Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8150
Gene name
LocationContig_99:13991..15429
Strand+
Gene length (bp)1438
Transcript length (bp)1386
Coding sequence length (bp)1386
Protein length (aa) 462

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 21 0.999555

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup725
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2549
Ophiocordyceps australis map64 (Brazil) OphauB2|8150 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00846
Ophiocordyceps camponoti-rufipedis Ophun1|1758
Ophiocordyceps kimflemingae Ophio5|607
Ophiocordyceps subramaniannii Hirsu2|1750
Ophiocordyceps subramaniannii Hirsu2|3274
Ophiocordyceps subramaniannii Hirsu2|4091

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8150
MKSLTLSLVAAIINSPRFAIATKVDSVREIGKDAVIKGSSVTWDSGKGWRDSFMCNENRILSISIDKKWAACCQD
NGSLKGSQATEFHCCAPGHDLAGSKEVGFNCCPTGQDFNGKVCKLVCKNGKNLVDGKCVCPEGYVEAADDTCTEA
PVKGGCTSGLTTGKCYMFKGETGRRLAYKNKQYSETIPHKDAIPGKFQLCRDEKCTPGLPINPNHEIHIKDLHGS
PPTSADAGQWLNNNGGGAHIGKTPDYAKSGNFSITRWPCGKYCLSGIQRGLGVACPSEDPSITFYGSATEACIEY
DLLEVPCKIRDKRNNCIWKNGKNQCCSKTDCSDTTPDHNPDDKPGDKPDPTGSTPHVPEETKSPMEKLCPSQHDT
TIEAFGIGFRILCGWQFGPGEKVDTEKNVLDPLSCHAKCAKDKKCQGANWDMVNLGCSCSRDWEAAIVEGNFSYV
TFHPTFVRPRD*
Coding >OphauB2|8150
ATGAAGAGTCTCACGTTGAGCCTTGTGGCCGCTATCATAAACTCGCCTCGCTTTGCCATTGCGACAAAGGTCGAT
AGCGTGAGAGAAATTGGCAAAGATGCTGTCATCAAGGGCAGCAGTGTCACCTGGGATAGTGGCAAAGGCTGGAGA
GACAGCTTCATGTGTAATGAAAATAGAATTCTCAGCATAAGCATCGACAAAAAATGGGCCGCGTGCTGCCAGGAC
AACGGCTCTCTCAAGGGATCGCAGGCAACTGAATTCCACTGCTGCGCCCCGGGACACGACCTAGCGGGCTCCAAG
GAGGTCGGCTTTAACTGCTGCCCTACGGGTCAAGACTTTAATGGCAAGGTCTGCAAACTTGTTTGCAAGAATGGG
AAGAACTTGGTCGACGGCAAATGTGTCTGTCCAGAGGGCTATGTCGAAGCCGCAGACGACACTTGCACTGAGGCG
CCCGTCAAGGGAGGATGCACGTCTGGACTAACGACGGGAAAATGCTACATGTTCAAGGGAGAGACTGGACGTCGA
CTGGCTTACAAGAACAAGCAGTACTCGGAAACGATTCCTCACAAGGACGCTATCCCAGGCAAGTTCCAGCTCTGC
CGCGACGAAAAATGTACGCCTGGATTGCCCATCAACCCCAACCACGAAATCCACATCAAGGACTTGCACGGATCT
CCCCCAACCTCTGCCGATGCAGGCCAGTGGCTCAACAACAATGGCGGAGGCGCCCACATTGGCAAGACGCCCGAC
TATGCAAAGTCTGGCAACTTTTCCATCACCAGGTGGCCCTGTGGCAAATACTGTCTTAGTGGAATTCAAAGGGGT
CTTGGCGTGGCCTGCCCGTCCGAGGATCCTTCCATCACCTTTTACGGCAGCGCCACAGAGGCCTGTATTGAGTAT
GATTTGCTCGAGGTGCCTTGTAAGATTAGAGACAAGAGAAATAACTGCATCTGGAAGAATGGAAAGAACCAATGC
TGCAGCAAGACGGACTGCTCCGACACCACGCCTGACCACAATCCCGATGACAAGCCCGGCGACAAGCCAGATCCC
ACTGGCAGCACGCCTCACGTCCCCGAGGAGACCAAGTCGCCCATGGAGAAGCTTTGCCCGTCCCAGCACGACACG
ACGATTGAGGCCTTTGGCATCGGCTTCCGCATCCTCTGCGGCTGGCAATTTGGGCCTGGCGAAAAGGTAGACACT
GAGAAGAACGTGCTCGACCCTCTGTCTTGCCATGCCAAGTGCGCCAAGGATAAGAAGTGCCAGGGAGCCAACTGG
GACATGGTCAACCTGGGCTGCTCCTGCAGCAGGGACTGGGAGGCTGCCATTGTCGAAGGCAACTTTAGCTACGTT
ACTTTCCACCCTACGTTTGTCCGGCCACGCGATTAA
Transcript >OphauB2|8150
ATGAAGAGTCTCACGTTGAGCCTTGTGGCCGCTATCATAAACTCGCCTCGCTTTGCCATTGCGACAAAGGTCGAT
AGCGTGAGAGAAATTGGCAAAGATGCTGTCATCAAGGGCAGCAGTGTCACCTGGGATAGTGGCAAAGGCTGGAGA
GACAGCTTCATGTGTAATGAAAATAGAATTCTCAGCATAAGCATCGACAAAAAATGGGCCGCGTGCTGCCAGGAC
AACGGCTCTCTCAAGGGATCGCAGGCAACTGAATTCCACTGCTGCGCCCCGGGACACGACCTAGCGGGCTCCAAG
GAGGTCGGCTTTAACTGCTGCCCTACGGGTCAAGACTTTAATGGCAAGGTCTGCAAACTTGTTTGCAAGAATGGG
AAGAACTTGGTCGACGGCAAATGTGTCTGTCCAGAGGGCTATGTCGAAGCCGCAGACGACACTTGCACTGAGGCG
CCCGTCAAGGGAGGATGCACGTCTGGACTAACGACGGGAAAATGCTACATGTTCAAGGGAGAGACTGGACGTCGA
CTGGCTTACAAGAACAAGCAGTACTCGGAAACGATTCCTCACAAGGACGCTATCCCAGGCAAGTTCCAGCTCTGC
CGCGACGAAAAATGTACGCCTGGATTGCCCATCAACCCCAACCACGAAATCCACATCAAGGACTTGCACGGATCT
CCCCCAACCTCTGCCGATGCAGGCCAGTGGCTCAACAACAATGGCGGAGGCGCCCACATTGGCAAGACGCCCGAC
TATGCAAAGTCTGGCAACTTTTCCATCACCAGGTGGCCCTGTGGCAAATACTGTCTTAGTGGAATTCAAAGGGGT
CTTGGCGTGGCCTGCCCGTCCGAGGATCCTTCCATCACCTTTTACGGCAGCGCCACAGAGGCCTGTATTGAGTAT
GATTTGCTCGAGGTGCCTTGTAAGATTAGAGACAAGAGAAATAACTGCATCTGGAAGAATGGAAAGAACCAATGC
TGCAGCAAGACGGACTGCTCCGACACCACGCCTGACCACAATCCCGATGACAAGCCCGGCGACAAGCCAGATCCC
ACTGGCAGCACGCCTCACGTCCCCGAGGAGACCAAGTCGCCCATGGAGAAGCTTTGCCCGTCCCAGCACGACACG
ACGATTGAGGCCTTTGGCATCGGCTTCCGCATCCTCTGCGGCTGGCAATTTGGGCCTGGCGAAAAGGTAGACACT
GAGAAGAACGTGCTCGACCCTCTGTCTTGCCATGCCAAGTGCGCCAAGGATAAGAAGTGCCAGGGAGCCAACTGG
GACATGGTCAACCTGGGCTGCTCCTGCAGCAGGGACTGGGAGGCTGCCATTGTCGAAGGCAACTTTAGCTACGTT
ACTTTCCACCCTACGTTTGTCCGGCCACGCGATTAA
Gene >OphauB2|8150
ATGAAGAGTCTCACGTTGAGCCTTGTGGCCGCTATCATAAACTCGCCTCGCTTTGCCATTGCGACAAAGGTCGAT
AGCGTGAGAGAAATTGGCAAAGATGCTGTCATCAAGGGCAGCAGTGTCACCTGGGATAGTGGCAAAGGCTGGAGA
GACAGCTTCATGTGTAATGAAAATAGAATTCTCAGCATAAGCATCGACAAAAAATGGGCCGCGTGCTGCCAGGAC
AACGGCTCTCTCAAGGGATCGCAGGCAACTGAATTCCACTGCTGCGCCCCGGGACACGACCTAGCGGGCTCCAAG
GAGGTCGGCTTTAACTGCTGCCCTACGGGTCAAGACTTTAATGGCAAGGTCTGCAAACTTGTTTGCAAGAATGGG
AAGAACTTGGTCGACGGCAAATGTGTCTGTCCAGAGGGCTATGTCGAAGCCGCAGACGACACTTGCACTGAGGCG
CCCGTCAAGGGAGGATGCACGTCTGGACTAACGACGGGTAATGCTGCCATGTTCTCTCTAGATATCGAGCCTGGC
TAACTCGAAGACAGGAAAATGCTACATGTTCAAGGGAGAGACTGGACGTCGACTGGCTTACAAGAACAAGCAGTA
CTCGGAAACGATTCCTCACAAGGACGCTATCCCAGGCAAGTTCCAGCTCTGCCGCGACGAAAAATGTACGCCTGG
ATTGCCCATCAACCCCAACCACGAAATCCACATCAAGGACTTGCACGGATCTCCCCCAACCTCTGCCGATGCAGG
CCAGTGGCTCAACAACAATGGCGGAGGCGCCCACATTGGCAAGACGCCCGACTATGCAAAGTCTGGCAACTTTTC
CATCACCAGGTGGCCCTGTGGCAAATACTGTCTTAGTGGAATTCAAAGGGGTCTTGGCGTGGCCTGCCCGTCCGA
GGATCCTTCCATCACCTTTTACGGCAGCGCCACAGAGGCCTGTATTGAGTATGATTTGCTCGAGGTGCCTTGTAA
GATTAGAGACAAGAGAAATAACTGCATCTGGAAGAATGGAAAGAACCAATGCTGCAGCAAGACGGACTGCTCCGA
CACCACGCCTGACCACAATCCCGATGACAAGCCCGGCGACAAGCCAGATCCCACTGGCAGCACGCCTCACGTCCC
CGAGGAGACCAAGTCGCCCATGGAGAAGCTTTGCCCGTCCCAGCACGACACGACGATTGAGGCCTTTGGCATCGG
CTTCCGCATCCTCTGCGGCTGGCAATTTGGGCCTGGCGAAAAGGTAGACACTGAGAAGAACGTGCTCGACCCTCT
GTCTTGCCATGCCAAGTGCGCCAAGGATAAGAAGTGCCAGGGAGCCAACTGGGACATGGTCAACCTGGGCTGCTC
CTGCAGCAGGGACTGGGAGGCTGCCATTGTCGAAGGCAACTTTAGCTACGTTACTTTCCACCCTACGTTTGTCCG
GCCACGCGATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail