Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8139
Gene name
LocationContig_98:61895..63362
Strand+
Gene length (bp)1467
Transcript length (bp)819
Coding sequence length (bp)819
Protein length (aa) 273

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 6.5E-10 167 207

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q03237|MYBB_CHICK Myb-related protein B OS=Gallus gallus GN=MYBL2 PE=1 SV=1 152 267 7.0E-06
sp|P10244|MYBB_HUMAN Myb-related protein B OS=Homo sapiens GN=MYBL2 PE=1 SV=1 152 264 9.0E-06
sp|Q9S7G7|MB3R1_ARATH Myb-related protein 3R-1 OS=Arabidopsis thaliana GN=MYB3R-1 PE=2 SV=1 137 267 1.0E-05

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8139
MQQWQVGPVPDYVYSNSTHQPNDMHNHPYQADMARRNEQQRMDFPYGPPQPNMGAQQQHHATPVQPPPPMNVQQQ
APPNAQGSAQHTPTQTPAQPSRQRKRPAPNTAQSPATGAPPAPVTPSQVQPPAPAPSAPQTAPQVPPQAPSDDVN
ATPSTQPPAKKSRTNTPWTPQEELRLKQMRDAGNSWAEIAKTFPTRTEGSVKKHWYKDMHYAEFAEDESQALLNA
IKEYENNKWKVIGQKVGKPAKACEQYAKEHFPGMFSKACREQGPSQA*
Coding >OphauB2|8139
ATGCAGCAGTGGCAGGTCGGCCCTGTGCCGGACTACGTTTACTCCAACTCCACTCACCAGCCCAACGACATGCAC
AACCATCCTTACCAGGCAGACATGGCCCGTCGCAATGAGCAGCAGCGCATGGACTTTCCCTATGGCCCTCCCCAG
CCCAACATGGGGGCTCAACAGCAGCACCACGCGACTCCCGTTCAGCCGCCGCCGCCCATGAATGTGCAGCAACAG
GCTCCCCCAAATGCACAGGGCAGCGCTCAGCATACGCCTACCCAGACACCTGCTCAACCCAGCCGTCAGCGCAAA
CGCCCGGCCCCGAATACGGCCCAGTCCCCCGCAACAGGCGCGCCTCCGGCTCCGGTTACCCCGAGTCAGGTTCAG
CCTCCCGCTCCTGCACCTTCAGCCCCTCAGACGGCTCCTCAGGTGCCGCCTCAGGCGCCGTCTGACGACGTCAAC
GCCACGCCCAGCACACAGCCACCCGCCAAGAAGAGCCGGACCAACACTCCCTGGACTCCACAAGAGGAACTGCGA
CTGAAGCAAATGCGTGACGCTGGCAACAGCTGGGCTGAGATTGCAAAGACATTTCCTACAAGAACCGAGGGATCT
GTCAAGAAGCATTGGTACAAGGACATGCATTATGCTGAGTTTGCCGAGGATGAGAGCCAAGCTCTGTTGAACGCC
ATCAAGGAGTACGAAAATAACAAGTGGAAAGTCATCGGACAGAAGGTCGGCAAGCCAGCCAAGGCTTGTGAACAG
TACGCTAAAGAGCATTTCCCCGGAATGTTCTCAAAGGCCTGCCGGGAACAAGGGCCGTCACAGGCTTAG
Transcript >OphauB2|8139
ATGCAGCAGTGGCAGGTCGGCCCTGTGCCGGACTACGTTTACTCCAACTCCACTCACCAGCCCAACGACATGCAC
AACCATCCTTACCAGGCAGACATGGCCCGTCGCAATGAGCAGCAGCGCATGGACTTTCCCTATGGCCCTCCCCAG
CCCAACATGGGGGCTCAACAGCAGCACCACGCGACTCCCGTTCAGCCGCCGCCGCCCATGAATGTGCAGCAACAG
GCTCCCCCAAATGCACAGGGCAGCGCTCAGCATACGCCTACCCAGACACCTGCTCAACCCAGCCGTCAGCGCAAA
CGCCCGGCCCCGAATACGGCCCAGTCCCCCGCAACAGGCGCGCCTCCGGCTCCGGTTACCCCGAGTCAGGTTCAG
CCTCCCGCTCCTGCACCTTCAGCCCCTCAGACGGCTCCTCAGGTGCCGCCTCAGGCGCCGTCTGACGACGTCAAC
GCCACGCCCAGCACACAGCCACCCGCCAAGAAGAGCCGGACCAACACTCCCTGGACTCCACAAGAGGAACTGCGA
CTGAAGCAAATGCGTGACGCTGGCAACAGCTGGGCTGAGATTGCAAAGACATTTCCTACAAGAACCGAGGGATCT
GTCAAGAAGCATTGGTACAAGGACATGCATTATGCTGAGTTTGCCGAGGATGAGAGCCAAGCTCTGTTGAACGCC
ATCAAGGAGTACGAAAATAACAAGTGGAAAGTCATCGGACAGAAGGTCGGCAAGCCAGCCAAGGCTTGTGAACAG
TACGCTAAAGAGCATTTCCCCGGAATGTTCTCAAAGGCCTGCCGGGAACAAGGGCCGTCACAGGCTTAG
Gene >OphauB2|8139
ATGCAGCAGTGGCAGGTCGGCCCTGTGCCGGACTACGTTTACTCCAACTCCACTCACCAGCCCAACGACATGCAG
TAAGTACTTTTCGCCTCTCTCCTTGTTCCTGTACCTCGACTCGTTGCCCTCAGGTCGTCAGTCACCCCGATTGTT
GTATCTGGCGTGTGCGTCTTGTGTATCCCCCGGCCTCGTTTCGCCTCGCCTCATCTCGCCTCGCCTTGCCTTGCC
TTTGCCTTGCCCTCCCTTGCCCTCTCCTCCTCTGCCTCTTTACCACTAGACCCCGGCCCTGACGGCCACTGGTGC
CCATGTATCACCAGGGCCGGCTTTCCTTTTGAACACAGACCAGCAGCGCGGCCGCTGTCCACCACCTTTTCGCGA
TGCCCTTTGTTCCCTTGGGCGTTGCTTTGGTTGGACCGAGGGCACAGCTTCATGCAATGCAAGGCCATGACGGCT
TACCGGCAAAAGTGCTGACCGGCGCGTCTAAATAGCAACCATCCTTACCAGGCAGACATGGCCCGTCGCAATGAG
CAGCAGCGCATGGACTTTCCCTATGGCCCTCCCCAGCCCAACATGGGGGCTCAACAGCAGCACCACGCGACTCCC
GTTCAGCCGCCGCCGCCCATGAATGTGCAGCAACAGGCTCCCCCAAATGCACAGGGCAGCGCTCAGCATACGCCT
ACCCAGACACCTGCTCAACCCAGCCGTCAGCGCAAACGCCCGGCCCCGAATACGGCCCAGTCCCCCGCAACAGGC
GCGCCTCCGGCTCCGGTTACCCCGAGTCAGGTTCAGCCTCCCGCTCCTGCACCTTCAGCCCCTCAGACGGCTCCT
CAGGTGCCGCCTCAGGCGCCGTCTGACGACGTCAACGCCACGCCCAGCACACAGCCACCCGCCAAGAAGAGCCGG
ACCAACACTCCCTGGACTCCACAAGAGGAACTGCGACTGAAGCAAATGCGTGACGCTGGCAACAGCTGGGCTGAG
ATTGCAAAGGTATACCTGTCTGTTGGCAACGCGGCATGGCTTTGTCTTTGTTACTCACACGTAGTTTCGCAGACA
TTTCCTACAAGAACCGAGGGATCTGTCAAGAAGCATTGGTACAAGGTATTCTTCTCAAAGCAATCATGATTTTCA
TGGCAATGCGTTTCTAACCCATCTACAGGACATGCATTATGCTGAGTTTGCCGAGGATGAGGTGACCAGTCCATC
GACATCCCTGTCAATCAAGATTGCCTGCTGACGTGATTGGGGTTTCAGAGCCAAGCTCTGTTGAACGCCATCAAG
GAGTACGAAAATAACAAGTGGAAAGTCATCGGACAGAAGGTCGGCAAGCCAGCCAAGGTACTTGCTCGCCGTTCG
TCTAGTTATTCGTGGAGCATCCTGACCTTGTAATAGGCTTGTGAACAGTACGCTAAAGAGCATTTCCCCGGAATG
TTCTCAAAGGCCTGCCGGGAACAAGGGCCGTCACAGGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail