Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8140
Gene name
LocationContig_98:65172..67187
Strand+
Gene length (bp)2015
Transcript length (bp)1680
Coding sequence length (bp)1680
Protein length (aa) 560

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00270 DEAD DEAD/DEAH box helicase 1.4E-38 33 203
PF00271 Helicase_C Helicase conserved C-terminal domain 6.5E-30 244 398
PF04851 ResIII Type III restriction enzyme, res subunit 8.2E-06 43 166

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IJ56|DBP9_GIBZE ATP-dependent RNA helicase DBP9 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP9 PE=3 SV=1 5 559 0.0E+00
sp|A7EM78|DBP9_SCLS1 ATP-dependent RNA helicase dbp9 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp9 PE=3 SV=1 2 555 0.0E+00
sp|A6SNX1|DBP9_BOTFB ATP-dependent RNA helicase dbp9 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp9 PE=3 SV=2 9 555 0.0E+00
sp|A4QTR1|DBP9_MAGO7 ATP-dependent RNA helicase DBP9 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP9 PE=3 SV=1 12 559 0.0E+00
sp|Q7S6F3|DBP9_NEUCR ATP-dependent RNA helicase dbp-9 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-9 PE=3 SV=1 2 543 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IJ56|DBP9_GIBZE ATP-dependent RNA helicase DBP9 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP9 PE=3 SV=1 5 559 0.0E+00
sp|A7EM78|DBP9_SCLS1 ATP-dependent RNA helicase dbp9 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp9 PE=3 SV=1 2 555 0.0E+00
sp|A6SNX1|DBP9_BOTFB ATP-dependent RNA helicase dbp9 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp9 PE=3 SV=2 9 555 0.0E+00
sp|A4QTR1|DBP9_MAGO7 ATP-dependent RNA helicase DBP9 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP9 PE=3 SV=1 12 559 0.0E+00
sp|Q7S6F3|DBP9_NEUCR ATP-dependent RNA helicase dbp-9 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-9 PE=3 SV=1 2 543 0.0E+00
sp|A1C7F7|DBP9_ASPCL ATP-dependent RNA helicase dbp9 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp9 PE=3 SV=1 10 543 0.0E+00
sp|Q4X0C2|DBP9_ASPFU ATP-dependent RNA helicase dbp9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp9 PE=3 SV=1 10 543 0.0E+00
sp|A1DHV3|DBP9_NEOFI ATP-dependent RNA helicase dbp9 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp9 PE=3 SV=1 10 543 0.0E+00
sp|Q1DWF4|DBP9_COCIM ATP-dependent RNA helicase DBP9 OS=Coccidioides immitis (strain RS) GN=DBP9 PE=3 SV=2 7 543 0.0E+00
sp|A6R2L6|DBP9_AJECN ATP-dependent RNA helicase DBP9 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP9 PE=3 SV=1 9 538 0.0E+00
sp|Q0CY48|DBP9_ASPTN ATP-dependent RNA helicase dbp9 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp9 PE=3 SV=2 1 543 0.0E+00
sp|Q2UFL0|DBP9_ASPOR ATP-dependent RNA helicase dbp9 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp9 PE=3 SV=1 10 543 0.0E+00
sp|A2QCW6|DBP9_ASPNC ATP-dependent RNA helicase dbp9 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp9 PE=3 SV=1 6 543 0.0E+00
sp|Q5AZA6|DBP9_EMENI ATP-dependent RNA helicase dbp9 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp9 PE=3 SV=1 1 543 0.0E+00
sp|Q6CUI6|DBP9_KLULA ATP-dependent RNA helicase DBP9 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP9 PE=3 SV=1 5 535 0.0E+00
sp|Q0UZ59|DBP9_PHANO ATP-dependent RNA helicase DBP9 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP9 PE=3 SV=1 8 555 2.0E-180
sp|Q6FUA6|DBP9_CANGA ATP-dependent RNA helicase DBP9 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP9 PE=3 SV=1 5 534 6.0E-177
sp|O60080|DBP9_SCHPO ATP-dependent RNA helicase dbp9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp9 PE=3 SV=1 6 556 5.0E-175
sp|Q5A4P9|DBP9_CANAL ATP-dependent RNA helicase DBP9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP9 PE=3 SV=1 5 535 1.0E-174
sp|Q06218|DBP9_YEAST ATP-dependent RNA helicase DBP9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP9 PE=1 SV=1 5 534 7.0E-174
sp|A7A1G0|DBP9_YEAS7 ATP-dependent RNA helicase DBP9 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP9 PE=3 SV=1 5 534 7.0E-174
sp|Q6BLM5|DBP9_DEBHA ATP-dependent RNA helicase DBP9 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP9 PE=3 SV=1 4 555 1.0E-173
sp|Q74ZC1|DBP9_ASHGO ATP-dependent RNA helicase DBP9 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP9 PE=3 SV=1 2 553 2.0E-172
sp|A5E572|DBP9_LODEL ATP-dependent RNA helicase DBP9 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP9 PE=3 SV=1 5 534 3.0E-171
sp|A5DC85|DBP9_PICGU ATP-dependent RNA helicase DBP9 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP9 PE=3 SV=2 2 535 9.0E-171
sp|A3LV40|DBP9_PICST ATP-dependent RNA helicase DBP9 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP9 PE=3 SV=1 4 556 9.0E-171
sp|A7TPC9|DBP9_VANPO ATP-dependent RNA helicase DBP9 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP9 PE=3 SV=2 5 543 2.0E-169
sp|Q6BZR4|DBP9_YARLI ATP-dependent RNA helicase DBP9 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP9 PE=3 SV=1 7 536 3.0E-164
sp|Q4P7M1|DBP9_USTMA ATP-dependent RNA helicase DBP9 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP9 PE=3 SV=1 15 531 2.0E-144
sp|P0CR10|DBP9_CRYNJ ATP-dependent RNA helicase DBP9 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP9 PE=3 SV=1 6 531 6.0E-141
sp|P0CR11|DBP9_CRYNB ATP-dependent RNA helicase DBP9 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP9 PE=3 SV=1 6 531 6.0E-141
sp|Q9D0R4|DDX56_MOUSE Probable ATP-dependent RNA helicase DDX56 OS=Mus musculus GN=Ddx56 PE=2 SV=1 10 549 4.0E-132
sp|Q9NY93|DDX56_HUMAN Probable ATP-dependent RNA helicase DDX56 OS=Homo sapiens GN=DDX56 PE=1 SV=1 1 553 4.0E-131
sp|Q3SZ40|DDX56_BOVIN Probable ATP-dependent RNA helicase DDX56 OS=Bos taurus GN=DDX56 PE=2 SV=1 1 534 1.0E-128
sp|Q9SW44|RH16_ARATH DEAD-box ATP-dependent RNA helicase 16 OS=Arabidopsis thaliana GN=RH16 PE=2 SV=1 9 529 7.0E-114
sp|Q6ATJ8|RH16_ORYSJ DEAD-box ATP-dependent RNA helicase 16 OS=Oryza sativa subsp. japonica GN=Os03g0728800 PE=2 SV=1 9 554 4.0E-109
sp|Q54VF1|DDX56_DICDI Probable ATP-dependent RNA helicase ddx56 OS=Dictyostelium discoideum GN=ddx56 PE=3 SV=1 7 315 2.0E-76
sp|Q0INC5|RH28_ORYSJ DEAD-box ATP-dependent RNA helicase 28 OS=Oryza sativa subsp. japonica GN=Os12g0481100 PE=2 SV=2 9 408 2.0E-53
sp|P0CQ92|DRS1_CRYNJ ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DRS1 PE=3 SV=1 8 439 4.0E-53
sp|P0CQ93|DRS1_CRYNB ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DRS1 PE=3 SV=1 8 439 4.0E-53
sp|Q0V1Z7|DRS1_PHANO ATP-dependent RNA helicase DRS1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DRS1 PE=3 SV=1 8 415 2.0E-50
sp|Q54TJ4|DDX27_DICDI Probable ATP-dependent RNA helicase ddx27 OS=Dictyostelium discoideum GN=ddx27 PE=3 SV=1 9 499 9.0E-50
sp|Q9ZRZ8|RH28_ARATH DEAD-box ATP-dependent RNA helicase 28 OS=Arabidopsis thaliana GN=RH28 PE=2 SV=1 9 408 9.0E-50
sp|Q2UNB7|RRP3_ASPOR ATP-dependent rRNA helicase rrp3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rrp3 PE=3 SV=1 9 406 2.0E-49
sp|A4QYM6|DRS1_MAGO7 ATP-dependent RNA helicase DRS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DRS1 PE=3 SV=1 8 540 5.0E-48
sp|P44701|SRMB_HAEIN ATP-dependent RNA helicase SrmB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=srmB PE=3 SV=1 6 436 5.0E-48
sp|P57453|DEAD_BUCAI ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=deaD PE=3 SV=1 7 407 6.0E-48
sp|Q8XA87|DEAD_ECO57 ATP-dependent RNA helicase DeaD OS=Escherichia coli O157:H7 GN=deaD PE=3 SV=3 4 407 1.0E-47
sp|P0A9P8|DEAD_SHIFL ATP-dependent RNA helicase DeaD OS=Shigella flexneri GN=deaD PE=3 SV=2 4 407 1.0E-47
sp|P0A9P6|DEAD_ECOLI ATP-dependent RNA helicase DeaD OS=Escherichia coli (strain K12) GN=deaD PE=1 SV=2 4 407 1.0E-47
sp|P0A9P7|DEAD_ECOL6 ATP-dependent RNA helicase DeaD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=deaD PE=3 SV=2 4 407 1.0E-47
sp|A1CNV8|DRS1_ASPCL ATP-dependent RNA helicase drs1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=drs1 PE=3 SV=1 2 408 1.0E-47
sp|P33906|DEAD_KLEPN ATP-dependent RNA helicase DeaD OS=Klebsiella pneumoniae GN=deaD PE=3 SV=3 4 407 1.0E-47
sp|Q4WRV2|DRS1_ASPFU ATP-dependent RNA helicase drs1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=drs1 PE=3 SV=1 9 408 1.0E-47
sp|A1D1R8|DRS1_NEOFI ATP-dependent RNA helicase drs1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=drs1 PE=3 SV=1 9 406 2.0E-47
sp|Q8K9H6|DEAD_BUCAP ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=deaD PE=3 SV=1 7 407 2.0E-47
sp|Q09903|DRS1_SCHPO ATP-dependent RNA helicase drs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=drs1 PE=3 SV=1 8 498 4.0E-47
sp|Q8Y8N0|CSHA_LISMO ATP-dependent RNA helicase CshA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cshA PE=2 SV=1 10 412 5.0E-47
sp|Q2UQI6|DRS1_ASPOR ATP-dependent RNA helicase drs1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=drs1 PE=3 SV=2 9 406 5.0E-47
sp|Q5L3G9|CSHA_GEOKA DEAD-box ATP-dependent RNA helicase CshA OS=Geobacillus kaustophilus (strain HTA426) GN=cshA PE=3 SV=1 9 437 7.0E-47
sp|Q4IFI0|RRP3_GIBZE ATP-dependent rRNA helicase RRP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RRP3 PE=3 SV=1 9 467 7.0E-47
sp|Q0UK12|RRP3_PHANO ATP-dependent rRNA helicase RRP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RRP3 PE=3 SV=2 9 408 8.0E-47
sp|Q5B5E7|RRP3_EMENI ATP-dependent rRNA helicase rrp3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rrp3 PE=3 SV=1 9 470 9.0E-47
sp|Q0CZN5|DRS1_ASPTN ATP-dependent RNA helicase drs1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=drs1 PE=3 SV=1 9 406 9.0E-47
sp|Q1E2B2|DRS1_COCIM ATP-dependent RNA helicase DRS1 OS=Coccidioides immitis (strain RS) GN=DRS1 PE=3 SV=1 2 408 1.0E-46
sp|Q9H0S4|DDX47_HUMAN Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens GN=DDX47 PE=1 SV=1 5 407 1.0E-46
sp|A2RB17|RRP3_ASPNC ATP-dependent rRNA helicase rrp3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rrp3 PE=3 SV=1 9 407 1.0E-46
sp|Q4WJE9|RRP3_ASPFU ATP-dependent rRNA helicase rrp3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rrp3 PE=3 SV=1 9 467 2.0E-46
sp|Q4I830|DRS1_GIBZE ATP-dependent RNA helicase DRS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DRS1 PE=3 SV=1 8 459 4.0E-46
sp|A1D405|RRP3_NEOFI ATP-dependent rRNA helicase rrp3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rrp3 PE=3 SV=1 9 467 4.0E-46
sp|Q9CWX9|DDX47_MOUSE Probable ATP-dependent RNA helicase DDX47 OS=Mus musculus GN=Ddx47 PE=2 SV=2 5 407 5.0E-46
sp|Q29S22|DDX47_BOVIN Probable ATP-dependent RNA helicase DDX47 OS=Bos taurus GN=DDX47 PE=2 SV=1 5 407 6.0E-46
sp|Q1E1N5|RRP3_COCIM ATP-dependent rRNA helicase RRP3 OS=Coccidioides immitis (strain RS) GN=RRP3 PE=3 SV=1 4 472 9.0E-46
sp|Q8GY84|RH10_ARATH DEAD-box ATP-dependent RNA helicase 10 OS=Arabidopsis thaliana GN=RH10 PE=2 SV=2 5 407 1.0E-45
sp|A2QAX7|DRS1_ASPNC ATP-dependent RNA helicase drs1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=drs1 PE=3 SV=1 4 406 1.0E-45
sp|Q6FW42|DRS1_CANGA ATP-dependent RNA helicase DRS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DRS1 PE=3 SV=1 2 407 2.0E-45
sp|A1A4H6|DDX27_BOVIN Probable ATP-dependent RNA helicase DDX27 OS=Bos taurus GN=DDX27 PE=2 SV=1 9 407 3.0E-45
sp|A1CR32|RRP3_ASPCL ATP-dependent rRNA helicase rrp3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rrp3 PE=3 SV=1 9 467 4.0E-45
sp|A6QRQ7|RRP3_AJECN ATP-dependent rRNA helicase RRP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=RRP3 PE=3 SV=1 9 472 4.0E-45
sp|A4RGD1|RRP3_MAGO7 ATP-dependent rRNA helicase RRP3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RRP3 PE=3 SV=1 9 467 4.0E-45
sp|P44586|DEAD_HAEIN ATP-dependent RNA helicase DeaD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=deaD PE=3 SV=1 6 411 7.0E-45
sp|A7EML8|RRP3_SCLS1 ATP-dependent rRNA helicase rrp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rrp3 PE=3 SV=1 9 467 9.0E-45
sp|Q0CIQ3|RRP3_ASPTN ATP-dependent rRNA helicase rrp3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rrp3 PE=3 SV=2 9 494 1.0E-44
sp|Q5ACK7|DRS1_CANAL ATP-dependent RNA helicase DRS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DRS1 PE=3 SV=1 5 407 1.0E-44
sp|Q9Z6C9|CSHA_LACRE ATP-dependent RNA helicase CshA OS=Lactobacillus reuteri GN=cshA PE=3 SV=1 10 412 1.0E-44
sp|Q96GQ7|DDX27_HUMAN Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens GN=DDX27 PE=1 SV=2 9 407 2.0E-44
sp|Q6CJV1|DRS1_KLULA ATP-dependent RNA helicase DRS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DRS1 PE=3 SV=1 9 407 2.0E-44
sp|P0A4D8|CSHA_STRR6 DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=cshA PE=3 SV=1 10 421 3.0E-44
sp|P0A4D7|CSHA_STRPN DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=cshA PE=3 SV=1 10 421 3.0E-44
sp|A7TJM9|DRS1_VANPO ATP-dependent RNA helicase DRS1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DRS1 PE=3 SV=1 8 407 3.0E-44
sp|A5DKW3|DRS1_PICGU ATP-dependent RNA helicase DRS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DRS1 PE=3 SV=2 2 407 4.0E-44
sp|Q7Y183|RH10_ORYSJ DEAD-box ATP-dependent RNA helicase 10 OS=Oryza sativa subsp. japonica GN=Os03g0669000 PE=2 SV=1 4 420 4.0E-44
sp|Q4P3U9|RRP3_USTMA ATP-dependent rRNA helicase RRP3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RRP3 PE=3 SV=2 10 408 4.0E-44
sp|Q6CEB8|DRS1_YARLI ATP-dependent RNA helicase DRS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DRS1 PE=3 SV=1 9 407 7.0E-44
sp|Q2H1Q8|RRP3_CHAGB ATP-dependent rRNA helicase RRP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RRP3 PE=3 SV=1 2 467 8.0E-44
sp|Q8L4E9|RH36_ORYSJ DEAD-box ATP-dependent RNA helicase 36 OS=Oryza sativa subsp. japonica GN=Os07g0633500 PE=3 SV=1 8 411 8.0E-44
sp|Q75F95|DRS1_ASHGO ATP-dependent RNA helicase DRS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DRS1 PE=3 SV=1 2 407 1.0E-43
sp|P34580|DDX47_CAEEL Putative ATP-dependent RNA helicase T26G10.1 OS=Caenorhabditis elegans GN=T26G10.1 PE=3 SV=1 7 407 2.0E-43
sp|Q49Z29|CSHA_STAS1 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cshA PE=3 SV=1 10 412 4.0E-43
sp|Q4FZF3|DDX49_MOUSE Probable ATP-dependent RNA helicase DDX49 OS=Mus musculus GN=Ddx49 PE=2 SV=1 8 454 5.0E-43
sp|P42305|DBPA_BACSU ATP-dependent RNA helicase DbpA OS=Bacillus subtilis (strain 168) GN=dbpA PE=1 SV=2 10 407 5.0E-43
sp|Q73EU1|CSHA_BACC1 DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cshA PE=3 SV=1 8 411 5.0E-43
sp|P0C2N8|DRS1_NEUCR ATP-dependent RNA helicase drs1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-11 PE=3 SV=1 8 406 5.0E-43
sp|P32892|DRS1_YEAST ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS1 PE=1 SV=2 10 407 6.0E-43
sp|A7A0P8|DRS1_YEAS7 ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DRS1 PE=3 SV=1 10 407 7.0E-43
sp|A7F4L5|DRS1_SCLS1 ATP-dependent RNA helicase drs1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=drs1 PE=3 SV=1 8 408 7.0E-43
sp|P0CR00|RRP3_CRYNJ ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RRP3 PE=3 SV=1 4 455 7.0E-43
sp|P0CR01|RRP3_CRYNB ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RRP3 PE=3 SV=1 4 455 7.0E-43
sp|Q6HPE6|CSHA_BACHK DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cshA PE=3 SV=1 8 411 8.0E-43
sp|Q81VG0|CSHA_BACAN DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus anthracis GN=cshA PE=3 SV=1 8 411 8.0E-43
sp|A0R8U6|CSHA_BACAH DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis (strain Al Hakam) GN=cshA PE=3 SV=1 8 411 8.0E-43
sp|Q8CRP6|CSHA_STAES DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cshA PE=3 SV=1 10 412 8.0E-43
sp|A6RW56|RRP3_BOTFB ATP-dependent rRNA helicase rrp3 OS=Botryotinia fuckeliana (strain B05.10) GN=rrp3 PE=3 SV=1 9 407 9.0E-43
sp|Q63GX5|CSHA_BACCZ DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ZK / E33L) GN=cshA PE=3 SV=1 8 411 9.0E-43
sp|Q9Y6V7|DDX49_HUMAN Probable ATP-dependent RNA helicase DDX49 OS=Homo sapiens GN=DDX49 PE=1 SV=1 8 416 1.0E-42
sp|A3LSN3|DRS1_PICST ATP-dependent RNA helicase DRS1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DRS1 PE=3 SV=3 8 407 1.0E-42
sp|Q81IT9|CSHA_BACCR DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshA PE=2 SV=2 8 411 1.0E-42
sp|Q5HME0|CSHA_STAEQ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cshA PE=3 SV=1 10 412 2.0E-42
sp|A5DY34|DRS1_LODEL ATP-dependent RNA helicase DRS1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DRS1 PE=3 SV=1 9 407 2.0E-42
sp|Q7RY59|RRP3_NEUCR ATP-dependent rRNA helicase rrp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rrp-3 PE=3 SV=1 9 467 2.0E-42
sp|A6RUH2|DRS1_BOTFB ATP-dependent RNA helicase drs1 OS=Botryotinia fuckeliana (strain B05.10) GN=drs1 PE=3 SV=1 9 406 2.0E-42
sp|Q6CH58|RRP3_YARLI ATP-dependent rRNA helicase RRP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RRP3 PE=3 SV=1 2 471 2.0E-42
sp|B9XXL6|RHPA_HELP8 DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain B128) GN=rhpA PE=1 SV=1 2 414 2.0E-42
sp|O25029|RHPA_HELPY DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rhpA PE=1 SV=1 3 414 3.0E-42
sp|Q814I2|DBPA_BACCR ATP-dependent RNA helicase DbpA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dbpA PE=2 SV=1 9 409 3.0E-42
sp|Q9P6N8|RRP3_SCHPO ATP-dependent rRNA helicase rrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp3 PE=3 SV=1 2 472 3.0E-42
sp|Q921N6|DDX27_MOUSE Probable ATP-dependent RNA helicase DDX27 OS=Mus musculus GN=Ddx27 PE=1 SV=3 9 407 4.0E-42
sp|Q75EW9|RRP3_ASHGO ATP-dependent rRNA helicase RRP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RRP3 PE=3 SV=2 2 407 6.0E-42
sp|Q4L7W0|CSHA_STAHJ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cshA PE=3 SV=1 10 412 7.0E-42
sp|Q6BTL5|DRS1_DEBHA ATP-dependent RNA helicase DRS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DRS1 PE=3 SV=1 8 498 8.0E-42
sp|C4K8M8|RHLB_HAMD5 ATP-dependent RNA helicase RhlB OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rhlB PE=3 SV=1 10 431 8.0E-42
sp|Q6GEZ3|CSHA_STAAR DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MRSA252) GN=cshA PE=3 SV=1 10 412 8.0E-42
sp|Q6BRE4|DBP5_DEBHA ATP-dependent RNA helicase DBP5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP5 PE=3 SV=1 9 436 8.0E-42
sp|Q7A0D2|CSHA_STAAW DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MW2) GN=cshA PE=3 SV=1 10 412 9.0E-42
sp|Q6G7M9|CSHA_STAAS DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MSSA476) GN=cshA PE=3 SV=1 10 412 9.0E-42
sp|Q7A4G0|CSHA_STAAN DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain N315) GN=cshA PE=1 SV=1 10 412 9.0E-42
sp|Q99SH6|CSHA_STAAM DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cshA PE=3 SV=1 10 412 9.0E-42
sp|Q5HEB9|CSHA_STAAC DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain COL) GN=cshA PE=3 SV=1 10 412 9.0E-42
sp|Q2FWH5|CSHA_STAA8 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain NCTC 8325) GN=cshA PE=1 SV=1 10 412 9.0E-42
sp|Q2FF45|CSHA_STAA3 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain USA300) GN=cshA PE=3 SV=1 10 412 9.0E-42
sp|A6ZSX1|RRP3_YEAS7 ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=RRP3 PE=3 SV=1 5 407 1.0E-41
sp|Q2YUH3|CSHA_STAAB DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cshA PE=3 SV=1 10 412 2.0E-41
sp|P38712|RRP3_YEAST ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP3 PE=1 SV=2 5 407 2.0E-41
sp|P25888|RHLE_ECOLI ATP-dependent RNA helicase RhlE OS=Escherichia coli (strain K12) GN=rhlE PE=1 SV=3 9 407 2.0E-41
sp|Q6FNK8|RRP3_CANGA ATP-dependent rRNA helicase RRP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RRP3 PE=3 SV=1 9 407 2.0E-41
sp|Q9M2E0|RH12_ARATH DEAD-box ATP-dependent RNA helicase 12 OS=Arabidopsis thaliana GN=RH12 PE=2 SV=1 10 416 3.0E-41
sp|Q4P9P3|DRS1_USTMA ATP-dependent RNA helicase DRS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DRS1 PE=3 SV=1 7 407 3.0E-41
sp|Q54E49|DDX6_DICDI Probable ATP-dependent RNA helicase ddx6 OS=Dictyostelium discoideum GN=ddx6 PE=3 SV=1 10 407 4.0E-41
sp|Q54IV3|DDX42_DICDI Probable ATP-dependent RNA helicase ddx42 OS=Dictyostelium discoideum GN=ddx42 PE=3 SV=1 8 413 4.0E-41
sp|Q89AF9|DEAD_BUCBP ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=deaD PE=3 SV=1 9 407 5.0E-41
sp|A3LS22|RRP3_PICST ATP-dependent rRNA helicase RRP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RRP3 PE=3 SV=3 8 408 5.0E-41
sp|Q756G5|DBP8_ASHGO ATP-dependent RNA helicase DBP8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP8 PE=3 SV=1 4 414 7.0E-41
sp|Q8SR63|RRP3_ENCCU ATP-dependent rRNA helicase RRP3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RRP3 PE=3 SV=1 10 407 7.0E-41
sp|Q8RXK6|RH8_ARATH DEAD-box ATP-dependent RNA helicase 8 OS=Arabidopsis thaliana GN=RH8 PE=2 SV=1 10 407 7.0E-41
sp|P9WH05|DEAD_MYCTU ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=deaD PE=1 SV=1 4 413 1.0E-40
sp|P9WH04|DEAD_MYCTO ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=deaD PE=3 SV=1 4 413 1.0E-40
sp|Q65N62|CSHA_BACLD DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=cshA PE=3 SV=1 9 411 1.0E-40
sp|A7TK63|DBP8_VANPO ATP-dependent RNA helicase DBP8 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP8 PE=3 SV=1 10 414 2.0E-40
sp|Q84TG1|RH57_ARATH DEAD-box ATP-dependent RNA helicase 57 OS=Arabidopsis thaliana GN=RH57 PE=2 SV=1 9 406 2.0E-40
sp|Q6CXW0|DBP8_KLULA ATP-dependent RNA helicase DBP8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP8 PE=3 SV=1 1 414 2.0E-40
sp|Q9BUQ8|DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens GN=DDX23 PE=1 SV=3 9 408 4.0E-40
sp|Q09719|DBP10_SCHPO ATP-dependent RNA helicase dbp10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp10 PE=1 SV=1 8 407 5.0E-40
sp|Q8Y7M8|DBPA_LISMO ATP-dependent RNA helicase DbpA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dbpA PE=2 SV=1 12 407 6.0E-40
sp|A5DQF1|RRP3_PICGU ATP-dependent rRNA helicase RRP3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RRP3 PE=3 SV=2 3 408 6.0E-40
sp|A7TS37|RRP3_VANPO ATP-dependent rRNA helicase RRP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RRP3 PE=3 SV=1 9 407 7.0E-40
sp|Q54CD8|DDX54_DICDI ATP-dependent RNA helicase ddx54 OS=Dictyostelium discoideum GN=helA PE=3 SV=1 10 412 9.0E-40
sp|Q6CT85|RRP3_KLULA ATP-dependent rRNA helicase RRP3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RRP3 PE=3 SV=1 12 407 9.0E-40
sp|Q94BV4|RH6_ARATH DEAD-box ATP-dependent RNA helicase 6 OS=Arabidopsis thaliana GN=RH6 PE=2 SV=2 10 416 1.0E-39
sp|P96614|CSHA_BACSU DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus subtilis (strain 168) GN=cshA PE=1 SV=2 9 411 2.0E-39
sp|Q5ACU6|RRP3_CANAL ATP-dependent rRNA helicase RRP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RRP3 PE=3 SV=2 9 407 2.0E-39
sp|Q5RC67|DDX23_PONAB Probable ATP-dependent RNA helicase DDX23 OS=Pongo abelii GN=DDX23 PE=2 SV=1 9 408 3.0E-39
sp|A7TGU7|DHH1_VANPO ATP-dependent RNA helicase DHH1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DHH1 PE=3 SV=1 9 407 4.0E-39
sp|Q6C4D4|DBP2_YARLI ATP-dependent RNA helicase DBP2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP2 PE=3 SV=1 8 406 5.0E-39
sp|Q9HGM5|DBP8_SCHPO ATP-dependent RNA helicase dbp8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp8 PE=3 SV=1 9 416 5.0E-39
sp|A1SZG4|RHLB_PSYIN ATP-dependent RNA helicase RhlB OS=Psychromonas ingrahamii (strain 37) GN=rhlB PE=3 SV=1 6 431 5.0E-39
sp|Q1E5R1|DHH1_COCIM ATP-dependent RNA helicase DHH1 OS=Coccidioides immitis (strain RS) GN=DHH1 PE=3 SV=1 10 407 5.0E-39
sp|Q6H7S2|RH8_ORYSJ DEAD-box ATP-dependent RNA helicase 8 OS=Oryza sativa subsp. japonica GN=Os02g0641800 PE=2 SV=2 10 407 5.0E-39
sp|P93008|RH21_ARATH DEAD-box ATP-dependent RNA helicase 21 OS=Arabidopsis thaliana GN=RH21 PE=2 SV=1 9 408 5.0E-39
sp|Q54VT4|DDX47_DICDI Probable ATP-dependent RNA helicase ddx47 OS=Dictyostelium discoideum GN=ddx47 PE=3 SV=1 9 407 6.0E-39
sp|Q54QS3|DDX3_DICDI Probable ATP-dependent RNA helicase ddx3 OS=Dictyostelium discoideum GN=ddx3 PE=3 SV=1 9 407 7.0E-39
sp|A5DPU0|MAK5_PICGU ATP-dependent RNA helicase MAK5 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MAK5 PE=3 SV=1 9 411 7.0E-39
sp|Q81DF9|CSHE_BACCR DEAD-box ATP-dependent RNA helicase CshE OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshE PE=2 SV=1 10 410 7.0E-39
sp|Q0U8V9|DBP8_PHANO ATP-dependent RNA helicase DBP8 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP8 PE=3 SV=1 2 407 7.0E-39
sp|Q4WIN6|DBP5_ASPFU ATP-dependent RNA helicase dbp5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp5 PE=3 SV=2 10 407 8.0E-39
sp|Q6BQ61|RRP3_DEBHA ATP-dependent rRNA helicase RRP3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RRP3 PE=3 SV=2 9 408 1.0E-38
sp|Q6BV58|MAK5_DEBHA ATP-dependent RNA helicase MAK5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MAK5 PE=3 SV=1 2 411 1.0E-38
sp|Q5QYF8|RHLB_IDILO ATP-dependent RNA helicase RhlB OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rhlB PE=3 SV=1 6 413 1.0E-38
sp|A6SFV4|DBP8_BOTFB ATP-dependent RNA helicase dbp8 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp8 PE=3 SV=1 7 407 1.0E-38
sp|Q9SA27|RH36_ARATH DEAD-box ATP-dependent RNA helicase 36 OS=Arabidopsis thaliana GN=RH36 PE=2 SV=1 10 407 1.0E-38
sp|A1CKJ0|DBP8_ASPCL ATP-dependent RNA helicase dbp8 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp8 PE=3 SV=1 5 407 1.0E-38
sp|Q6FQU5|DHH1_CANGA ATP-dependent RNA helicase DHH1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DHH1 PE=3 SV=1 9 407 2.0E-38
sp|P39517|DHH1_YEAST ATP-dependent RNA helicase DHH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DHH1 PE=1 SV=1 9 407 2.0E-38
sp|A6ZXG9|DHH1_YEAS7 ATP-dependent RNA helicase DHH1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DHH1 PE=3 SV=1 9 407 2.0E-38
sp|A6RY31|DHH1_BOTFB ATP-dependent RNA helicase dhh1 OS=Botryotinia fuckeliana (strain B05.10) GN=dhh1 PE=3 SV=1 10 407 2.0E-38
sp|Q55804|CRHR_SYNY3 RNA helicase CrhR OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=crhR PE=1 SV=1 8 409 2.0E-38
sp|Q7XMK8|RH6_ORYSJ DEAD-box ATP-dependent RNA helicase 6 OS=Oryza sativa subsp. japonica GN=Os04g0533000 PE=2 SV=1 10 407 3.0E-38
sp|A1CYG5|DBP5_NEOFI ATP-dependent RNA helicase dbp5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp5 PE=3 SV=1 10 407 3.0E-38
sp|Q8K4L0|DDX54_MOUSE ATP-dependent RNA helicase DDX54 OS=Mus musculus GN=Ddx54 PE=1 SV=1 10 412 3.0E-38
sp|Q9FNM7|RH26_ARATH DEAD-box ATP-dependent RNA helicase 26 OS=Arabidopsis thaliana GN=RH26 PE=1 SV=2 10 413 3.0E-38
sp|P38719|DBP8_YEAST ATP-dependent RNA helicase DBP8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP8 PE=1 SV=1 8 414 4.0E-38
sp|A6ZT77|DBP8_YEAS7 ATP-dependent RNA helicase DBP8 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP8 PE=3 SV=1 8 414 4.0E-38
sp|Q54Y81|DDX23_DICDI ATP-dependent RNA helicase ddx23 OS=Dictyostelium discoideum GN=helB2 PE=2 SV=1 9 412 4.0E-38
sp|C6DHF5|RHLB_PECCP ATP-dependent RNA helicase RhlB OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rhlB PE=3 SV=1 7 406 4.0E-38
sp|O74393|MAK5_SCHPO ATP-dependent RNA helicase mak5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak5 PE=1 SV=1 8 412 4.0E-38
sp|A1D8G1|DHH1_NEOFI ATP-dependent RNA helicase dhh1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dhh1 PE=3 SV=1 10 407 4.0E-38
sp|Q2U5A2|DHH1_ASPOR ATP-dependent RNA helicase dhh1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dhh1 PE=3 SV=1 10 407 5.0E-38
sp|Q4WWD3|DHH1_ASPFU ATP-dependent RNA helicase dhh1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dhh1 PE=3 SV=1 10 407 5.0E-38
sp|A1CJ18|DHH1_ASPCL ATP-dependent RNA helicase dhh1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dhh1 PE=3 SV=1 10 407 5.0E-38
sp|C4LB49|RHLB_TOLAT ATP-dependent RNA helicase RhlB OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rhlB PE=3 SV=1 6 406 6.0E-38
sp|Q0CBE1|DHH1_ASPTN ATP-dependent RNA helicase dhh1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dhh1 PE=3 SV=1 10 407 6.0E-38
sp|Q109G2|RH12_ORYSJ DEAD-box ATP-dependent RNA helicase 12 OS=Oryza sativa subsp. japonica GN=Os10g0503700 PE=2 SV=2 10 407 7.0E-38
sp|Q1E0Z3|DBP8_COCIM ATP-dependent RNA helicase DBP8 OS=Coccidioides immitis (strain RS) GN=DBP8 PE=3 SV=1 7 407 8.0E-38
sp|A4R715|DHH1_MAGO7 ATP-dependent RNA helicase DHH1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DHH1 PE=3 SV=2 10 407 8.0E-38
sp|A2QY39|DHH1_ASPNC ATP-dependent RNA helicase dhh1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dhh1 PE=3 SV=1 10 407 9.0E-38
sp|Q810A7|DDX42_MOUSE ATP-dependent RNA helicase DDX42 OS=Mus musculus GN=Ddx42 PE=1 SV=3 8 410 1.0E-37
sp|Q86XP3|DDX42_HUMAN ATP-dependent RNA helicase DDX42 OS=Homo sapiens GN=DDX42 PE=1 SV=1 8 410 1.0E-37
sp|Q5R7D1|DDX42_PONAB ATP-dependent RNA helicase DDX42 OS=Pongo abelii GN=DDX42 PE=2 SV=1 8 410 1.0E-37
sp|Q0U7S9|DHH1_PHANO ATP-dependent RNA helicase DHH1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DHH1 PE=3 SV=1 10 407 1.0E-37
sp|A1D6X9|DBP8_NEOFI ATP-dependent RNA helicase dbp8 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp8 PE=3 SV=1 5 407 1.0E-37
sp|Q0CDT1|DBP5_ASPTN ATP-dependent RNA helicase dbp5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp5 PE=3 SV=1 10 407 1.0E-37
sp|Q6CZD9|RHLB_PECAS ATP-dependent RNA helicase RhlB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rhlB PE=3 SV=3 7 406 1.0E-37
sp|Q4WXW1|DBP8_ASPFU ATP-dependent RNA helicase dbp8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp8 PE=3 SV=1 5 407 1.0E-37
sp|Q75C39|DBP5_ASHGO ATP-dependent RNA helicase DBP5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP5 PE=3 SV=2 9 436 2.0E-37
sp|A1CFV3|DBP5_ASPCL ATP-dependent RNA helicase dbp5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp5 PE=3 SV=1 10 407 2.0E-37
sp|Q10MH8|RH24_ORYSJ DEAD-box ATP-dependent RNA helicase 24 OS=Oryza sativa subsp. japonica GN=Os03g0308500 PE=2 SV=1 9 412 2.0E-37
sp|Q5E8U5|RHLB_VIBF1 ATP-dependent RNA helicase RhlB OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rhlB PE=3 SV=2 6 406 2.0E-37
sp|B5FF87|RHLB_VIBFM ATP-dependent RNA helicase RhlB OS=Vibrio fischeri (strain MJ11) GN=rhlB PE=3 SV=1 6 406 2.0E-37
sp|Q6FQZ0|DBP8_CANGA ATP-dependent RNA helicase DBP8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP8 PE=3 SV=1 2 414 2.0E-37
sp|A2QWW0|MAK5_ASPNC ATP-dependent RNA helicase mak5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mak5 PE=3 SV=1 8 412 3.0E-37
sp|P19109|DDX17_DROME ATP-dependent RNA helicase p62 OS=Drosophila melanogaster GN=Rm62 PE=1 SV=3 10 408 3.0E-37
sp|A3GG51|MAK5_PICST ATP-dependent RNA helicase MAK5 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MAK5 PE=3 SV=2 11 411 3.0E-37
sp|Q75BS4|DHH1_ASHGO ATP-dependent RNA helicase DHH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DHH1 PE=3 SV=1 9 407 3.0E-37
sp|P21507|SRMB_ECOLI ATP-dependent RNA helicase SrmB OS=Escherichia coli (strain K12) GN=srmB PE=1 SV=1 22 407 3.0E-37
sp|A5AA68|DBP8_ASPNC ATP-dependent RNA helicase dbp8 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp8 PE=3 SV=1 1 407 3.0E-37
sp|O22907|RH24_ARATH DEAD-box ATP-dependent RNA helicase 24 OS=Arabidopsis thaliana GN=RH24 PE=1 SV=2 9 411 3.0E-37
sp|Q5AVM1|DBP5_EMENI ATP-dependent RNA helicase dbp5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp5 PE=3 SV=1 10 407 3.0E-37
sp|A5DIP0|DHH1_PICGU ATP-dependent RNA helicase DHH1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DHH1 PE=3 SV=1 9 407 3.0E-37
sp|Q09181|DHH1_SCHPO Putative ATP-dependent RNA helicase ste13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ste13 PE=3 SV=1 10 407 4.0E-37
sp|P27639|IF4A_CAEEL Eukaryotic initiation factor 4A OS=Caenorhabditis elegans GN=inf-1 PE=2 SV=1 9 407 4.0E-37
sp|A3LWX3|DHH1_PICST ATP-dependent RNA helicase DHH1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DHH1 PE=3 SV=1 9 407 4.0E-37
sp|A7E436|DBP8_SCLS1 ATP-dependent RNA helicase dbp8 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp8 PE=3 SV=1 7 421 4.0E-37
sp|Q95YF3|CGH1_CAEEL ATP-dependent RNA helicase cgh-1 OS=Caenorhabditis elegans GN=cgh-1 PE=1 SV=1 10 407 5.0E-37
sp|Q5B3H7|DBP8_EMENI ATP-dependent RNA helicase dbp8 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp8 PE=3 SV=1 3 407 5.0E-37
sp|Q84UQ1|RH42_ORYSJ DEAD-box ATP-dependent RNA helicase 42 OS=Oryza sativa subsp. japonica GN=Os08g0159900 PE=2 SV=1 9 407 5.0E-37
sp|Q4P5U4|DBP4_USTMA ATP-dependent RNA helicase DBP4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP4 PE=3 SV=2 10 411 5.0E-37
sp|P54824|DDX6_XENLA ATP-dependent RNA helicase ddx6 OS=Xenopus laevis GN=ddx6 PE=1 SV=2 10 407 6.0E-37
sp|A3GH91|DBP5_PICST ATP-dependent RNA helicase DBP5 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP5 PE=3 SV=2 9 436 6.0E-37
sp|Q5K5B6|RH57_ORYSJ DEAD-box ATP-dependent RNA helicase 57 OS=Oryza sativa subsp. japonica GN=Os07g0647900 PE=2 SV=2 14 406 7.0E-37
sp|B4F1V3|RHLB_PROMH ATP-dependent RNA helicase RhlB OS=Proteus mirabilis (strain HI4320) GN=rhlB PE=3 SV=1 7 406 8.0E-37
sp|Q5F485|DDX42_CHICK ATP-dependent RNA helicase DDX42 OS=Gallus gallus GN=DDX42 PE=2 SV=1 8 410 8.0E-37
sp|A4REU9|MAK5_MAGO7 ATP-dependent RNA helicase MAK5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MAK5 PE=3 SV=2 13 412 8.0E-37
sp|Q0ILZ4|RH9_ORYSJ DEAD-box ATP-dependent RNA helicase 9 OS=Oryza sativa subsp. japonica GN=Os12g0611200 PE=2 SV=1 11 404 9.0E-37
sp|Q4HW67|DHH1_GIBZE ATP-dependent RNA helicase DHH1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DHH1 PE=3 SV=1 10 407 9.0E-37
sp|Q94C75|RH25_ARATH DEAD-box ATP-dependent RNA helicase 25 OS=Arabidopsis thaliana GN=RH25 PE=2 SV=2 10 413 1.0E-36
sp|Q9Y7C4|ROK1_CANAL ATP-dependent RNA helicase CHR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHR1 PE=3 SV=1 8 406 1.0E-36
sp|Q5ZBH5|RH25_ORYSJ DEAD-box ATP-dependent RNA helicase 25 OS=Oryza sativa subsp. japonica GN=Os01g0618400 PE=2 SV=1 6 413 1.0E-36
sp|Q6BP45|ROK1_DEBHA ATP-dependent RNA helicase ROK1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ROK1 PE=3 SV=2 8 406 1.0E-36
sp|P20449|DBP5_YEAST ATP-dependent RNA helicase DBP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP5 PE=1 SV=2 9 436 1.0E-36
sp|A6ZNQ1|DBP5_YEAS7 ATP-dependent RNA helicase DBP5 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP5 PE=3 SV=1 9 436 1.0E-36
sp|Q5ZKB9|DDX6_CHICK Probable ATP-dependent RNA helicase DDX6 OS=Gallus gallus GN=DDX6 PE=2 SV=1 10 407 1.0E-36
sp|Q6CDS6|ROK1_YARLI ATP-dependent RNA helicase ROK1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ROK1 PE=3 SV=1 8 406 1.0E-36
sp|A4QSS5|DBP2_MAGO7 ATP-dependent RNA helicase DBP2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP2 PE=3 SV=1 9 406 2.0E-36
sp|Q6BJX6|DHH1_DEBHA ATP-dependent RNA helicase DHH1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DHH1 PE=3 SV=2 9 407 2.0E-36
sp|B6EPA4|RHLB_ALISL ATP-dependent RNA helicase RhlB OS=Aliivibrio salmonicida (strain LFI1238) GN=rhlB PE=3 SV=1 6 406 2.0E-36
sp|A3GHW9|ROK1_PICST ATP-dependent RNA helicase ROK1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ROK1 PE=3 SV=1 15 406 2.0E-36
sp|P26196|DDX6_HUMAN Probable ATP-dependent RNA helicase DDX6 OS=Homo sapiens GN=DDX6 PE=1 SV=2 10 407 2.0E-36
sp|Q5B0J9|DBP2_EMENI ATP-dependent RNA helicase dbp2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp2 PE=3 SV=1 9 406 2.0E-36
sp|A3GGE9|DBP4_PICST ATP-dependent RNA helicase DBP4 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP4 PE=3 SV=2 8 411 2.0E-36
sp|Q0IHV9|DDX6_XENTR Probable ATP-dependent RNA helicase ddx6 OS=Xenopus tropicalis GN=ddx6 PE=2 SV=1 10 407 2.0E-36
sp|Q9WTM2|DDX6_CAVPO Probable ATP-dependent RNA helicase DDX6 (Fragment) OS=Cavia porcellus GN=DDX6 PE=2 SV=1 10 407 2.0E-36
sp|A5DE68|FAL1_PICGU ATP-dependent RNA helicase FAL1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=FAL1 PE=3 SV=2 9 410 2.0E-36
sp|Q5AF95|DBP4_CANAL ATP-dependent RNA helicase DBP4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP4 PE=3 SV=1 8 411 3.0E-36
sp|Q6C799|DBP8_YARLI ATP-dependent RNA helicase DBP8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP8 PE=3 SV=1 9 414 3.0E-36
sp|P54823|DDX6_MOUSE Probable ATP-dependent RNA helicase DDX6 OS=Mus musculus GN=Ddx6 PE=1 SV=1 10 407 3.0E-36
sp|Q4I662|DBP8_GIBZE ATP-dependent RNA helicase DBP8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP8 PE=3 SV=1 9 407 3.0E-36
sp|Q2UKX3|DBP8_ASPOR ATP-dependent RNA helicase dbp8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp8 PE=3 SV=1 13 407 4.0E-36
sp|Q2GQ93|DHH1_CHAGB ATP-dependent RNA helicase DHH1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DHH1 PE=3 SV=1 10 407 5.0E-36
sp|A6VKC3|RHLB_ACTSZ ATP-dependent RNA helicase RhlB OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rhlB PE=3 SV=1 10 406 5.0E-36
sp|A2QUY7|DBP5_ASPNC ATP-dependent RNA helicase dbp5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp5 PE=3 SV=1 10 407 6.0E-36
sp|Q6FKN8|DBP5_CANGA ATP-dependent RNA helicase DBP5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP5 PE=3 SV=1 9 414 6.0E-36
sp|Q6LLL5|RHLB_PHOPR ATP-dependent RNA helicase RhlB OS=Photobacterium profundum GN=rhlB PE=3 SV=1 7 406 7.0E-36
sp|A3LP87|DBP8_PICST ATP-dependent RNA helicase DBP8 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP8 PE=3 SV=2 9 414 7.0E-36
sp|Q6K7R9|RH48_ORYSJ DEAD-box ATP-dependent RNA helicase 48 OS=Oryza sativa subsp. japonica GN=Os02g0826100 PE=2 SV=1 10 413 7.0E-36
sp|Q7ZY47|DDX42_XENLA ATP-dependent RNA helicase DDX42 OS=Xenopus laevis GN=ddx42 PE=2 SV=1 8 411 7.0E-36
sp|A9MJ29|RHLB_SALAR ATP-dependent RNA helicase RhlB OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rhlB PE=3 SV=1 6 406 7.0E-36
sp|A5DZX2|DBP5_LODEL ATP-dependent RNA helicase DBP5 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP5 PE=3 SV=1 9 438 7.0E-36
sp|Q6CSZ7|DHH1_KLULA ATP-dependent RNA helicase DHH1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DHH1 PE=3 SV=1 9 407 8.0E-36
sp|Q59ZH9|MAK5_CANAL ATP-dependent RNA helicase MAK5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MAK5 PE=3 SV=1 27 411 8.0E-36
sp|A7MQI2|RHLB_CROS8 ATP-dependent RNA helicase RhlB OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rhlB PE=3 SV=1 6 406 8.0E-36
sp|Q088J2|RHLB_SHEFN ATP-dependent RNA helicase RhlB OS=Shewanella frigidimarina (strain NCIMB 400) GN=rhlB PE=3 SV=1 10 406 8.0E-36
sp|C3LQR1|RHLB_VIBCM ATP-dependent RNA helicase RhlB OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rhlB PE=3 SV=1 6 431 8.0E-36
sp|Q9KV52|RHLB_VIBCH ATP-dependent RNA helicase RhlB OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rhlB PE=3 SV=1 6 431 8.0E-36
sp|A5F3R4|RHLB_VIBC3 ATP-dependent RNA helicase RhlB OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rhlB PE=3 SV=1 6 431 8.0E-36
sp|Q4IF76|DBP2_GIBZE ATP-dependent RNA helicase DBP2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP2 PE=3 SV=1 9 406 9.0E-36
sp|P0A2P0|RHLB_SALTY ATP-dependent RNA helicase RhlB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rhlB PE=3 SV=2 6 406 9.0E-36
sp|P0A2P1|RHLB_SALTI ATP-dependent RNA helicase RhlB OS=Salmonella typhi GN=rhlB PE=3 SV=2 6 406 9.0E-36
sp|B4TNT3|RHLB_SALSV ATP-dependent RNA helicase RhlB OS=Salmonella schwarzengrund (strain CVM19633) GN=rhlB PE=3 SV=1 6 406 9.0E-36
sp|C0Q2V9|RHLB_SALPC ATP-dependent RNA helicase RhlB OS=Salmonella paratyphi C (strain RKS4594) GN=rhlB PE=3 SV=1 6 406 9.0E-36
sp|A9MXF3|RHLB_SALPB ATP-dependent RNA helicase RhlB OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rhlB PE=3 SV=1 6 406 9.0E-36
sp|B4SZ26|RHLB_SALNS ATP-dependent RNA helicase RhlB OS=Salmonella newport (strain SL254) GN=rhlB PE=3 SV=1 6 406 9.0E-36
sp|B4TB13|RHLB_SALHS ATP-dependent RNA helicase RhlB OS=Salmonella heidelberg (strain SL476) GN=rhlB PE=3 SV=1 6 406 9.0E-36
sp|B5RFS3|RHLB_SALG2 ATP-dependent RNA helicase RhlB OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rhlB PE=3 SV=1 6 406 9.0E-36
sp|B5QVH2|RHLB_SALEP ATP-dependent RNA helicase RhlB OS=Salmonella enteritidis PT4 (strain P125109) GN=rhlB PE=3 SV=1 6 406 9.0E-36
sp|Q57HT6|RHLB_SALCH ATP-dependent RNA helicase RhlB OS=Salmonella choleraesuis (strain SC-B67) GN=rhlB PE=3 SV=1 6 406 9.0E-36
sp|B5EZ40|RHLB_SALA4 ATP-dependent RNA helicase RhlB OS=Salmonella agona (strain SL483) GN=rhlB PE=3 SV=1 6 406 9.0E-36
sp|Q9LFN6|RH56_ARATH DEAD-box ATP-dependent RNA helicase 56 OS=Arabidopsis thaliana GN=RH56 PE=1 SV=2 6 407 1.0E-35
sp|Q56XG6|RH15_ARATH DEAD-box ATP-dependent RNA helicase 15 OS=Arabidopsis thaliana GN=RH15 PE=1 SV=3 6 407 1.0E-35
sp|Q7S5D9|DHH1_NEUCR ATP-dependent RNA helicase dhh1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-10 PE=3 SV=3 10 407 1.0E-35
sp|O49289|RH29_ARATH Putative DEAD-box ATP-dependent RNA helicase 29 OS=Arabidopsis thaliana GN=RH29 PE=3 SV=1 10 412 1.0E-35
sp|B5FN74|RHLB_SALDC ATP-dependent RNA helicase RhlB OS=Salmonella dublin (strain CT_02021853) GN=rhlB PE=3 SV=1 6 406 1.0E-35
sp|P23128|DDX6_DROME Putative ATP-dependent RNA helicase me31b OS=Drosophila melanogaster GN=me31B PE=1 SV=3 10 416 1.0E-35
sp|A5DUB2|MAK5_LODEL ATP-dependent RNA helicase MAK5 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=MAK5 PE=3 SV=1 15 411 1.0E-35
sp|Q2U8K6|DBP5_ASPOR ATP-dependent RNA helicase dbp5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp5 PE=3 SV=1 9 407 1.0E-35
sp|Q59LU0|DBP2_CANAL ATP-dependent RNA helicase DBP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP2 PE=3 SV=2 8 406 1.0E-35
sp|Q7MGP7|RHLB_VIBVY ATP-dependent RNA helicase RhlB OS=Vibrio vulnificus (strain YJ016) GN=rhlB PE=3 SV=1 6 406 1.0E-35
sp|Q7SBC6|DBP2_NEUCR ATP-dependent RNA helicase dbp2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-1 PE=3 SV=2 9 406 2.0E-35
sp|Q5N7W4|RH30_ORYSJ DEAD-box ATP-dependent RNA helicase 30 OS=Oryza sativa subsp. japonica GN=Os01g0911100 PE=2 SV=2 7 408 2.0E-35
sp|Q8DDN6|RHLB_VIBVU ATP-dependent RNA helicase RhlB OS=Vibrio vulnificus (strain CMCP6) GN=rhlB PE=3 SV=1 6 406 2.0E-35
sp|A6RC50|DBP5_AJECN ATP-dependent RNA helicase DBP5 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP5 PE=3 SV=1 9 414 2.0E-35
sp|Q0DBU5|RH31_ORYSJ DEAD-box ATP-dependent RNA helicase 31 OS=Oryza sativa subsp. japonica GN=Os06g0526600 PE=3 SV=2 6 413 2.0E-35
sp|Q6C7D2|HAS1_YARLI ATP-dependent RNA helicase HAS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HAS1 PE=3 SV=1 10 427 2.0E-35
sp|Q3BNH8|RHLB_XANC5 ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rhlB PE=3 SV=1 6 406 2.0E-35
sp|Q2H720|DBP2_CHAGB ATP-dependent RNA helicase DBP2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP2 PE=3 SV=1 9 406 2.0E-35
sp|Q5AK59|HAS1_CANAL ATP-dependent RNA helicase HAS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HAS1 PE=3 SV=1 20 427 2.0E-35
sp|Q0I1X0|RHLB_HAES1 ATP-dependent RNA helicase RhlB OS=Haemophilus somnus (strain 129Pt) GN=rhlB PE=3 SV=1 1 446 2.0E-35
sp|Q6CXB7|HAS1_KLULA ATP-dependent RNA helicase HAS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HAS1 PE=3 SV=1 3 461 2.0E-35
sp|Q8W4R3|RH30_ARATH DEAD-box ATP-dependent RNA helicase 30 OS=Arabidopsis thaliana GN=RH30 PE=2 SV=2 10 406 3.0E-35
sp|Q6BXG0|DBP4_DEBHA ATP-dependent RNA helicase DBP4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP4 PE=3 SV=2 8 411 3.0E-35
sp|A7MXT4|RHLB_VIBCB ATP-dependent RNA helicase RhlB OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rhlB PE=3 SV=1 6 431 3.0E-35
sp|P0CQ96|SUB2_CRYNJ ATP-dependent RNA helicase SUB2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SUB2 PE=3 SV=1 10 437 3.0E-35
sp|P0CQ97|SUB2_CRYNB ATP-dependent RNA helicase SUB2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SUB2 PE=3 SV=1 10 437 3.0E-35
sp|Q8PFZ3|RHLB_XANAC ATP-dependent RNA helicase RhlB OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rhlB PE=3 SV=1 6 406 3.0E-35
sp|Q8TDD1|DDX54_HUMAN ATP-dependent RNA helicase DDX54 OS=Homo sapiens GN=DDX54 PE=1 SV=2 10 412 3.0E-35
sp|A3AVH5|RH13_ORYSJ DEAD-box ATP-dependent RNA helicase 13 OS=Oryza sativa subsp. japonica GN=Os04g0510400 PE=2 SV=2 10 409 3.0E-35
sp|A2XVF7|RH13_ORYSI DEAD-box ATP-dependent RNA helicase 13 OS=Oryza sativa subsp. indica GN=OsI_016050 PE=3 SV=2 10 409 3.0E-35
sp|Q88NB7|RHLB_PSEPK ATP-dependent RNA helicase RhlB OS=Pseudomonas putida (strain KT2440) GN=rhlB PE=3 SV=1 1 406 3.0E-35
sp|A5E6W6|RRP3_LODEL ATP-dependent rRNA helicase RRP3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=RRP3 PE=3 SV=1 9 407 3.0E-35
sp|Q8H0U8|RH42_ARATH DEAD-box ATP-dependent RNA helicase 42 OS=Arabidopsis thaliana GN=RH42 PE=1 SV=2 14 407 4.0E-35
sp|Q1DP69|DBP2_COCIM ATP-dependent RNA helicase DBP2 OS=Coccidioides immitis (strain RS) GN=DBP2 PE=3 SV=2 9 406 4.0E-35
sp|Q6C024|PRP28_YARLI Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP28 PE=3 SV=1 17 407 4.0E-35
sp|Q5GUR8|RHLB_XANOR ATP-dependent RNA helicase RhlB OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rhlB PE=3 SV=2 6 406 4.0E-35
sp|Q5AAW3|DHH1_CANAL ATP-dependent RNA helicase DHH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DHH1 PE=3 SV=1 9 407 4.0E-35
sp|Q9FFQ1|RH31_ARATH DEAD-box ATP-dependent RNA helicase 31 OS=Arabidopsis thaliana GN=RH31 PE=2 SV=2 10 413 5.0E-35
sp|B5BIS9|RHLB_SALPK ATP-dependent RNA helicase RhlB OS=Salmonella paratyphi A (strain AKU_12601) GN=rhlB PE=3 SV=1 6 406 5.0E-35
sp|A7TEG8|MAK5_VANPO ATP-dependent RNA helicase MAK5 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MAK5 PE=3 SV=1 20 411 5.0E-35
sp|Q7S2N9|HAS1_NEUCR ATP-dependent RNA helicase has-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=has-1 PE=3 SV=1 4 427 5.0E-35
sp|Q0CNX1|DBP8_ASPTN ATP-dependent RNA helicase dbp8 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp8 PE=3 SV=1 6 407 6.0E-35
sp|B0UUZ9|RHLB_HISS2 ATP-dependent RNA helicase RhlB OS=Histophilus somni (strain 2336) GN=rhlB PE=3 SV=1 1 446 6.0E-35
sp|Q5JK84|RH15_ORYSJ DEAD-box ATP-dependent RNA helicase 15 OS=Oryza sativa subsp. japonica GN=Os01g0550000 PE=2 SV=1 6 407 6.0E-35
sp|Q0JM17|RH56_ORYSJ DEAD-box ATP-dependent RNA helicase 56 OS=Oryza sativa subsp. japonica GN=Os01g0549700 PE=2 SV=2 6 407 7.0E-35
sp|A4R8G3|DBP8_MAGO7 ATP-dependent RNA helicase DBP8 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP8 PE=3 SV=3 5 407 7.0E-35
sp|B5YY28|RHLB_ECO5E ATP-dependent RNA helicase RhlB OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rhlB PE=3 SV=1 6 406 7.0E-35
sp|Q8P4D4|RHLB_XANCP ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rhlB PE=3 SV=1 9 406 8.0E-35
sp|B0RWT6|RHLB_XANCB ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. campestris (strain B100) GN=rhlB PE=3 SV=1 9 406 8.0E-35
sp|Q4UPY5|RHLB_XANC8 ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rhlB PE=3 SV=1 9 406 8.0E-35
sp|Q54S03|DDX18_DICDI Probable ATP-dependent RNA helicase ddx18 OS=Dictyostelium discoideum GN=ddx18 PE=3 SV=1 10 412 8.0E-35
sp|Q8H136|RH14_ARATH DEAD-box ATP-dependent RNA helicase 14 OS=Arabidopsis thaliana GN=RH14 PE=1 SV=2 9 406 8.0E-35
sp|Q329V8|RHLB_SHIDS ATP-dependent RNA helicase RhlB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rhlB PE=3 SV=1 6 406 8.0E-35
sp|A8ACT3|RHLB_CITK8 ATP-dependent RNA helicase RhlB OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rhlB PE=3 SV=1 6 406 8.0E-35
sp|Q3YVI4|RHLB_SHISS ATP-dependent RNA helicase RhlB OS=Shigella sonnei (strain Ss046) GN=rhlB PE=3 SV=1 6 406 8.0E-35
sp|P0A8K0|RHLB_SHIFL ATP-dependent RNA helicase RhlB OS=Shigella flexneri GN=rhlB PE=3 SV=2 6 406 8.0E-35
sp|Q1R4F9|RHLB_ECOUT ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain UTI89 / UPEC) GN=rhlB PE=3 SV=1 6 406 8.0E-35
sp|B6I4B6|RHLB_ECOSE ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain SE11) GN=rhlB PE=3 SV=1 6 406 8.0E-35
sp|P0A8J8|RHLB_ECOLI ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain K12) GN=rhlB PE=1 SV=2 6 406 8.0E-35
sp|B1IWC0|RHLB_ECOLC ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rhlB PE=3 SV=1 6 406 8.0E-35
sp|P0A8J9|RHLB_ECOL6 ATP-dependent RNA helicase RhlB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rhlB PE=3 SV=2 6 406 8.0E-35
sp|Q0TAU3|RHLB_ECOL5 ATP-dependent RNA helicase RhlB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rhlB PE=3 SV=1 6 406 8.0E-35
sp|A1AHV0|RHLB_ECOK1 ATP-dependent RNA helicase RhlB OS=Escherichia coli O1:K1 / APEC GN=rhlB PE=3 SV=1 6 406 8.0E-35
sp|A8A6N4|RHLB_ECOHS ATP-dependent RNA helicase RhlB OS=Escherichia coli O9:H4 (strain HS) GN=rhlB PE=3 SV=1 6 406 8.0E-35
sp|B1X9Z4|RHLB_ECODH ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain K12 / DH10B) GN=rhlB PE=3 SV=1 6 406 8.0E-35
sp|C4ZZ48|RHLB_ECOBW ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rhlB PE=3 SV=1 6 406 8.0E-35
sp|B7M5C7|RHLB_ECO8A ATP-dependent RNA helicase RhlB OS=Escherichia coli O8 (strain IAI1) GN=rhlB PE=3 SV=1 6 406 8.0E-35
sp|B7MR01|RHLB_ECO81 ATP-dependent RNA helicase RhlB OS=Escherichia coli O81 (strain ED1a) GN=rhlB PE=3 SV=1 6 406 8.0E-35
sp|B7L8B6|RHLB_ECO55 ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain 55989 / EAEC) GN=rhlB PE=3 SV=1 6 406 8.0E-35
sp|B7MGJ1|RHLB_ECO45 ATP-dependent RNA helicase RhlB OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rhlB PE=3 SV=1 6 406 8.0E-35
sp|B7UMN5|RHLB_ECO27 ATP-dependent RNA helicase RhlB OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rhlB PE=3 SV=1 6 406 8.0E-35
sp|A7ZTY2|RHLB_ECO24 ATP-dependent RNA helicase RhlB OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rhlB PE=3 SV=1 6 406 8.0E-35
sp|Q5RFQ5|DDX6_PONAB Probable ATP-dependent RNA helicase DDX6 OS=Pongo abelii GN=DDX6 PE=2 SV=1 10 407 8.0E-35
sp|Q0SYX0|RHLB_SHIF8 ATP-dependent RNA helicase RhlB OS=Shigella flexneri serotype 5b (strain 8401) GN=rhlB PE=3 SV=1 6 406 9.0E-35
sp|B7LU75|RHLB_ESCF3 ATP-dependent RNA helicase RhlB OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rhlB PE=3 SV=1 6 406 9.0E-35
sp|B7NF85|RHLB_ECOLU ATP-dependent RNA helicase RhlB OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rhlB PE=3 SV=1 6 406 9.0E-35
sp|Q15N18|RHLB_PSEA6 ATP-dependent RNA helicase RhlB OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rhlB PE=3 SV=1 6 406 1.0E-34
sp|A5DLE0|DBP8_PICGU ATP-dependent RNA helicase DBP8 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP8 PE=3 SV=2 9 414 1.0E-34
sp|B7NTG2|RHLB_ECO7I ATP-dependent RNA helicase RhlB OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rhlB PE=3 SV=1 6 406 1.0E-34
sp|A2QC74|DBP2_ASPNC ATP-dependent RNA helicase dbp2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp2 PE=3 SV=1 9 406 1.0E-34
sp|Q5QMN3|RH20_ORYSJ DEAD-box ATP-dependent RNA helicase 20 OS=Oryza sativa subsp. japonica GN=Os01g0197200 PE=3 SV=2 10 406 1.0E-34
sp|Q7RZH4|MAK5_NEUCR ATP-dependent RNA helicase mak-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mak-5 PE=3 SV=1 10 411 1.0E-34
sp|Q9HXE5|RHLB_PSEAE ATP-dependent RNA helicase RhlB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlB PE=3 SV=1 1 406 1.0E-34
sp|Q02S21|RHLB_PSEAB ATP-dependent RNA helicase RhlB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rhlB PE=3 SV=1 1 406 1.0E-34
sp|B7UUT0|RHLB_PSEA8 ATP-dependent RNA helicase RhlB OS=Pseudomonas aeruginosa (strain LESB58) GN=rhlB PE=3 SV=1 1 406 1.0E-34
sp|Q2HGF7|DBP5_CHAGB ATP-dependent RNA helicase DBP5 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP5 PE=3 SV=1 8 413 1.0E-34
sp|Q0JL73|RH26_ORYSJ DEAD-box ATP-dependent RNA helicase 26 OS=Oryza sativa subsp. japonica GN=Os01g0618500 PE=2 SV=1 6 413 1.0E-34
sp|Q887N8|RHLB_PSESM ATP-dependent RNA helicase RhlB OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rhlB PE=3 SV=1 1 406 1.0E-34
sp|Q9C718|RH20_ARATH DEAD-box ATP-dependent RNA helicase 20 OS=Arabidopsis thaliana GN=RH20 PE=2 SV=1 9 406 1.0E-34
sp|Q4X195|DBP2_ASPFU ATP-dependent RNA helicase dbp2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp2 PE=3 SV=2 10 406 1.0E-34
sp|Q6C9P3|DBP3_YARLI ATP-dependent RNA helicase DBP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP3 PE=3 SV=1 10 406 1.0E-34
sp|Q6FLF3|DBP2_CANGA ATP-dependent RNA helicase DBP2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP2 PE=3 SV=1 8 406 1.0E-34
sp|B1LLV3|RHLB_ECOSM ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rhlB PE=3 SV=1 6 406 1.0E-34
sp|A0KS84|RHLB_SHESA ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain ANA-3) GN=rhlB PE=3 SV=1 10 406 1.0E-34
sp|Q87KH5|RHLB_VIBPA ATP-dependent RNA helicase RhlB OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rhlB PE=3 SV=1 6 406 1.0E-34
sp|A9L5D5|RHLB_SHEB9 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS195) GN=rhlB PE=3 SV=1 10 406 2.0E-34
sp|A6WTD3|RHLB_SHEB8 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS185) GN=rhlB PE=3 SV=1 10 406 2.0E-34
sp|A3D9I5|RHLB_SHEB5 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rhlB PE=3 SV=1 10 406 2.0E-34
sp|B8E670|RHLB_SHEB2 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS223) GN=rhlB PE=3 SV=1 10 406 2.0E-34
sp|Q8XAT4|RHLB_ECO57 ATP-dependent RNA helicase RhlB OS=Escherichia coli O157:H7 GN=rhlB PE=3 SV=3 6 406 2.0E-34
sp|Q6FJG1|FAL1_CANGA ATP-dependent RNA helicase FAL1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FAL1 PE=3 SV=1 8 407 2.0E-34
sp|A1DGZ7|DBP2_NEOFI ATP-dependent RNA helicase dbp2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp2 PE=3 SV=1 10 406 2.0E-34
sp|Q27268|DX39B_DROME ATP-dependent RNA helicase WM6 OS=Drosophila melanogaster GN=Hel25E PE=1 SV=1 10 407 2.0E-34
sp|P0CQ80|DHH1_CRYNJ ATP-dependent RNA helicase DHH1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DHH1 PE=3 SV=1 3 408 2.0E-34
sp|P0CQ81|DHH1_CRYNB ATP-dependent RNA helicase DHH1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DHH1 PE=3 SV=1 3 408 2.0E-34
sp|Q2U070|DBP2_ASPOR ATP-dependent RNA helicase dbp2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp2 PE=3 SV=1 9 406 2.0E-34
sp|Q58Z64|DHH1_CRYNH ATP-dependent RNA helicase VAD1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=VAD1 PE=2 SV=1 3 408 2.0E-34
sp|A5DID7|HAS1_PICGU ATP-dependent RNA helicase HAS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=HAS1 PE=3 SV=2 2 427 2.0E-34
sp|Q59PR3|DBP8_CANAL ATP-dependent RNA helicase DBP8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP8 PE=3 SV=1 9 414 3.0E-34
sp|Q8X0X2|DBP5_NEUCR ATP-dependent RNA helicase dbp-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-5 PE=3 SV=1 8 407 3.0E-34
sp|A5E3K3|DBP4_LODEL ATP-dependent RNA helicase DBP4 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP4 PE=3 SV=1 10 411 3.0E-34
sp|Q5BCI0|MAK5_EMENI ATP-dependent RNA helicase mak5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mak5 PE=3 SV=1 8 412 3.0E-34
sp|Q501J6|DDX17_MOUSE Probable ATP-dependent RNA helicase DDX17 OS=Mus musculus GN=Ddx17 PE=1 SV=1 19 412 3.0E-34
sp|P21693|DBPA_ECOLI ATP-dependent RNA helicase DbpA OS=Escherichia coli (strain K12) GN=dbpA PE=1 SV=2 27 417 3.0E-34
sp|P38112|MAK5_YEAST ATP-dependent RNA helicase MAK5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAK5 PE=1 SV=1 19 411 3.0E-34
sp|Q58083|H669_METJA Probable ATP-dependent RNA helicase MJ0669 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0669 PE=1 SV=1 9 407 3.0E-34
sp|Q31UK5|RHLB_SHIBS ATP-dependent RNA helicase RhlB OS=Shigella boydii serotype 4 (strain Sb227) GN=rhlB PE=3 SV=1 6 406 4.0E-34
sp|B2TU12|RHLB_SHIB3 ATP-dependent RNA helicase RhlB OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rhlB PE=3 SV=1 6 406 4.0E-34
sp|Q09775|ROK1_SCHPO ATP-dependent RNA helicase rok1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rok1 PE=3 SV=1 19 406 4.0E-34
sp|Q2H0R2|DBP10_CHAGB ATP-dependent RNA helicase DBP10 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP10 PE=3 SV=1 2 407 4.0E-34
sp|Q0HQL1|RHLB_SHESR ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain MR-7) GN=rhlB PE=3 SV=1 10 406 4.0E-34
sp|Q0HN76|RHLB_SHESM ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain MR-4) GN=rhlB PE=3 SV=1 10 406 4.0E-34
sp|Q0TXZ2|SUB2_PHANO ATP-dependent RNA helicase SUB2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SUB2 PE=3 SV=1 10 439 5.0E-34
sp|Q74Z73|HAS1_ASHGO ATP-dependent RNA helicase HAS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HAS1 PE=3 SV=2 10 472 5.0E-34
sp|Q4PHU9|DBP2_USTMA ATP-dependent RNA helicase DBP2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP2 PE=3 SV=2 9 410 5.0E-34
sp|Q53RK8|RH21_ORYSJ DEAD-box ATP-dependent RNA helicase 21 OS=Oryza sativa subsp. japonica GN=Os03g0708600 PE=2 SV=1 10 408 5.0E-34
sp|Q4P7Z8|DBP5_USTMA ATP-dependent RNA helicase DBP5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP5 PE=3 SV=1 9 450 5.0E-34
sp|A3Q9R3|RHLB_SHELP ATP-dependent RNA helicase RhlB OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rhlB PE=3 SV=1 10 406 6.0E-34
sp|A5UI36|RHLB_HAEIG ATP-dependent RNA helicase RhlB OS=Haemophilus influenzae (strain PittGG) GN=rhlB PE=3 SV=1 10 406 7.0E-34
sp|B5XYY9|RHLB_KLEP3 ATP-dependent RNA helicase RhlB OS=Klebsiella pneumoniae (strain 342) GN=rhlB PE=3 SV=1 6 406 7.0E-34
sp|Q0CI35|MAK5_ASPTN ATP-dependent RNA helicase mak5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mak5 PE=3 SV=2 8 412 7.0E-34
sp|Q7MYL2|RHLB_PHOLL ATP-dependent RNA helicase RhlB OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rhlB PE=3 SV=1 7 406 7.0E-34
sp|Q6CGD1|DBP4_YARLI ATP-dependent RNA helicase DBP4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP4 PE=3 SV=1 8 411 7.0E-34
sp|Q9P7C7|PRP11_SCHPO Pre-mRNA-processing ATP-dependent RNA helicase prp11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp11 PE=3 SV=1 8 411 8.0E-34
sp|Q9UTP9|DBP4_SCHPO ATP-dependent RNA helicase dbp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp4 PE=1 SV=1 10 411 9.0E-34
sp|Q2H4D0|SUB2_CHAGB ATP-dependent RNA helicase SUB2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SUB2 PE=3 SV=1 10 437 9.0E-34
sp|Q9CWT6|DDX28_MOUSE Probable ATP-dependent RNA helicase DDX28 OS=Mus musculus GN=Ddx28 PE=2 SV=2 1 407 9.0E-34
sp|Q6BY27|DBP2_DEBHA ATP-dependent RNA helicase DBP2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP2 PE=3 SV=1 8 406 1.0E-33
sp|Q5JKF2|RH40_ORYSJ DEAD-box ATP-dependent RNA helicase 40 OS=Oryza sativa subsp. japonica GN=Os01g0549400 PE=2 SV=2 9 406 1.0E-33
sp|A6ZL85|MAK5_YEAS7 ATP-dependent RNA helicase MAK5 OS=Saccharomyces cerevisiae (strain YJM789) GN=MAK5 PE=3 SV=1 19 411 1.0E-33
sp|Q9SQV1|RH40_ARATH DEAD-box ATP-dependent RNA helicase 40 OS=Arabidopsis thaliana GN=RH40 PE=2 SV=1 9 406 1.0E-33
sp|Q6C0X2|DHH1_YARLI ATP-dependent RNA helicase DHH1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DHH1 PE=3 SV=1 10 407 1.0E-33
sp|Q92841|DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 19 412 1.0E-33
sp|Q5VQL1|RH14_ORYSJ DEAD-box ATP-dependent RNA helicase 14 OS=Oryza sativa subsp. japonica GN=Os01g0172200 PE=2 SV=1 9 406 2.0E-33
sp|A6QUM7|DBP10_AJECN ATP-dependent RNA helicase DBP10 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP10 PE=3 SV=1 10 407 2.0E-33
sp|B2VG58|RHLB_ERWT9 ATP-dependent RNA helicase RhlB OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rhlB PE=3 SV=1 7 406 2.0E-33
sp|B1JQ11|RHLB_YERPY ATP-dependent RNA helicase RhlB OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rhlB PE=3 SV=1 6 406 2.0E-33
sp|Q66G19|RHLB_YERPS ATP-dependent RNA helicase RhlB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rhlB PE=3 SV=1 6 406 2.0E-33
sp|A4TRC8|RHLB_YERPP ATP-dependent RNA helicase RhlB OS=Yersinia pestis (strain Pestoides F) GN=rhlB PE=3 SV=1 6 406 2.0E-33
sp|Q1CNK3|RHLB_YERPN ATP-dependent RNA helicase RhlB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rhlB PE=3 SV=1 6 406 2.0E-33
sp|Q8ZAD8|RHLB_YERPE ATP-dependent RNA helicase RhlB OS=Yersinia pestis GN=rhlB PE=3 SV=1 6 406 2.0E-33
sp|B2K046|RHLB_YERPB ATP-dependent RNA helicase RhlB OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rhlB PE=3 SV=1 6 406 2.0E-33
sp|Q1CBQ4|RHLB_YERPA ATP-dependent RNA helicase RhlB OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rhlB PE=3 SV=1 6 406 2.0E-33
sp|A7FD47|RHLB_YERP3 ATP-dependent RNA helicase RhlB OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rhlB PE=3 SV=1 6 406 2.0E-33
sp|A1C6C4|DBP2_ASPCL ATP-dependent RNA helicase dbp2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp2 PE=3 SV=1 9 406 2.0E-33
sp|A6R603|SUB2_AJECN ATP-dependent RNA helicase SUB2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=SUB2 PE=3 SV=2 10 437 2.0E-33
sp|A6R9U4|MAK5_AJECN ATP-dependent RNA helicase MAK5 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=MAK5 PE=3 SV=1 13 412 2.0E-33
sp|A1RFB3|RHLB_SHESW ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain W3-18-1) GN=rhlB PE=3 SV=1 10 406 2.0E-33
sp|A4YB09|RHLB_SHEPC ATP-dependent RNA helicase RhlB OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rhlB PE=3 SV=1 10 406 2.0E-33
sp|A5E2Z9|HAS1_LODEL ATP-dependent RNA helicase HAS1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=HAS1 PE=3 SV=1 20 427 2.0E-33
sp|Q7RYZ7|DBP8_NEUCR ATP-dependent RNA helicase dbp-8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-8 PE=3 SV=1 9 469 2.0E-33
sp|A2YV85|RH29_ORYSI DEAD-box ATP-dependent RNA helicase 29 OS=Oryza sativa subsp. indica GN=OsI_028228 PE=2 SV=2 10 412 2.0E-33
sp|Q755N4|DBP2_ASHGO ATP-dependent RNA helicase DBP2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP2 PE=3 SV=2 9 406 2.0E-33
sp|A0KEG9|RHLB_AERHH ATP-dependent RNA helicase RhlB OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rhlB PE=3 SV=1 10 406 2.0E-33
sp|A7E449|DBP2_SCLS1 ATP-dependent RNA helicase dbp2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp2 PE=3 SV=1 9 406 2.0E-33
sp|A6TGG9|RHLB_KLEP7 ATP-dependent RNA helicase RhlB OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rhlB PE=3 SV=1 6 406 2.0E-33
sp|A3BT52|RH29_ORYSJ DEAD-box ATP-dependent RNA helicase 29 OS=Oryza sativa subsp. japonica GN=Os08g0416100 PE=2 SV=2 10 412 3.0E-33
sp|A3LNR6|HAS1_PICST ATP-dependent RNA helicase HAS1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HAS1 PE=3 SV=2 2 427 3.0E-33
sp|Q4WMS3|MAK5_ASPFU ATP-dependent RNA helicase mak5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mak5 PE=3 SV=2 8 412 3.0E-33
sp|Q4R6M5|DDX5_MACFA Probable ATP-dependent RNA helicase DDX5 OS=Macaca fascicularis GN=DDX5 PE=2 SV=1 10 412 3.0E-33
sp|Q0UMB9|DBP4_PHANO ATP-dependent RNA helicase DBP4 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP4 PE=3 SV=1 10 411 3.0E-33
sp|A5UDI1|RHLB_HAEIE ATP-dependent RNA helicase RhlB OS=Haemophilus influenzae (strain PittEE) GN=rhlB PE=3 SV=1 10 406 3.0E-33
sp|A1DMT9|MAK5_NEOFI ATP-dependent RNA helicase mak5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mak5 PE=3 SV=1 8 412 3.0E-33
sp|Q6BGU8|DBP8_DEBHA ATP-dependent RNA helicase DBP8 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP8 PE=3 SV=2 9 414 3.0E-33
sp|Q759L6|SUB2_ASHGO ATP-dependent RNA helicase SUB2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SUB2 PE=3 SV=1 10 437 3.0E-33
sp|P54475|CSHB_BACSU DEAD-box ATP-dependent RNA helicase CshB OS=Bacillus subtilis (strain 168) GN=cshB PE=1 SV=1 7 406 3.0E-33
sp|Q61656|DDX5_MOUSE Probable ATP-dependent RNA helicase DDX5 OS=Mus musculus GN=Ddx5 PE=1 SV=2 10 412 4.0E-33
sp|A6SFW7|DBP2_BOTFB ATP-dependent RNA helicase dbp2 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp2 PE=3 SV=2 9 406 4.0E-33
sp|Q5R4I9|DDX5_PONAB Probable ATP-dependent RNA helicase DDX5 OS=Pongo abelii GN=DDX5 PE=2 SV=1 10 412 4.0E-33
sp|Q818H2|CSHB_BACCR DEAD-box ATP-dependent RNA helicase CshB OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshB PE=2 SV=1 6 409 4.0E-33
sp|P17844|DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens GN=DDX5 PE=1 SV=1 10 412 4.0E-33
sp|Q0UR48|HAS1_PHANO ATP-dependent RNA helicase HAS1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HAS1 PE=3 SV=1 10 412 4.0E-33
sp|Q6CRF4|DBP4_KLULA ATP-dependent RNA helicase DBP4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP4 PE=3 SV=1 10 411 4.0E-33
sp|Q6FIL3|HAS1_CANGA ATP-dependent RNA helicase HAS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HAS1 PE=3 SV=1 1 427 4.0E-33
sp|A4STJ7|RHLB_AERS4 ATP-dependent RNA helicase RhlB OS=Aeromonas salmonicida (strain A449) GN=rhlB PE=3 SV=1 10 406 4.0E-33
sp|Q2GMX1|HAS1_CHAGB ATP-dependent RNA helicase HAS1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HAS1 PE=3 SV=1 10 427 4.0E-33
sp|Q55BR9|DDX49_DICDI Probable ATP-dependent RNA helicase ddx49 OS=Dictyostelium discoideum GN=ddx49 PE=3 SV=1 6 409 4.0E-33
sp|Q7RZ35|DBP4_NEUCR ATP-dependent RNA helicase dbp-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-4 PE=3 SV=1 10 411 5.0E-33
sp|Q5ZHZ0|DX39B_CHICK Spliceosome RNA helicase DDX39B OS=Gallus gallus GN=DDX39B PE=2 SV=1 6 407 5.0E-33
sp|Q3T147|DX39B_BOVIN Spliceosome RNA helicase DDX39B OS=Bos taurus GN=DDX39B PE=2 SV=1 6 407 5.0E-33
sp|A8G828|RHLB_SERP5 ATP-dependent RNA helicase RhlB OS=Serratia proteamaculans (strain 568) GN=rhlB PE=3 SV=1 6 406 5.0E-33
sp|Q0U6X2|MAK5_PHANO ATP-dependent RNA helicase MAK5 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MAK5 PE=3 SV=1 8 412 5.0E-33
sp|Q5AJD0|DBP5_CANAL ATP-dependent RNA helicase DBP5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP5 PE=3 SV=1 9 418 5.0E-33
sp|Q6CM95|SUB2_KLULA ATP-dependent RNA helicase SUB2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SUB2 PE=3 SV=1 10 437 6.0E-33
sp|Q8SQK9|DHH1_ENCCU ATP-dependent RNA helicase DHH1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DHH1 PE=3 SV=2 10 411 6.0E-33
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0005524 ATP binding Yes
GO:0016787 hydrolase activity Yes
GO:0003677 DNA binding Yes
GO:0017076 purine nucleotide binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0030554 adenyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1394
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5481
Ophiocordyceps australis map64 (Brazil) OphauB2|8140 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01698
Ophiocordyceps camponoti-rufipedis Ophun1|7061
Ophiocordyceps kimflemingae Ophio5|5685
Ophiocordyceps subramaniannii Hirsu2|10865

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8140
MENAENEATFADLGLDPRLVQAVASQNYLKPTLVQRKAIPLALNGQDVLCKAKTGSGKTAAYVLPVLAGILKRKS
ADSNPATSALILVPSRELADQVFRATEDLSSFCASHIKAVKLTDKLSDAAQRSLLSTRPDIIISTPARAWNHVKS
NDAILAKLSCLVLDEADLLLSYGYNEDLENLSWSMPKGVQTIMMSATLTDEVELLKKVFYRNNVPALLDLQEPDV
DGEGVTQLYTKCGEDEKFLLAYVIFKLQLVKGKCIIFVGEVDRCYRLKLFLEQFGIRSCILNSELPVNSRLHVVD
EFNRNVYDLIIASDDKEVIGNEENADDAQGGDEHHGADGHDGEKKQRPRKKRKMRQEDKEYGVSRGIDFKNVAAV
INFDLPKTASSYTHRIGRTGRAGRAGLALSFVVPKQLYRQHMATWTPTAEHDEKVLARIMRRQADKDKELQAYNF
DAKQIEAFRYRMNDALRAVTQVAVREARTRELRQELVKSEKLTRYFEENPSEMKHLRHDGELRTARQQAHLRHIP
DYLMPKEGRKGLSEQQVGRNNDPLKTLKARRLAK*
Coding >OphauB2|8140
ATGGAAAATGCAGAAAACGAGGCCACTTTTGCAGACTTGGGACTGGACCCAAGACTAGTGCAAGCTGTCGCCAGC
CAGAACTACTTGAAGCCCACGCTGGTACAGCGCAAGGCTATCCCCCTAGCACTGAATGGCCAAGATGTGCTATGC
AAGGCCAAGACGGGGTCTGGAAAGACGGCAGCCTATGTTTTGCCTGTACTGGCCGGAATCCTTAAGCGCAAGAGT
GCCGACTCGAATCCTGCCACGTCGGCTCTGATACTGGTGCCTTCGCGCGAATTGGCCGATCAAGTCTTCAGAGCC
ACTGAGGATTTATCCTCCTTTTGCGCCAGCCACATCAAAGCCGTCAAGTTGACGGACAAGCTCTCAGATGCGGCA
CAACGATCACTCTTATCAACTCGCCCCGATATAATCATTTCCACGCCGGCGCGCGCCTGGAATCATGTCAAGTCC
AACGATGCCATTCTCGCCAAGCTCTCGTGTCTGGTTCTCGACGAGGCCGATCTTCTTCTCTCATACGGCTACAAC
GAAGATTTGGAAAATCTCTCATGGTCAATGCCCAAAGGCGTGCAAACAATCATGATGAGCGCGACCCTAACAGAT
GAGGTGGAGCTGCTGAAAAAGGTGTTTTACCGGAACAACGTGCCAGCTCTTCTGGACCTCCAAGAGCCAGACGTT
GATGGCGAGGGCGTAACACAACTCTATACCAAGTGTGGCGAGGATGAAAAGTTTCTTCTGGCATATGTCATCTTC
AAGCTTCAGCTAGTCAAGGGCAAGTGCATCATCTTTGTGGGAGAAGTGGACCGTTGCTATCGGTTGAAGCTATTT
CTTGAGCAATTTGGTATCCGCAGTTGCATCTTGAACTCTGAACTGCCCGTCAACTCGAGGCTACACGTGGTTGAC
GAGTTCAACCGCAACGTATACGACCTCATCATTGCGTCTGACGACAAGGAGGTAATTGGGAACGAGGAAAATGCG
GACGACGCGCAAGGCGGGGATGAGCACCATGGCGCAGACGGCCATGACGGCGAGAAGAAGCAGCGGCCGAGAAAG
AAGCGCAAGATGAGACAAGAGGACAAGGAGTATGGCGTTTCACGAGGCATTGACTTCAAAAATGTGGCGGCCGTC
ATCAACTTTGATCTCCCCAAGACGGCGTCGTCGTACACACACAGAATAGGGCGTACAGGTCGAGCAGGTAGAGCA
GGCTTGGCTCTTTCGTTTGTGGTACCCAAGCAGCTCTATCGCCAGCACATGGCGACATGGACGCCGACGGCAGAG
CATGATGAAAAAGTACTGGCTAGGATTATGCGGCGACAGGCCGACAAGGACAAGGAGCTCCAAGCATACAACTTT
GACGCCAAGCAAATCGAGGCGTTTCGCTATCGTATGAATGACGCTTTGCGGGCGGTGACTCAGGTCGCGGTGCGC
GAAGCTCGTACTCGAGAATTGCGACAAGAACTCGTCAAGAGTGAGAAGCTGACACGATACTTTGAAGAGAACCCG
TCGGAAATGAAACATCTTCGTCATGACGGTGAACTAAGGACAGCAAGACAGCAAGCGCACTTGAGACATATCCCG
GACTATCTGATGCCCAAAGAGGGCAGAAAGGGATTGAGTGAACAACAAGTTGGACGAAACAATGATCCACTCAAG
ACACTCAAGGCTCGTCGTCTGGCCAAGTGA
Transcript >OphauB2|8140
ATGGAAAATGCAGAAAACGAGGCCACTTTTGCAGACTTGGGACTGGACCCAAGACTAGTGCAAGCTGTCGCCAGC
CAGAACTACTTGAAGCCCACGCTGGTACAGCGCAAGGCTATCCCCCTAGCACTGAATGGCCAAGATGTGCTATGC
AAGGCCAAGACGGGGTCTGGAAAGACGGCAGCCTATGTTTTGCCTGTACTGGCCGGAATCCTTAAGCGCAAGAGT
GCCGACTCGAATCCTGCCACGTCGGCTCTGATACTGGTGCCTTCGCGCGAATTGGCCGATCAAGTCTTCAGAGCC
ACTGAGGATTTATCCTCCTTTTGCGCCAGCCACATCAAAGCCGTCAAGTTGACGGACAAGCTCTCAGATGCGGCA
CAACGATCACTCTTATCAACTCGCCCCGATATAATCATTTCCACGCCGGCGCGCGCCTGGAATCATGTCAAGTCC
AACGATGCCATTCTCGCCAAGCTCTCGTGTCTGGTTCTCGACGAGGCCGATCTTCTTCTCTCATACGGCTACAAC
GAAGATTTGGAAAATCTCTCATGGTCAATGCCCAAAGGCGTGCAAACAATCATGATGAGCGCGACCCTAACAGAT
GAGGTGGAGCTGCTGAAAAAGGTGTTTTACCGGAACAACGTGCCAGCTCTTCTGGACCTCCAAGAGCCAGACGTT
GATGGCGAGGGCGTAACACAACTCTATACCAAGTGTGGCGAGGATGAAAAGTTTCTTCTGGCATATGTCATCTTC
AAGCTTCAGCTAGTCAAGGGCAAGTGCATCATCTTTGTGGGAGAAGTGGACCGTTGCTATCGGTTGAAGCTATTT
CTTGAGCAATTTGGTATCCGCAGTTGCATCTTGAACTCTGAACTGCCCGTCAACTCGAGGCTACACGTGGTTGAC
GAGTTCAACCGCAACGTATACGACCTCATCATTGCGTCTGACGACAAGGAGGTAATTGGGAACGAGGAAAATGCG
GACGACGCGCAAGGCGGGGATGAGCACCATGGCGCAGACGGCCATGACGGCGAGAAGAAGCAGCGGCCGAGAAAG
AAGCGCAAGATGAGACAAGAGGACAAGGAGTATGGCGTTTCACGAGGCATTGACTTCAAAAATGTGGCGGCCGTC
ATCAACTTTGATCTCCCCAAGACGGCGTCGTCGTACACACACAGAATAGGGCGTACAGGTCGAGCAGGTAGAGCA
GGCTTGGCTCTTTCGTTTGTGGTACCCAAGCAGCTCTATCGCCAGCACATGGCGACATGGACGCCGACGGCAGAG
CATGATGAAAAAGTACTGGCTAGGATTATGCGGCGACAGGCCGACAAGGACAAGGAGCTCCAAGCATACAACTTT
GACGCCAAGCAAATCGAGGCGTTTCGCTATCGTATGAATGACGCTTTGCGGGCGGTGACTCAGGTCGCGGTGCGC
GAAGCTCGTACTCGAGAATTGCGACAAGAACTCGTCAAGAGTGAGAAGCTGACACGATACTTTGAAGAGAACCCG
TCGGAAATGAAACATCTTCGTCATGACGGTGAACTAAGGACAGCAAGACAGCAAGCGCACTTGAGACATATCCCG
GACTATCTGATGCCCAAAGAGGGCAGAAAGGGATTGAGTGAACAACAAGTTGGACGAAACAATGATCCACTCAAG
ACACTCAAGGCTCGTCGTCTGGCCAAGTGA
Gene >OphauB2|8140
ATGGAAAATGCAGAAAACGAGGCCACTTTTGCAGACTTGGGACTGGACCCAAGACTAGTGCAAGCTGTCGCCAGC
CAGAACTACTTGAAGCCCACGCTGGTACAGCGCAAGGCTATCCCCCTAGCACTGAATGGCCAAGATGTGCTATGC
AAGGCCAAGACGGGGTCTGGAAAGACGGCAGCCTATGTTTTGCCTGTACTGGCCGGAATCCTTAAGCGCAAGAGT
GTAGGTCTTGGTCACCGGTTCTGCCGACACTTGCCGGCAGTATTGCTGATAGAAGCCAGGCCGACTCGAATCCTG
CCACGTCGGCTCTGATACTGGTGCCTTCGCGCGAATTGGCCGATCAAGTCTTCAGAGCCACTGAGGATTTATCCT
CCTTTTGCGCCAGCCACATCAAAGCCGTCAAGTTGACGGACAAGCTCTCAGATGCGGCACAACGATCACTCTTAT
CAACTCGCCCCGATATAATCATTTCCACGCCGGCGCGCGCCTGGAATCATGTCAAGTCCAACGATGCCATTCTCG
CCAAGCTCTCGTGTCTGGTTCTCGACGAGGCCGATCTTCTTCTCTCATACGGCTACAACGAAGATTTGGAAAATC
TCTCATGGTCAATGCCCAAAGGCGTGCAAACAATCATGATGAGCGCGACCCTAACAGATGAGGTGGAGCTGCTGA
AAAAGGTGTTTTACCGGAACAACGTGCCAGCTCTTCTGGACCTCCAAGAGCCAGACGTTGATGGCGAGGGCGTAA
CACAACTCTATACCAAGTAGGCTTTCCTCTTGACAATGCCGTGAAAACGGGCTTCTAACATGATGCAAGGTGTGG
CGAGGATGAAAAGTTTCTTCTGGCATATGTCATCTTCAAGCTTCAGCTAGTCAAGGGCAAGTGCATCATCTTTGT
GGGAGAAGTGGACCGTTGCTATCGGTTGAAGCTATTTCTTGAGCAATTTGGTATCCGCAGTTGCATCTTGAACTC
TGAACTGCCCGTCAACTCGAGGCTACACGTGGTTGACGAGTTCAACCGCAACGTATACGACCTCATCATTGCGTC
TGACGACAAGGAGGTAATTGGGAACGAGGAAAATGCGGACGACGCGCAAGGCGGGGATGAGCACCATGGCGCAGA
CGGCCATGACGGCGAGAAGAAGCAGCGGCCGAGAAAGAAGCGCAAGATGAGACAAGAGGACAAGGAGTATGGCGT
TTCACGAGGCGAGTTACAAATGACAGATAGTTGGGTTAATTTGACAATTGGGACAAGTGCTGACTCGAAGCAGGC
ATTGACTTCAAAAATGTGGCGGCCGTCATCAACTTTGATCTCCCCAAGACGGCGTCGTCGTACACACACAGAATA
GGGCGTACAGGTCGAGCAGGTAGAGCAGGCTTGGCTCTTTCGTTTGTGGTACCCAAGCAGCTCTATCGCCAGCAC
ATGGCGACATGGACGCCGACGGCAGAGCATGATGAAAAAGTACTGGCTAGGATTATGCGGCGACAGGCCGACAAG
GACAAGGAGCTCCAAGCATACAACTTTGACGCCAAGCAAATCGAGGCGTTTCGCTATCGTATGAATGACGCTTTG
CGGGCGGTGACTCAGGTCGCGGTGCGCGAAGCTCGTACTCGAGAATTGCGACAAGAACTCGTCAAGAGTGAGAAG
CTGACACGGTAAGTTGAAAAGATGAATGCAAAGTTTAGGAGCTAGAGGCTAAGATAATAATGATTGATGTGACTA
GATACTTTGAAGAGAACCCGTCGGAAATGAAACATCTTCGTCATGACGGTGAACTAAGGACAGCAAGACAGCAAG
CGCACTTGAGACATATCCCGGACTATCTGATGCCCAAAGAGGGCAGAAAGGGATTGAGTGAACAACAAGTTGGGT
TTGTGCCACTCAACAAAGCCGGCAGCAAAGAGCGAGGAGGGCACAGAAAAGGAAGAGGCAAGCGAGGGAGACTTG
TGCGTGGCGGTAGACGAAACAATGATCCACTCAAGACACTCAAGGCTCGTCGTCTGGCCAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail