase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=adk PE=3 SV=1 41 229 3.0E-59
sp|P69441|KAD_ECOLI Adenylate kinase OS=Escherichia coli (strain K12) GN=adk PE=1 SV=1 41 229 3.0E-59
sp|B1IZC0|KAD_ECOLC Adenylate kinase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=adk PE=3 SV=1 41 229 3.0E-59
sp|A7ZXD2|KAD_ECOHS Adenylate kinase OS=Escherichia coli O9:H4 (strain HS) GN=adk PE=3 SV=1 41 229 3.0E-59
sp|B1XFR1|KAD_ECODH Adenylate kinase OS=Escherichia coli (strain K12 / DH10B) GN=adk PE=3 SV=1 41 229 3.0E-59
sp|C4ZUS8|KAD_ECOBW Adenylate kinase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=adk PE=3 SV=1 41 229 3.0E-59
sp|P69442|KAD_ECO57 Adenylate kinase OS=Escherichia coli O157:H7 GN=adk PE=3 SV=1 41 229 3.0E-59
sp|B7L799|KAD_ECO55 Adenylate kinase OS=Escherichia coli (strain 55989 / EAEC) GN=adk PE=3 SV=1 41 229 3.0E-59
sp|A7ZIN4|KAD_ECO24 Adenylate kinase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=adk PE=3 SV=1 41 229 3.0E-59
sp|Q65UF7|KAD_MANSM Adenylate kinase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=adk PE=3 SV=1 41 228 3.0E-59
sp|A9AGK1|KAD_BURM1 Adenylate kinase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=adk PE=3 SV=1 41 240 3.0E-59
sp|A4J592|KAD_DESRM Adenylate kinase OS=Desulfotomaculum reducens (strain MI-1) GN=adk PE=3 SV=1 41 250 4.0E-59
sp|Q21II4|KAD_SACD2 Adenylate kinase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=adk PE=3 SV=1 41 229 4.0E-59
sp|Q3Z4S5|KAD_SHISS Adenylate kinase OS=Shigella sonnei (strain Ss046) GN=adk PE=3 SV=1 41 229 4.0E-59
sp|B6EHK0|KAD_ALISL Adenylate kinase OS=Aliivibrio salmonicida (strain LFI1238) GN=adk PE=3 SV=1 41 229 5.0E-59
sp|B5YHP1|KAD_THEYD Adenylate kinase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=adk PE=3 SV=1 41 254 5.0E-59
sp|Q129C6|KAD_POLSJ Adenylate kinase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=adk PE=3 SV=1 41 227 5.0E-59
sp|A5UAD6|KAD_HAEIE Adenylate kinase OS=Haemophilus influenzae (strain PittEE) GN=adk PE=3 SV=1 41 228 6.0E-59
sp|B7MDZ6|KAD_ECO45 Adenylate kinase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=adk PE=3 SV=1 41 229 6.0E-59
sp|B2A4G2|KAD_NATTJ Adenylate kinase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=adk PE=3 SV=1 41 255 7.0E-59
sp|B0V9Q9|KAD_ACIBY Adenylate kinase OS=Acinetobacter baumannii (strain AYE) GN=adk PE=3 SV=1 41 228 8.0E-59
sp|A3M3G1|KAD_ACIBT Adenylate kinase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=adk PE=3 SV=2 41 228 8.0E-59
sp|B0VSA9|KAD_ACIBS Adenylate kinase OS=Acinetobacter baumannii (strain SDF) GN=adk PE=3 SV=1 41 228 8.0E-59
sp|B2HVT0|KAD_ACIBC Adenylate kinase OS=Acinetobacter baumannii (strain ACICU) GN=adk PE=3 SV=1 41 228 8.0E-59
sp|B7I8U4|KAD_ACIB5 Adenylate kinase OS=Acinetobacter baumannii (strain AB0057) GN=adk PE=3 SV=1 41 228 8.0E-59
sp|B7GXT4|KAD_ACIB3 Adenylate kinase OS=Acinetobacter baumannii (strain AB307-0294) GN=adk PE=3 SV=1 41 228 8.0E-59
sp|Q12PB0|KAD_SHEDO Adenylate kinase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=adk PE=3 SV=1 41 227 9.0E-59
sp|O29581|KAD_ARCFU Adenylate kinase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=adk PE=3 SV=1 41 254 1.0E-58
sp|B1KNK5|KAD_SHEWM Adenylate kinase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=adk PE=3 SV=1 41 227 1.0E-58
sp|A4SVI8|KAD_POLSQ Adenylate kinase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=adk PE=3 SV=1 41 227 1.0E-58
sp|Q46GB9|KAD_METBF Adenylate kinase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=adk PE=3 SV=1 41 254 1.0E-58
sp|Q2RFR8|KAD_MOOTA Adenylate kinase OS=Moorella thermoacetica (strain ATCC 39073) GN=adk PE=3 SV=1 41 240 1.0E-58
sp|A5FZU4|KAD_ACICJ Adenylate kinase OS=Acidiphilium cryptum (strain JF-5) GN=adk PE=3 SV=1 41 249 1.0E-58
sp|Q5QWR3|KAD_IDILO Adenylate kinase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=adk PE=3 SV=1 41 253 1.0E-58
sp|B1YVE0|KAD_BURA4 Adenylate kinase OS=Burkholderia ambifaria (strain MC40-6) GN=adk PE=3 SV=1 41 240 1.0E-58
sp|Q39DJ3|KAD_BURL3 Adenylate kinase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=adk PE=3 SV=1 41 233 1.0E-58
sp|Q6FD71|KAD_ACIAD Adenylate kinase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=adk PE=3 SV=1 41 228 2.0E-58
sp|Q0BCH1|KAD_BURCM Adenylate kinase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=adk PE=3 SV=1 41 233 2.0E-58
sp|P43412|KAD_YEREN Adenylate kinase OS=Yersinia enterocolitica GN=adk PE=3 SV=1 41 229 2.0E-58
sp|Q13UR8|KAD_BURXL Adenylate kinase OS=Burkholderia xenovorans (strain LB400) GN=adk PE=3 SV=1 41 227 2.0E-58
sp|B4E9G1|KAD_BURCJ Adenylate kinase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=adk PE=3 SV=1 41 233 2.0E-58
sp|A0K9X1|KAD_BURCH Adenylate kinase OS=Burkholderia cenocepacia (strain HI2424) GN=adk PE=3 SV=1 41 233 2.0E-58
sp|B1JXF8|KAD_BURCC Adenylate kinase OS=Burkholderia cenocepacia (strain MC0-3) GN=adk PE=3 SV=1 41 233 2.0E-58
sp|Q1BU66|KAD_BURCA Adenylate kinase OS=Burkholderia cenocepacia (strain AU 1054) GN=adk PE=3 SV=1 41 233 2.0E-58
sp|A1ALW2|KAD_PELPD Adenylate kinase OS=Pelobacter propionicus (strain DSM 2379) GN=adk PE=3 SV=1 41 255 2.0E-58
sp|B9MKG1|KAD_CALBD Adenylate kinase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=adk PE=3 SV=1 41 253 2.0E-58
sp|B8CN03|KAD_SHEPW Adenylate kinase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=adk PE=3 SV=1 41 253 2.0E-58
sp|B7M3W6|KAD_ECO8A Adenylate kinase OS=Escherichia coli O8 (strain IAI1) GN=adk PE=3 SV=1 41 229 3.0E-58
sp|C0ZIK1|KAD_BREBN Adenylate kinase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=adk PE=3 SV=1 41 255 3.0E-58
sp|Q47XA8|KAD_COLP3 Adenylate kinase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=adk PE=3 SV=1 41 228 3.0E-58
sp|A6VQC3|KAD_ACTSZ Adenylate kinase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=adk PE=3 SV=1 41 228 4.0E-58
sp|Q32J54|KAD_SHIDS Adenylate kinase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=adk PE=3 SV=1 41 229 4.0E-58
sp|P84139|KAD_SPOGL Adenylate kinase OS=Sporosarcina globispora GN=adk PE=1 SV=1 41 255 4.0E-58
sp|Q18CH9|KAD_PEPD6 Adenylate kinase OS=Peptoclostridium difficile (strain 630) GN=adk PE=3 SV=1 41 257 6.0E-58
sp|A1BGN6|KAD_CHLPD Adenylate kinase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=adk PE=3 SV=1 41 238 6.0E-58
sp|Q250L1|KAD_DESHY Adenylate kinase OS=Desulfitobacterium hafniense (strain Y51) GN=adk PE=3 SV=1 41 256 7.0E-58
sp|B8G1Y7|KAD_DESHD Adenylate kinase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=adk PE=3 SV=1 41 256 7.0E-58
sp|P65202|KAD_STAAW Adenylate kinase OS=Staphylococcus aureus (strain MW2) GN=adk PE=3 SV=1 41 254 7.0E-58
sp|Q6G792|KAD_STAAS Adenylate kinase OS=Staphylococcus aureus (strain MSSA476) GN=adk PE=3 SV=1 41 254 7.0E-58
sp|Q6GEK4|KAD_STAAR Adenylate kinase OS=Staphylococcus aureus (strain MRSA252) GN=adk PE=3 SV=1 41 254 7.0E-58
sp|P99062|KAD_STAAN Adenylate kinase OS=Staphylococcus aureus (strain N315) GN=adk PE=1 SV=1 41 254 7.0E-58
sp|P65201|KAD_STAAM Adenylate kinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=adk PE=3 SV=1 41 254 7.0E-58
sp|Q5HDX9|KAD_STAAC Adenylate kinase OS=Staphylococcus aureus (strain COL) GN=adk PE=3 SV=1 41 254 7.0E-58
sp|P35140|KAD_BACLD Adenylate kinase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=adk PE=3 SV=2 41 258 9.0E-58
sp|Q83E75|KAD_COXBU Adenylate kinase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=adk PE=3 SV=1 41 254 1.0E-57
sp|A9NBU5|KAD_COXBR Adenylate kinase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=adk PE=3 SV=1 41 254 1.0E-57
sp|A9KED8|KAD_COXBN Adenylate kinase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=adk PE=3 SV=1 41 254 1.0E-57
sp|B6J1M3|KAD_COXB2 Adenylate kinase OS=Coxiella burnetii (strain CbuG_Q212) GN=adk PE=3 SV=1 41 254 1.0E-57
sp|B6J8H9|KAD_COXB1 Adenylate kinase OS=Coxiella burnetii (strain CbuK_Q154) GN=adk PE=3 SV=1 41 254 1.0E-57
sp|Q8R7X4|KAD_CALS4 Adenylate kinase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=adk PE=3 SV=1 41 258 1.0E-57
sp|O66490|KAD_AQUAE Adenylate kinase OS=Aquifex aeolicus (strain VF5) GN=adk PE=1 SV=1 43 256 1.0E-57
sp|A4JH80|KAD_BURVG Adenylate kinase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=adk PE=3 SV=1 41 233 2.0E-57
sp|B2TIJ6|KAD_CLOBB Adenylate kinase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=adk PE=3 SV=1 41 253 2.0E-57
sp|Q8PV26|KAD_METMA Adenylate kinase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=adk PE=3 SV=1 41 253 2.0E-57
sp|P57837|KAD_PASMU Adenylate kinase OS=Pasteurella multocida (strain Pm70) GN=adk PE=3 SV=1 41 228 2.0E-57
sp|B2UYD1|KAD_CLOBA Adenylate kinase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=adk PE=3 SV=1 41 253 2.0E-57
sp|B2T6M4|KAD_BURPP Adenylate kinase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=adk PE=3 SV=1 41 228 2.0E-57
sp|A1WSH6|KAD_VEREI Adenylate kinase OS=Verminephrobacter eiseniae (strain EF01-2) GN=adk PE=3 SV=1 41 242 3.0E-57
sp|Q97EJ9|KAD_CLOAB Adenylate kinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=adk PE=3 SV=1 41 253 3.0E-57
sp|C5D3T8|KAD_GEOSW Adenylate kinase OS=Geobacillus sp. (strain WCH70) GN=adk PE=3 SV=1 41 255 4.0E-57
sp|Q890Q5|KAD_CLOTE Adenylate kinase OS=Clostridium tetani (strain Massachusetts / E88) GN=adk PE=3 SV=1 41 253 4.0E-57
sp|A4SLY1|KAD_AERS4 Adenylate kinase OS=Aeromonas salmonicida (strain A449) GN=adk PE=3 SV=1 41 253 4.0E-57
sp|A1VNK2|KAD_POLNA Adenylate kinase OS=Polaromonas naphthalenivorans (strain CJ2) GN=adk PE=3 SV=1 41 227 5.0E-57
sp|B0TC77|KAD_HELMI Adenylate kinase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=adk PE=3 SV=1 41 253 6.0E-57
sp|Q8ETW3|KAD_OCEIH Adenylate kinase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=adk PE=3 SV=1 41 254 6.0E-57
sp|A0KL52|KAD_AERHH Adenylate kinase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=adk PE=3 SV=1 41 229 8.0E-57
sp|B0UT69|KAD_HISS2 Adenylate kinase OS=Histophilus somni (strain 2336) GN=adk PE=3 SV=1 41 228 9.0E-57
sp|Q0I2Y5|KAD_HAES1 Adenylate kinase OS=Haemophilus somnus (strain 129Pt) GN=adk PE=3 SV=1 41 228 9.0E-57
sp|Q0W1W4|KAD_METAR Adenylate kinase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=adk PE=3 SV=1 41 249 9.0E-57
sp|C4K7W8|KAD_HAMD5 Adenylate kinase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=adk PE=3 SV=1 41 229 1.0E-56
sp|B8I800|KAD_CLOCE Adenylate kinase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=adk PE=3 SV=1 41 253 1.0E-56
sp|B1YGX1|KAD_EXIS2 Adenylate kinase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=adk PE=3 SV=1 41 255 1.0E-56
sp|C4Z2V1|KAD_EUBE2 Adenylate kinase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=adk PE=3 SV=1 41 253 1.0E-56
sp|A7Z0Q9|KAD_BACMF Adenylate kinase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=adk PE=3 SV=1 41 255 1.0E-56
sp|C4ZBT9|KAD_EUBR3 Adenylate kinase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=adk PE=3 SV=1 41 253 2.0E-56
sp|A8F9A6|KAD_BACP2 Adenylate kinase OS=Bacillus pumilus (strain SAFR-032) GN=adk PE=3 SV=1 41 258 2.0E-56
sp|A7GK41|KAD_BACCN Adenylate kinase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=adk PE=3 SV=1 41 256 2.0E-56
sp|Q7VMY0|KAD_HAEDU Adenylate kinase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=adk PE=3 SV=1 41 227 3.0E-56
sp|Q7N0P5|KAD_PHOLL Adenylate kinase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=adk PE=3 SV=1 41 254 3.0E-56
sp|Q8TRS3|KAD_METAC Adenylate kinase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=adk PE=3 SV=1 41 253 3.0E-56
sp|Q8CRI0|KAD_STAES Adenylate kinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=adk PE=3 SV=1 41 254 3.0E-56
sp|Q5HM20|KAD_STAEQ Adenylate kinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=adk PE=3 SV=1 41 254 3.0E-56
sp|A3DJJ3|KAD_CLOTH Adenylate kinase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=adk PE=3 SV=1 41 257 3.0E-56
sp|C4KZM5|KAD_EXISA Adenylate kinase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=adk PE=3 SV=1 41 249 4.0E-56
sp|A9KJH3|KAD_CLOPH Adenylate kinase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=adk PE=3 SV=1 41 253 5.0E-56
sp|A9VP98|KAD_BACWK Adenylate kinase OS=Bacillus weihenstephanensis (strain KBAB4) GN=adk PE=3 SV=1 41 256 1.0E-55
sp|B4SA64|KAD_PELPB Adenylate kinase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=adk PE=3 SV=1 41 227 2.0E-55
sp|B3H271|KAD_ACTP7 Adenylate kinase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=adk PE=3 SV=1 41 227 2.0E-55
sp|A4XLR0|KAD_CALS8 Adenylate kinase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=adk PE=3 SV=1 41 253 2.0E-55
sp|B7IT40|KAD_BACC2 Adenylate kinase OS=Bacillus cereus (strain G9842) GN=adk PE=3 SV=1 41 256 2.0E-55
sp|A0LIL1|KAD_SYNFM Adenylate kinase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=adk PE=3 SV=1 41 253 3.0E-55
sp|B9JVQ8|KAD_AGRVS Adenylate kinase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=adk PE=3 SV=1 41 255 3.0E-55
sp|Q81J22|KAD_BACCR Adenylate kinase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=adk PE=3 SV=1 41 256 3.0E-55
sp|B7HJ69|KAD_BACC4 Adenylate kinase OS=Bacillus cereus (strain B4264) GN=adk PE=3 SV=1 41 256 3.0E-55
sp|B9IZL5|KAD_BACCQ Adenylate kinase OS=Bacillus cereus (strain Q1) GN=adk PE=3 SV=1 41 256 3.0E-55
sp|B7HQW5|KAD_BACC7 Adenylate kinase OS=Bacillus cereus (strain AH187) GN=adk PE=3 SV=1 41 256 3.0E-55
sp|Q73F75|KAD_BACC1 Adenylate kinase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=adk PE=3 SV=1 41 256 3.0E-55
sp|B3E851|KAD_GEOLS Adenylate kinase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=adk PE=3 SV=1 41 228 4.0E-55
sp|A4IJK9|KAD_GEOTN Adenylate kinase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=adk PE=3 SV=1 41 255 5.0E-55
sp|Q5L3R8|KAD_GEOKA Adenylate kinase OS=Geobacillus kaustophilus (strain HTA426) GN=adk PE=3 SV=1 41 255 5.0E-55
sp|B0BQN2|KAD_ACTPJ Adenylate kinase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=adk PE=3 SV=1 41 227 6.0E-55
sp|A3N1U8|KAD_ACTP2 Adenylate kinase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=adk PE=3 SV=1 41 227 6.0E-55
sp|B6IRS7|KAD_RHOCS Adenylate kinase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=adk PE=3 SV=1 41 255 6.0E-55
sp|A1B049|KAD_PARDP Adenylate kinase OS=Paracoccus denitrificans (strain Pd 1222) GN=adk PE=3 SV=1 41 254 9.0E-55
sp|P10772|KAD_PARDE Adenylate kinase OS=Paracoccus denitrificans GN=adk PE=1 SV=3 41 254 9.0E-55
sp|Q59627|KAD_NEIPO Adenylate kinase (Fragment) OS=Neisseria polysaccharea GN=adk PE=3 SV=1 60 229 1.0E-54
sp|Q0AUK1|KAD_SYNWW Adenylate kinase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=adk PE=3 SV=1 41 254 2.0E-54
sp|B1W3Y6|KAD_STRGG Adenylate kinase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=adk PE=3 SV=1 41 254 2.0E-54
sp|Q59594|KAD_NEICI Adenylate kinase (Fragment) OS=Neisseria cinerea GN=adk PE=3 SV=1 60 229 2.0E-54
sp|Q59628|KAD_NEIPH Adenylate kinase (Fragment) OS=Neisseria pharyngis GN=adk PE=3 SV=1 60 229 2.0E-54
sp|Q59615|KAD_NEILA Adenylate kinase (Fragment) OS=Neisseria lactamica GN=adk PE=3 SV=1 60 229 2.0E-54
sp|Q59596|KAD_NEIFL Adenylate kinase (Fragment) OS=Neisseria flavescens GN=adk PE=3 SV=1 60 229 2.0E-54
sp|Q927M8|KAD_LISIN Adenylate kinase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=adk PE=3 SV=1 41 253 3.0E-54
sp|P27142|KAD_GEOSE Adenylate kinase OS=Geobacillus stearothermophilus GN=adk PE=1 SV=1 41 255 3.0E-54
sp|Q6HPN7|KAD_BACHK Adenylate kinase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=adk PE=3 SV=1 41 256 5.0E-54
sp|Q63H69|KAD_BACCZ Adenylate kinase OS=Bacillus cereus (strain ZK / E33L) GN=adk PE=3 SV=1 41 256 5.0E-54
sp|C1ET60|KAD_BACC3 Adenylate kinase OS=Bacillus cereus (strain 03BB102) GN=adk PE=3 SV=1 41 256 5.0E-54
sp|B7JKE1|KAD_BACC0 Adenylate kinase OS=Bacillus cereus (strain AH820) GN=adk PE=3 SV=1 41 256 5.0E-54
sp|Q81VQ9|KAD_BACAN Adenylate kinase OS=Bacillus anthracis GN=adk PE=3 SV=1 41 256 5.0E-54
sp|A0R8K1|KAD_BACAH Adenylate kinase OS=Bacillus thuringiensis (strain Al Hakam) GN=adk PE=3 SV=1 41 256 5.0E-54
sp|C3LJA3|KAD_BACAC Adenylate kinase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=adk PE=3 SV=1 41 256 5.0E-54
sp|C3P9S6|KAD_BACAA Adenylate kinase OS=Bacillus anthracis (strain A0248) GN=adk PE=3 SV=1 41 256 5.0E-54
sp|Q71WG7|KAD_LISMF Adenylate kinase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=adk PE=3 SV=1 41 253 8.0E-54
sp|C1KZF9|KAD_LISMC Adenylate kinase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=adk PE=3 SV=1 41 253 8.0E-54
sp|P49983|KADH_TRIVA Adenylate kinase OS=Trichomonas vaginalis PE=1 SV=1 36 242 1.0E-53
sp|Q8RE31|KAD_FUSNN Adenylate kinase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=adk PE=3 SV=1 41 253 2.0E-53
sp|Q1LTX5|KAD_BAUCH Adenylate kinase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=adk PE=3 SV=1 41 232 2.0E-53
sp|A5GAW3|KAD_GEOUR Adenylate kinase OS=Geobacter uraniireducens (strain Rf4) GN=adk PE=3 SV=1 41 261 4.0E-53
sp|Q8Y449|KAD_LISMO Adenylate kinase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=adk PE=3 SV=1 41 253 5.0E-53
sp|B0RZT0|KAD_FINM2 Adenylate kinase OS=Finegoldia magna (strain ATCC 29328) GN=adk PE=3 SV=1 41 256 8.0E-53
sp|A9BFZ7|KAD_PETMO Adenylate kinase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=adk PE=3 SV=1 41 258 9.0E-53
sp|B9M6F7|KAD_GEODF Adenylate kinase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=adk PE=3 SV=1 41 255 1.0E-52
sp|A8MLG1|KAD_ALKOO Adenylate kinase OS=Alkaliphilus oremlandii (strain OhILAs) GN=adk PE=3 SV=1 41 253 2.0E-52
sp|Q9WTP7|KAD3_MOUSE GTP:AMP phosphotransferase AK3, mitochondrial OS=Mus musculus GN=Ak3 PE=1 SV=3 36 254 2.0E-52
sp|Q8DS33|KAD_STRMU Adenylate kinase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=adk PE=3 SV=1 41 253 2.0E-52
sp|B3PWU2|KAD_RHIE6 Adenylate kinase OS=Rhizobium etli (strain CIAT 652) GN=adk PE=3 SV=1 41 253 2.0E-52
sp|A0ALU7|KAD_LISW6 Adenylate kinase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=adk PE=3 SV=1 41 253 3.0E-52
sp|B5EFS1|KAD_GEOBB Adenylate kinase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=adk PE=3 SV=1 41 237 4.0E-52
sp|P16304|KAD_BACSU Adenylate kinase OS=Bacillus subtilis (strain 168) GN=adk PE=1 SV=2 41 258 4.0E-52
sp|Q493A3|KAD_BLOPB Adenylate kinase OS=Blochmannia pennsylvanicus (strain BPEN) GN=adk PE=3 SV=1 41 253 4.0E-52
sp|C6E4N6|KAD_GEOSM Adenylate kinase OS=Geobacter sp. (strain M21) GN=adk PE=3 SV=1 41 237 4.0E-52
sp|Q3A6M6|KAD_PELCD Adenylate kinase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=adk PE=3 SV=1 41 256 4.0E-52
sp|A0LRP1|KAD_ACIC1 Adenylate kinase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=adk PE=3 SV=1 41 238 5.0E-52
sp|B7L0S9|KAD_METC4 Adenylate kinase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=adk PE=3 SV=1 41 262 6.0E-52
sp|B1I3R5|KAD_DESAP Adenylate kinase OS=Desulforudis audaxviator (strain MP104C) GN=adk PE=3 SV=1 41 250 6.0E-52
sp|Q2K9J5|KAD_RHIEC Adenylate kinase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=adk PE=3 SV=1 41 253 7.0E-52
sp|Q12ZS7|KAD_METBU Adenylate kinase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=adk PE=3 SV=1 41 254 7.0E-52
sp|Q2G8V9|KAD_NOVAD Adenylate kinase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=adk PE=3 SV=1 41 253 8.0E-52
sp|Q5RDZ0|KAD3_PONAB GTP:AMP phosphotransferase AK3, mitochondrial OS=Pongo abelii GN=AK3 PE=2 SV=3 36 254 1.0E-51
sp|B5XJ57|KAD_STRPZ Adenylate kinase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=adk PE=3 SV=1 41 249 1.0E-51
sp|Q48VS8|KAD_STRPM Adenylate kinase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=adk PE=3 SV=1 41 249 1.0E-51
sp|Q1JJ40|KAD_STRPD Adenylate kinase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=adk PE=3 SV=1 41 249 1.0E-51
sp|Q1JNZ6|KAD_STRPC Adenylate kinase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=adk PE=3 SV=1 41 249 1.0E-51
sp|Q1JE38|KAD_STRPB Adenylate kinase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=adk PE=3 SV=1 41 249 1.0E-51
sp|Q8P2Z4|KAD_STRP8 Adenylate kinase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=adk PE=3 SV=1 41 249 1.0E-51
sp|Q9UIJ7|KAD3_HUMAN GTP:AMP phosphotransferase AK3, mitochondrial OS=Homo sapiens GN=AK3 PE=1 SV=4 36 254 1.0E-51
sp|B8DB29|KAD_LISMH Adenylate kinase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=adk PE=3 SV=1 41 253 2.0E-51
sp|A1STI3|KAD_PSYIN Adenylate kinase OS=Psychromonas ingrahamii (strain 37) GN=adk PE=3 SV=1 41 229 2.0E-51
sp|Q82DM5|KAD_STRAW Adenylate kinase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=adk PE=3 SV=1 41 254 2.0E-51
sp|A9W4R9|KAD_METEP Adenylate kinase OS=Methylobacterium extorquens (strain PA1) GN=adk PE=3 SV=1 41 262 2.0E-51
sp|P43414|KAD_STRCO Adenylate kinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=adk PE=3 SV=3 41 253 2.0E-51
sp|B9JDU9|KAD_AGRRK Adenylate kinase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=adk PE=3 SV=1 41 253 3.0E-51
sp|B2G8V7|KAD_LACRJ Adenylate kinase OS=Lactobacillus reuteri (strain JCM 1112) GN=adk PE=3 SV=1 41 253 3.0E-51
sp|P65204|KAD_STRA5 Adenylate kinase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=adk PE=3 SV=1 41 249 4.0E-51
sp|P65203|KAD_STRA3 Adenylate kinase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=adk PE=3 SV=1 41 249 4.0E-51
sp|Q59591|KAD_NEIAN Adenylate kinase (Fragment) OS=Neisseria animalis GN=adk PE=3 SV=1 60 229 4.0E-51
sp|B9DSX1|KAD_STRU0 Adenylate kinase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=adk PE=3 SV=1 41 254 4.0E-51
sp|P0DB93|KAD_STRPQ Adenylate kinase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=adk PE=3 SV=1 41 249 4.0E-51
sp|Q1J8Z2|KAD_STRPF Adenylate kinase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=adk PE=3 SV=1 41 249 4.0E-51
sp|P0DB92|KAD_STRP3 Adenylate kinase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=adk PE=3 SV=1 41 249 4.0E-51
sp|P69882|KAD_STRP1 Adenylate kinase OS=Streptococcus pyogenes serotype M1 GN=adk PE=3 SV=1 41 249 5.0E-51
sp|Q749A8|KAD_GEOSL Adenylate kinase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=adk PE=3 SV=1 41 254 5.0E-51
sp|B0K5R3|KAD_THEPX Adenylate kinase OS=Thermoanaerobacter sp. (strain X514) GN=adk PE=3 SV=1 41 261 6.0E-51
sp|B0KCM0|KAD_THEP3 Adenylate kinase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=adk PE=3 SV=1 41 261 6.0E-51
sp|Q839E3|KAD_ENTFA Adenylate kinase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=adk PE=3 SV=1 41 254 7.0E-51
sp|A4VSH4|KAD_STRSY Adenylate kinase OS=Streptococcus suis (strain 05ZYH33) GN=adk PE=3 SV=1 41 253 2.0E-50
sp|A4VYR4|KAD_STRS2 Adenylate kinase OS=Streptococcus suis (strain 98HAH33) GN=adk PE=3 SV=1 41 253 2.0E-50
sp|Q5XEB4|KAD_STRP6 Adenylate kinase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=adk PE=1 SV=1 41 249 3.0E-50
sp|B1Z772|KAD_METPB Adenylate kinase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=adk PE=3 SV=1 41 262 3.0E-50
sp|P08760|KAD3_BOVIN GTP:AMP phosphotransferase AK3, mitochondrial OS=Bos taurus GN=AK3 PE=1 SV=3 36 254 3.0E-50
sp|A2RC35|KAD_STRPG Adenylate kinase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=adk PE=3 SV=1 41 249 4.0E-50
sp|B7IHW7|KAD_THEAB Adenylate kinase OS=Thermosipho africanus (strain TCF52B) GN=adk PE=3 SV=1 41 253 4.0E-50
sp|A9H3J9|KAD_GLUDA Adenylate kinase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=adk PE=3 SV=1 41 255 4.0E-50
sp|A9NEF4|KAD_ACHLI Adenylate kinase OS=Acholeplasma laidlawii (strain PG-8A) GN=adk PE=3 SV=1 42 254 5.0E-50
sp|A3CK85|KAD_STRSV Adenylate kinase OS=Streptococcus sanguinis (strain SK36) GN=adk PE=3 SV=1 41 253 6.0E-50
sp|Q3K3U8|KAD_STRA1 Adenylate kinase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=adk PE=3 SV=1 41 249 6.0E-50
sp|Q3J7A3|KAD_NITOC Adenylate kinase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=adk PE=3 SV=1 41 257 1.0E-49
sp|A6LLN4|KAD_THEM4 Adenylate kinase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=adk PE=3 SV=1 41 253 1.0E-49
sp|P29411|KAD3_RAT GTP:AMP phosphotransferase AK3, mitochondrial OS=Rattus norvegicus GN=Ak3 PE=2 SV=2 36 240 2.0E-49
sp|P61115|KAD_BDEBA Adenylate kinase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=adk PE=3 SV=1 41 254 2.0E-49
sp|B9K8A7|KAD_THENN Adenylate kinase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=adk PE=3 SV=1 43 253 5.0E-49
sp|Q8GGL2|KAD_THENE Adenylate kinase OS=Thermotoga neapolitana GN=adk PE=3 SV=1 43 253 5.0E-49
sp|Q67JW4|KAD_SYMTH Adenylate kinase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=adk PE=3 SV=1 41 257 6.0E-49
sp|B8IT32|KAD_METNO Adenylate kinase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=adk PE=3 SV=1 41 255 6.0E-49
sp|Q2W2L1|KAD_MAGSA Adenylate kinase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=adk PE=3 SV=1 53 257 8.0E-49
sp|B8D813|KAD_BUCAT Adenylate kinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=adk PE=3 SV=1 41 227 1.0E-48
sp|P57556|KAD_BUCAI Adenylate kinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=adk PE=3 SV=1 41 227 1.0E-48
sp|B8D9R1|KAD_BUCA5 Adenylate kinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=adk PE=3 SV=1 41 227 1.0E-48
sp|B2IK83|KAD_BEII9 Adenylate kinase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=adk PE=3 SV=1 41 255 2.0E-48
sp|A5V5Y1|KAD_SPHWW Adenylate kinase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=adk PE=3 SV=1 41 254 2.0E-48
sp|B8ELE2|KAD_METSB Adenylate kinase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=adk PE=3 SV=1 41 237 3.0E-48
sp|B2GDU8|KAD_LACF3 Adenylate kinase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=adk PE=3 SV=1 41 253 3.0E-48
sp|Q5NQ43|KAD_ZYMMO Adenylate kinase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=adk PE=3 SV=1 41 254 4.0E-48
sp|Q9X1I8|KAD_THEMA Adenylate kinase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=adk PE=3 SV=1 43 253 4.0E-48
sp|A8M508|KAD_SALAI Adenylate kinase OS=Salinispora arenicola (strain CNS-205) GN=adk PE=3 SV=1 41 253 4.0E-48
sp|A7HWT2|KAD_PARL1 Adenylate kinase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=adk PE=3 SV=1 41 271 5.0E-48
sp|A8AZK4|KAD_STRGC Adenylate kinase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=adk PE=3 SV=1 41 254 5.0E-48
sp|A6U880|KAD_SINMW Adenylate kinase OS=Sinorhizobium medicae (strain WSM419) GN=adk PE=3 SV=1 41 237 6.0E-48
sp|B1LBL9|KAD_THESQ Adenylate kinase OS=Thermotoga sp. (strain RQ2) GN=adk PE=3 SV=1 43 253 6.0E-48
sp|A5IMA4|KAD_THEP1 Adenylate kinase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=adk PE=3 SV=1 43 253 6.0E-48
sp|Q02W46|KAD_LACLS Adenylate kinase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=adk PE=3 SV=1 41 253 7.0E-48
[Show less]

GO

GO Term Description Terminal node
GO:0004017 adenylate kinase activity Yes
GO:0003824 catalytic activity No
GO:0016776 phosphotransferase activity, phosphate group as acceptor No
GO:0019205 nucleobase-containing compound kinase activity No
GO:0003674 molecular_function No
GO:0050145 nucleoside monophosphate kinase activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016740 transferase activity No
GO:0016301 kinase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8151
MGFVEDELLQLKDVVSNLDSRIKRLEQRATGSSSPATSEELRMILIGPPGAGKGTQAPKIKERFSCCHLATGDML
RSQVAKKTTLGREAKKIMDQGGLVSDDIVIGMIKEELDHNKECRGGFILDGFPRTVPQAEGLDAMLQERNQKLQH
AVELQIDDSLLVARVTGRLIHPASGRSYHTTFNPPKEPLKDDVTGEPLIQRSDDNADALKTRLATYHKQTTPVVD
YYQKTGIWKGVDASQQPGQVWKSVLDVLEGGKKSHGSSILSRITGKS*
Coding >OphauB2|8151
ATGGGTTTCGTCGAGGACGAGCTGCTCCAGCTCAAGGATGTCGTCTCAAATCTCGATTCGCGCATCAAGCGCCTA
GAGCAGCGCGCTACCGGCTCATCTTCGCCCGCAACGTCGGAGGAGCTGCGCATGATACTCATTGGTCCTCCAGGA
GCCGGCAAGGGAACCCAAGCCCCCAAGATCAAGGAACGCTTCTCTTGCTGTCACTTGGCTACCGGTGACATGCTG
CGCTCTCAAGTCGCCAAGAAGACGACCTTGGGCCGAGAAGCCAAAAAGATCATGGACCAAGGCGGCCTCGTCAGC
GACGACATCGTCATCGGCATGATCAAGGAGGAGCTTGACCACAATAAGGAGTGTCGTGGAGGCTTCATTCTTGAC
GGCTTCCCCCGCACTGTTCCACAAGCCGAGGGCCTCGATGCCATGCTTCAGGAACGCAATCAAAAGCTTCAACAT
GCCGTTGAACTCCAGATTGATGATTCTCTTCTCGTCGCTCGCGTTACTGGCCGCTTGATTCACCCCGCTTCTGGG
CGTTCGTACCACACCACGTTCAACCCTCCCAAGGAGCCCCTCAAGGATGATGTGACTGGCGAGCCTCTGATTCAG
CGGAGCGACGACAATGCCGACGCCCTCAAGACGCGGTTGGCAACCTATCATAAACAGACGACACCCGTCGTGGAC
TATTACCAGAAAACGGGCATATGGAAGGGTGTCGATGCAAGCCAACAGCCTGGCCAGGTTTGGAAGAGCGTCCTT
GATGTTCTCGAGGGCGGTAAAAAGAGCCATGGCTCCAGCATCTTGAGCCGAATCACAGGCAAGAGCTAA
Transcript >OphauB2|8151
ATGGGTTTCGTCGAGGACGAGCTGCTCCAGCTCAAGGATGTCGTCTCAAATCTCGATTCGCGCATCAAGCGCCTA
GAGCAGCGCGCTACCGGCTCATCTTCGCCCGCAACGTCGGAGGAGCTGCGCATGATACTCATTGGTCCTCCAGGA
GCCGGCAAGGGAACCCAAGCCCCCAAGATCAAGGAACGCTTCTCTTGCTGTCACTTGGCTACCGGTGACATGCTG
CGCTCTCAAGTCGCCAAGAAGACGACCTTGGGCCGAGAAGCCAAAAAGATCATGGACCAAGGCGGCCTCGTCAGC
GACGACATCGTCATCGGCATGATCAAGGAGGAGCTTGACCACAATAAGGAGTGTCGTGGAGGCTTCATTCTTGAC
GGCTTCCCCCGCACTGTTCCACAAGCCGAGGGCCTCGATGCCATGCTTCAGGAACGCAATCAAAAGCTTCAACAT
GCCGTTGAACTCCAGATTGATGATTCTCTTCTCGTCGCTCGCGTTACTGGCCGCTTGATTCACCCCGCTTCTGGG
CGTTCGTACCACACCACGTTCAACCCTCCCAAGGAGCCCCTCAAGGATGATGTGACTGGCGAGCCTCTGATTCAG
CGGAGCGACGACAATGCCGACGCCCTCAAGACGCGGTTGGCAACCTATCATAAACAGACGACACCCGTCGTGGAC
TATTACCAGAAAACGGGCATATGGAAGGGTGTCGATGCAAGCCAACAGCCTGGCCAGGTTTGGAAGAGCGTCCTT
GATGTTCTCGAGGGCGGTAAAAAGAGCCATGGCTCCAGCATCTTGAGCCGAATCACAGGCAAGAGCTAA
Gene >OphauB2|8151
ATGGGTTTCGTCGAGGACGAGCTGCTCCAGCTCAAGGATGTCGTCTCAAATCTCGATTCGCGCATCAAGCGCCTA
GAGCAGCGCGCTACCGGCTCATCTTCGCCCGCAACGTCGGAGGAGCTGCGCATGATACTCATTGGTCCTCCAGGA
GCCGGTGCGCACTCTTGATGCTCGCGTCTTGTCGCCATGGCCTTTTTTTTTTGCTAACGAGACGCTGCAAAGGCA
AGGGAACCCAAGCCCCCAAGATCAAGGAACGCTTCTCTTGCTGTCACTTGGTGCGTGGCACATCTCGAGAGAGCC
ATTGTCCCCCCATTCGGCTCTGACTCGGCTGCTTTTCTAGGCTACCGGTGACATGCTGCGCTCTCAAGTCGCCAA
GAAGACGACCTTGGGCCGAGAAGCCAAAAAGATCATGGACCAAGGCGGCCTCGTCAGCGACGACATCGTCATCGG
CATGATCAAGGAGGAGCTTGACCACAATAAGGAGTGTCGTGGAGGGTGCGTGCCTGGCTATAGACCGTGTTTTTG
TGTCGTCTTGTCTGACTCTGCGCCATGCGCTCAGCTTCATTCTTGACGGCTTCCCCCGCACTGTTCCACAAGCCG
AGGGCCTCGATGCCATGCTTCAGGAACGCAATCAAAAGCTTCAACATGCCGTTGAACTCCAGATTGATGATTCTC
TTCTCGTCGCTCGCGTTACTGGCCGCTTGATTCACCCCGCTTCTGGGCGTTCGTACCACACCACGTTCAACCCTC
CCAAGGAGCCCCTCAAGGATGATGTGACTGGCGAGCCTCTGATTCAGCGGAGCGACGACAATGCCGACGCCCTCA
AGACGCGGTTGGCAACCTATCATAAACAGACGACACCCGTCGTGGACTATTACCAGAAAACGGGCATATGGAAGG
GTGTCGATGCAAGCCAACAGCCTGGCCAGGTTTGGAAGAGCGTCCTTGATGTTCTCGAGGGCGGTAAAAAGAGCC
ATGGCTCCAGCATCTTGAGCCGAATCACAGGCAAGAGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail