Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8129
Gene name
LocationContig_98:37845..39156
Strand-
Gene length (bp)1311
Transcript length (bp)1251
Coding sequence length (bp)1251
Protein length (aa) 417

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03463 eRF1_1 eRF1 domain 1 1.9E-38 1 136
PF03464 eRF1_2 eRF1 domain 2 3.5E-17 145 269
PF03465 eRF1_3 eRF1 domain 3 1.8E-16 278 381

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P48612|PELO_DROME Protein pelota OS=Drosophila melanogaster GN=pelo PE=2 SV=2 1 381 1.0E-92
sp|Q58DV0|PELO_BOVIN Protein pelota homolog OS=Bos taurus GN=PELO PE=2 SV=2 1 388 3.0E-92
sp|Q5XIP1|PELO_RAT Protein pelota homolog OS=Rattus norvegicus GN=Pelo PE=1 SV=1 1 390 3.0E-92
sp|Q5RCE3|PELO_PONAB Protein pelota homolog OS=Pongo abelii GN=PELO PE=2 SV=1 1 390 4.0E-92
sp|Q9USL5|DOM34_SCHPO Protein dom34 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dom34 PE=1 SV=1 1 381 4.0E-92
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P48612|PELO_DROME Protein pelota OS=Drosophila melanogaster GN=pelo PE=2 SV=2 1 381 1.0E-92
sp|Q58DV0|PELO_BOVIN Protein pelota homolog OS=Bos taurus GN=PELO PE=2 SV=2 1 388 3.0E-92
sp|Q5XIP1|PELO_RAT Protein pelota homolog OS=Rattus norvegicus GN=Pelo PE=1 SV=1 1 390 3.0E-92
sp|Q5RCE3|PELO_PONAB Protein pelota homolog OS=Pongo abelii GN=PELO PE=2 SV=1 1 390 4.0E-92
sp|Q9USL5|DOM34_SCHPO Protein dom34 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dom34 PE=1 SV=1 1 381 4.0E-92
sp|Q9BRX2|PELO_HUMAN Protein pelota homolog OS=Homo sapiens GN=PELO PE=1 SV=2 1 408 6.0E-92
sp|Q7ZWC4|PELO_DANRE Protein pelota homolog OS=Danio rerio GN=pelo PE=2 SV=1 1 394 9.0E-92
sp|Q80X73|PELO_MOUSE Protein pelota homolog OS=Mus musculus GN=Pelo PE=1 SV=3 1 390 9.0E-91
sp|Q5ZK01|PELO_CHICK Protein pelota homolog OS=Gallus gallus GN=PELO PE=2 SV=1 1 390 1.0E-89
sp|Q5U567|PELO_XENLA Protein pelota homolog OS=Xenopus laevis GN=pelo PE=2 SV=1 1 384 2.0E-87
sp|P50444|PELO_CAEEL Protein pelota homolog OS=Caenorhabditis elegans GN=R74.6 PE=3 SV=1 17 387 5.0E-74
sp|Q9ZT87|PEL1_ARATH Protein PELOTA 1 OS=Arabidopsis thaliana GN=PEL1 PE=2 SV=1 17 386 3.0E-73
sp|Q9M2H7|PEL2_ARATH Protein PELOTA 2 OS=Arabidopsis thaliana GN=PEL2 PE=3 SV=1 17 386 1.0E-65
sp|P33309|DOM34_YEAST Protein DOM34 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOM34 PE=1 SV=2 17 391 2.0E-56
sp|C5A5T8|PELO_THEGJ Protein pelota homolog OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pelA PE=3 SV=1 17 379 7.0E-34
sp|A5UKW7|PELO_METS3 Protein pelota homolog OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=pelA PE=3 SV=1 6 381 2.0E-33
sp|Q5JIB9|PELO_THEKO Protein pelota homolog OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pelA PE=1 SV=1 13 379 8.0E-33
sp|B6YUV3|PELO_THEON Protein pelota homolog OS=Thermococcus onnurineus (strain NA1) GN=pelA PE=3 SV=1 6 379 3.0E-32
sp|O27679|PELO_METTH Protein pelota homolog OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pelA PE=3 SV=2 6 381 2.0E-30
sp|Q57638|PELO_METJA Protein pelota homolog OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pelA PE=3 SV=1 17 381 7.0E-30
sp|Q8TZ98|PELO_METKA Protein pelota homolog OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pelA PE=3 SV=1 6 381 1.0E-29
sp|B1L659|PELO_KORCO Protein pelota homolog OS=Korarchaeum cryptofilum (strain OPF8) GN=pelA PE=3 SV=1 6 379 3.0E-29
sp|Q0W6H4|PELO_METAR Protein pelota homolog OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=pelA PE=3 SV=1 16 381 1.0E-26
sp|A4G0A4|PELO_METM5 Protein pelota homolog OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pelA PE=3 SV=1 13 381 4.0E-25
sp|Q2NFD9|PELO_METST Protein pelota homolog OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=pelA PE=3 SV=1 6 381 5.0E-25
sp|A0B6U3|PELO_METTP Protein pelota homolog OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=pelA PE=3 SV=2 1 379 5.0E-25
sp|A3CU20|PELO_METMJ Protein pelota homolog OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pelA PE=3 SV=1 16 381 7.0E-25
sp|A9A8K6|PELO_METM6 Protein pelota homolog OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=pelA PE=3 SV=1 13 381 2.0E-24
sp|A6VI74|PELO_METM7 Protein pelota homolog OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pelA PE=3 SV=1 13 381 5.0E-24
sp|A3DMX7|PELO_STAMF Protein pelota homolog OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=pelA PE=3 SV=1 6 381 5.0E-24
sp|A7I7Y6|PELO_METB6 Protein pelota homolog OS=Methanoregula boonei (strain 6A8) GN=pelA PE=3 SV=1 16 381 6.0E-24
sp|Q9V0V3|PELO_PYRAB Protein pelota homolog OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pelA PE=3 SV=1 13 381 8.0E-24
sp|Q2FQH4|PELO_METHJ Protein pelota homolog OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pelA PE=3 SV=1 16 381 8.0E-24
sp|B9LQI7|PELO_HALLT Protein pelota homolog OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=pelA PE=3 SV=1 15 381 1.0E-23
sp|O59148|PELO_PYRHO Protein pelota homolog OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pelA PE=3 SV=1 13 381 1.0E-23
sp|B8GIR5|PELO_METPE Protein pelota homolog OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=pelA PE=3 SV=1 16 381 2.0E-23
sp|Q6M133|PELO_METMP Protein pelota homolog OS=Methanococcus maripaludis (strain S2 / LL) GN=pelA PE=3 SV=1 13 381 3.0E-23
sp|A6UR75|PELO_METVS Protein pelota homolog OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pelA PE=3 SV=1 13 381 5.0E-23
sp|Q12W71|PELO_METBU Protein pelota homolog OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=pelA PE=3 SV=1 14 381 5.0E-23
sp|A6UUY1|PELO_META3 Protein pelota homolog OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=pelA PE=3 SV=1 13 381 6.0E-23
sp|Q5V3G6|PELO_HALMA Protein pelota homolog OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=pelA PE=3 SV=1 15 381 9.0E-23
sp|Q8PVZ0|PELO_METMA Protein pelota homolog OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pelA PE=3 SV=1 14 381 1.0E-21
sp|O29421|PELO_ARCFU Protein pelota homolog OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pelA PE=1 SV=1 14 379 1.0E-21
sp|Q46C69|PELO_METBF Protein pelota homolog OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=pelA PE=3 SV=1 14 381 2.0E-21
sp|Q8U150|PELO_PYRFU Protein pelota homolog OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pelA PE=3 SV=1 14 381 1.0E-20
sp|Q9HPR5|PELO_HALSA Protein pelota homolog OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pelA PE=3 SV=1 15 381 1.0E-20
sp|B0R5R9|PELO_HALS3 Protein pelota homolog OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=pelA PE=3 SV=1 15 381 1.0E-20
sp|Q8TSZ1|PELO_METAC Protein pelota homolog OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pelA PE=3 SV=1 14 381 1.0E-20
sp|A2SQV7|PELO_METLZ Protein pelota homolog OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=pelA PE=3 SV=1 16 381 1.0E-20
sp|Q3INN9|PELO_NATPD Protein pelota homolog OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=pelA PE=3 SV=1 1 381 2.0E-20
sp|Q18J81|PELO_HALWD Protein pelota homolog OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=pelA PE=3 SV=1 15 381 3.0E-19
sp|A8A935|PELO_IGNH4 Protein pelota homolog OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=pelA PE=3 SV=1 6 381 1.0E-15
sp|Q9HJ74|PELO_THEAC Protein pelota homolog OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=pelA PE=1 SV=1 6 379 2.0E-15
sp|Q9YAZ5|PELO_AERPE Protein pelota homolog OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pelA PE=1 SV=2 6 381 4.0E-13
sp|A4YIP3|PELO_METS5 Protein pelota homolog OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=pelA PE=3 SV=1 22 379 2.0E-11
sp|B8D691|PELO_DESK1 Protein pelota homolog OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=pelA PE=3 SV=1 6 382 7.0E-11
sp|A2BL82|PELO_HYPBU Protein pelota homolog OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=pelA PE=3 SV=1 6 136 1.0E-10
sp|C3N8Q8|PELO_SULIY Protein pelota homolog OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=pelA PE=3 SV=1 6 379 1.0E-10
sp|C3NMR0|PELO_SULIN Protein pelota homolog OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=pelA PE=3 SV=1 6 379 1.0E-10
sp|C3MJN7|PELO_SULIL Protein pelota homolog OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=pelA PE=3 SV=1 6 379 1.0E-10
sp|C3MYZ5|PELO_SULIM Protein pelota homolog OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=pelA PE=3 SV=1 6 379 2.0E-10
sp|C4KJ83|PELO_SULIK Protein pelota homolog OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=pelA PE=3 SV=1 6 379 2.0E-10
sp|C3N044|PELO_SULIA Protein pelota homolog OS=Sulfolobus islandicus (strain M.16.27) GN=pelA PE=3 SV=1 6 379 6.0E-10
sp|P96026|PELO_SULSO Protein pelota homolog OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pelA PE=1 SV=1 6 379 1.0E-09
sp|Q4JCI0|PELO_SULAC Protein pelota homolog OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=pelA PE=3 SV=1 22 379 3.0E-09
sp|Q6L2M8|PELO_PICTO Protein pelota homolog OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=pelA PE=3 SV=1 8 381 1.0E-08
sp|Q97BJ3|PELO_THEVO Protein pelota homolog OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=pelA PE=3 SV=1 16 381 2.0E-08
sp|A0RWD1|PELO_CENSY Protein pelota homolog OS=Cenarchaeum symbiosum (strain A) GN=pelA PE=3 SV=1 12 128 2.0E-06
sp|A3MX13|PELO_PYRCJ Protein pelota homolog OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=pelA PE=3 SV=1 11 379 2.0E-06
sp|B1Y9M9|PELO_PYRNV Protein pelota homolog OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=pelA PE=3 SV=1 11 379 2.0E-06
sp|Q96VH2|YC01B_YEAST Putative pelota-like protein YCL001W-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCL001W-B PE=3 SV=1 285 359 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8129
MKLVARTVATDVEEQQVSLLPEDPEDMWHAYNLIVPGDLVNAHAVRKVVSVNVGTNASSAERVHTDLTICVKSTF
FDPAVSSLRVSGVVAAENDHVARGAHHTLDLEVNRTFTIIKPDLDGSGGWDSVCKDTLAQALSDDKDGAMAAVVM
NEGLANICLITRFRTVLKTRVESVVPKKRDTTAEQDAGMRRFFDKTLASLLRALDFSASRPLLLASPGFVASGFK
DYIARQGRDKSDKVLIAVAKQATVVHANSGHVHSLNEVLRSPEVLAKMRDMNYAKEAQYMDNLFDMLKLDDGRAW
YGSKAVEKAVAEGAVGPGGGVLLVNNSLFRSHDLTTRKKYVALVDKVKADGGEARILSSDHESGQRLKMLGDIAA
ILNYPMLDLDDDDEEQDVDIGKTRDGDTRHEQDETMLESII*
Coding >OphauB2|8129
ATGAAGCTGGTGGCACGAACCGTGGCGACCGATGTGGAGGAGCAGCAAGTGTCTCTGCTACCCGAGGACCCGGAA
GACATGTGGCATGCCTATAACCTCATAGTTCCTGGGGATCTTGTCAATGCCCATGCCGTCCGCAAAGTCGTGTCT
GTCAATGTCGGCACCAACGCGTCCTCGGCAGAACGCGTCCATACAGATCTGACGATTTGCGTCAAGTCGACCTTT
TTCGACCCGGCAGTGTCGTCCCTGCGTGTTTCCGGAGTGGTGGCAGCTGAAAATGACCATGTCGCCCGCGGTGCC
CATCACACTCTGGATCTCGAAGTCAATCGCACCTTTACCATCATCAAGCCAGACCTTGATGGTAGCGGTGGCTGG
GATTCGGTCTGCAAGGACACTCTTGCCCAAGCCTTGTCAGACGACAAGGACGGCGCCATGGCGGCCGTTGTCATG
AATGAGGGCCTAGCAAACATCTGTCTCATTACCCGGTTTCGGACGGTGCTCAAAACACGAGTCGAGAGCGTCGTG
CCCAAGAAGCGAGACACCACGGCCGAGCAGGATGCCGGTATGCGCCGCTTCTTCGACAAGACTCTGGCCTCGTTG
CTTCGCGCACTAGACTTCTCTGCATCGCGGCCCCTGCTACTCGCGAGCCCGGGCTTCGTTGCGTCTGGCTTCAAG
GACTATATAGCACGCCAAGGACGCGACAAGTCTGACAAGGTGCTCATTGCTGTAGCCAAGCAGGCAACAGTTGTG
CACGCCAATTCAGGCCACGTGCACAGCCTCAATGAGGTACTCCGCAGCCCTGAAGTACTGGCAAAGATGCGCGAC
ATGAATTATGCAAAAGAGGCTCAGTACATGGATAACTTGTTTGACATGCTCAAGCTGGACGATGGACGTGCGTGG
TATGGATCCAAAGCAGTGGAAAAGGCGGTGGCCGAGGGTGCCGTCGGCCCCGGCGGTGGTGTGCTGCTCGTCAAC
AACTCCCTATTCCGCAGCCATGACTTGACGACGCGCAAAAAGTATGTGGCCCTTGTCGACAAGGTCAAGGCCGAC
GGCGGGGAAGCGCGCATCCTCAGCAGCGATCATGAAAGTGGGCAACGACTCAAGATGCTGGGCGACATTGCCGCC
ATCCTAAACTATCCAATGCTTGATCTTGATGATGACGATGAAGAGCAAGATGTGGACATAGGAAAGACTCGAGAC
GGTGACACAAGACACGAACAAGACGAGACGATGCTTGAGAGTATTATCTGA
Transcript >OphauB2|8129
ATGAAGCTGGTGGCACGAACCGTGGCGACCGATGTGGAGGAGCAGCAAGTGTCTCTGCTACCCGAGGACCCGGAA
GACATGTGGCATGCCTATAACCTCATAGTTCCTGGGGATCTTGTCAATGCCCATGCCGTCCGCAAAGTCGTGTCT
GTCAATGTCGGCACCAACGCGTCCTCGGCAGAACGCGTCCATACAGATCTGACGATTTGCGTCAAGTCGACCTTT
TTCGACCCGGCAGTGTCGTCCCTGCGTGTTTCCGGAGTGGTGGCAGCTGAAAATGACCATGTCGCCCGCGGTGCC
CATCACACTCTGGATCTCGAAGTCAATCGCACCTTTACCATCATCAAGCCAGACCTTGATGGTAGCGGTGGCTGG
GATTCGGTCTGCAAGGACACTCTTGCCCAAGCCTTGTCAGACGACAAGGACGGCGCCATGGCGGCCGTTGTCATG
AATGAGGGCCTAGCAAACATCTGTCTCATTACCCGGTTTCGGACGGTGCTCAAAACACGAGTCGAGAGCGTCGTG
CCCAAGAAGCGAGACACCACGGCCGAGCAGGATGCCGGTATGCGCCGCTTCTTCGACAAGACTCTGGCCTCGTTG
CTTCGCGCACTAGACTTCTCTGCATCGCGGCCCCTGCTACTCGCGAGCCCGGGCTTCGTTGCGTCTGGCTTCAAG
GACTATATAGCACGCCAAGGACGCGACAAGTCTGACAAGGTGCTCATTGCTGTAGCCAAGCAGGCAACAGTTGTG
CACGCCAATTCAGGCCACGTGCACAGCCTCAATGAGGTACTCCGCAGCCCTGAAGTACTGGCAAAGATGCGCGAC
ATGAATTATGCAAAAGAGGCTCAGTACATGGATAACTTGTTTGACATGCTCAAGCTGGACGATGGACGTGCGTGG
TATGGATCCAAAGCAGTGGAAAAGGCGGTGGCCGAGGGTGCCGTCGGCCCCGGCGGTGGTGTGCTGCTCGTCAAC
AACTCCCTATTCCGCAGCCATGACTTGACGACGCGCAAAAAGTATGTGGCCCTTGTCGACAAGGTCAAGGCCGAC
GGCGGGGAAGCGCGCATCCTCAGCAGCGATCATGAAAGTGGGCAACGACTCAAGATGCTGGGCGACATTGCCGCC
ATCCTAAACTATCCAATGCTTGATCTTGATGATGACGATGAAGAGCAAGATGTGGACATAGGAAAGACTCGAGAC
GGTGACACAAGACACGAACAAGACGAGACGATGCTTGAGAGTATTATCTGA
Gene >OphauB2|8129
ATGAAGCTGGTGGCACGAACCGTGGCGACCGATGTGGAGGAGCAGCAAGTGTCTCTGCTACCCGAGGACCCGGAA
GACATGGTTAGTTAGTATACCAAGCCAGCTCTGGCCATGGAGTATTCGGGCTGACGACATGGCAAGTGGCATGCC
TATAACCTCATAGTTCCTGGGGATCTTGTCAATGCCCATGCCGTCCGCAAAGTCGTGTCTGTCAATGTCGGCACC
AACGCGTCCTCGGCAGAACGCGTCCATACAGATCTGACGATTTGCGTCAAGTCGACCTTTTTCGACCCGGCAGTG
TCGTCCCTGCGTGTTTCCGGAGTGGTGGCAGCTGAAAATGACCATGTCGCCCGCGGTGCCCATCACACTCTGGAT
CTCGAAGTCAATCGCACCTTTACCATCATCAAGCCAGACCTTGATGGTAGCGGTGGCTGGGATTCGGTCTGCAAG
GACACTCTTGCCCAAGCCTTGTCAGACGACAAGGACGGCGCCATGGCGGCCGTTGTCATGAATGAGGGCCTAGCA
AACATCTGTCTCATTACCCGGTTTCGGACGGTGCTCAAAACACGAGTCGAGAGCGTCGTGCCCAAGAAGCGAGAC
ACCACGGCCGAGCAGGATGCCGGTATGCGCCGCTTCTTCGACAAGACTCTGGCCTCGTTGCTTCGCGCACTAGAC
TTCTCTGCATCGCGGCCCCTGCTACTCGCGAGCCCGGGCTTCGTTGCGTCTGGCTTCAAGGACTATATAGCACGC
CAAGGACGCGACAAGTCTGACAAGGTGCTCATTGCTGTAGCCAAGCAGGCAACAGTTGTGCACGCCAATTCAGGC
CACGTGCACAGCCTCAATGAGGTACTCCGCAGCCCTGAAGTACTGGCAAAGATGCGCGACATGAATTATGCAAAA
GAGGCTCAGTACATGGATAACTTGTTTGACATGCTCAAGCTGGACGATGGACGTGCGTGGTATGGATCCAAAGCA
GTGGAAAAGGCGGTGGCCGAGGGTGCCGTCGGCCCCGGCGGTGGTGTGCTGCTCGTCAACAACTCCCTATTCCGC
AGCCATGACTTGACGACGCGCAAAAAGTATGTGGCCCTTGTCGACAAGGTCAAGGCCGACGGCGGGGAAGCGCGC
ATCCTCAGCAGCGATCATGAAAGTGGGCAACGACTCAAGATGCTGGGCGACATTGCCGCCATCCTAAACTATCCA
ATGCTTGATCTTGATGATGACGATGAAGAGCAAGATGTGGACATAGGAAAGACTCGAGACGGTGACACAAGACAC
GAACAAGACGAGACGATGCTTGAGAGTATTATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail