Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8129
Gene name
LocationContig_98:37845..39156
Strand-
Gene length (bp)1311
Transcript length (bp)1251
Coding sequence length (bp)1251
Protein length (aa) 417

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03463 eRF1_1 eRF1 domain 1 1.9E-38 1 136
PF03464 eRF1_2 eRF1 domain 2 3.5E-17 145 269
PF03465 eRF1_3 eRF1 domain 3 1.8E-16 278 381

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P48612|PELO_DROME Protein pelota OS=Drosophila melanogaster GN=pelo PE=2 SV=2 1 381 1.0E-92
sp|Q58DV0|PELO_BOVIN Protein pelota homolog OS=Bos taurus GN=PELO PE=2 SV=2 1 388 3.0E-92
sp|Q5XIP1|PELO_RAT Protein pelota homolog OS=Rattus norvegicus GN=Pelo PE=1 SV=1 1 390 3.0E-92
sp|Q5RCE3|PELO_PONAB Protein pelota homolog OS=Pongo abelii GN=PELO PE=2 SV=1 1 390 4.0E-92
sp|Q9USL5|DOM34_SCHPO Protein dom34 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dom34 PE=1 SV=1 1 381 4.0E-92
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P48612|PELO_DROME Protein pelota OS=Drosophila melanogaster GN=pelo PE=2 SV=2 1 381 1.0E-92
sp|Q58DV0|PELO_BOVIN Protein pelota homolog OS=Bos taurus GN=PELO PE=2 SV=2 1 388 3.0E-92
sp|Q5XIP1|PELO_RAT Protein pelota homolog OS=Rattus norvegicus GN=Pelo PE=1 SV=1 1 390 3.0E-92
sp|Q5RCE3|PELO_PONAB Protein pelota homolog OS=Pongo abelii GN=PELO PE=2 SV=1 1 390 4.0E-92
sp|Q9USL5|DOM34_SCHPO Protein dom34 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dom34 PE=1 SV=1 1 381 4.0E-92
sp|Q9BRX2|PELO_HUMAN Protein pelota homolog OS=Homo sapiens GN=PELO PE=1 SV=2 1 408 6.0E-92
sp|Q7ZWC4|PELO_DANRE Protein pelota homolog OS=Danio rerio GN=pelo PE=2 SV=1 1 394 9.0E-92
sp|Q80X73|PELO_MOUSE Protein pelota homolog OS=Mus musculus GN=Pelo PE=1 SV=3 1 390 9.0E-91
sp|Q5ZK01|PELO_CHICK Protein pelota homolog OS=Gallus gallus GN=PELO PE=2 SV=1 1 390 1.0E-89
sp|Q5U567|PELO_XENLA Protein pelota homolog OS=Xenopus laevis GN=pelo PE=2 SV=1 1 384 2.0E-87
sp|P50444|PELO_CAEEL Protein pelota homolog OS=Caenorhabditis elegans GN=R74.6 PE=3 SV=1 17 387 5.0E-74
sp|Q9ZT87|PEL1_ARATH Protein PELOTA 1 OS=Arabidopsis thaliana GN=PEL1 PE=2 SV=1 17 386 3.0E-73
sp|Q9M2H7|PEL2_ARATH Protein PELOTA 2 OS=Arabidopsis thaliana GN=PEL2 PE=3 SV=1 17 386 1.0E-65
sp|P33309|DOM34_YEAST Protein DOM34 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOM34 PE=1 SV=2 17 391 2.0E-56
sp|C5A5T8|PELO_THEGJ Protein pelota homolog OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pelA PE=3 SV=1 17 379 7.0E-34
sp|A5UKW7|PELO_METS3 Protein pelota homolog OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=pelA PE=3 SV=1 6 381 2.0E-33
sp|Q5JIB9|PELO_THEKO Protein pelota homolog OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pelA PE=1 SV=1 13 379 8.0E-33
sp|B6YUV3|PELO_THEON Protein pelota homolog OS=Thermococcus onnurineus (strain NA1) GN=pelA PE=3 SV=1 6 379 3.0E-32
sp|O27679|PELO_METTH Protein pelota homolog OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pelA PE=3 SV=2 6 381 2.0E-30
sp|Q57638|PELO_METJA Protein pelota homolog OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pelA PE=3 SV=1 17 381 7.0E-30
sp|Q8TZ98|PELO_METKA Protein pelota homolog OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pelA PE=3 SV=1 6 381 1.0E-29
sp|B1L659|PELO_KORCO Protein pelota homolog OS=Korarchaeum cryptofilum (strain OPF8) GN=pelA PE=3 SV=1 6 379 3.0E-29
sp|Q0W6H4|PELO_METAR Protein pelota homolog OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=pelA PE=3 SV=1 16 381 1.0E-26
sp|A4G0A4|PELO_METM5 Protein pelota homolog OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pelA PE=3 SV=1 13 381 4.0E-25
sp|Q2NFD9|PELO_METST Protein pelota homolog OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=pelA PE=3 SV=1 6 381 5.0E-25
sp|A0B6U3|PELO_METTP Protein pelota homolog OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=pelA PE=3 SV=2 1 379 5.0E-25
sp|A3CU20|PELO_METMJ Protein pelota homolog OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pelA PE=3 SV=1 16 381 7.0E-25
sp|A9A8K6|PELO_METM6 Protein pelota homolog OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=pelA PE=3 SV=1 13 381 2.0E-24
sp|A6VI74|PELO_METM7 Protein pelota homolog OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pelA PE=3 SV=1 13 381 5.0E-24
sp|A3DMX7|PELO_STAMF Protein pelota homolog OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=pelA PE=3 SV=1 6 381 5.0E-24
sp|A7I7Y6|PELO_METB6 Protein pelota homolog OS=Methanoregula boonei (strain 6A8) GN=pelA PE=3 SV=1 16 381 6.0E-24
sp|Q9V0V3|PELO_PYRAB Protein pelota homolog OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pelA PE=3 SV=1 13 381 8.0E-24
sp|Q2FQH4|PELO_METHJ Protein pelota homolog OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pelA PE=3 SV=1 16 381 8.0E-24
sp|B9LQI7|PELO_HALLT Protein pelota homolog OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=pelA PE=3 SV=1 15 381 1.0E-23
sp|O59148|PELO_PYRHO Protein pelota homolog OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pelA PE=3 SV=1 13 381 1.0E-23
sp|B8GIR5|PELO_METPE Protein pelota homolog OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=pelA PE=3 SV=1 16 381 2.0E-23
sp|Q6M133|PELO_METMP Protein pelota homolog OS=Methanococcus maripaludis (strain S2 / LL) GN=pelA PE=3 SV=1 13 381 3.0E-23
sp|A6UR75|PELO_METVS Protein pelota homolog OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pelA PE=3 SV=1 13 381 5.0E-23
sp|Q12W71|PELO_METBU Protein pelota homolog OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=pelA PE=3 SV=1 14 381 5.0E-23
sp|A6UUY1|PELO_META3 Protein pelota homolog OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=pelA PE=3 SV=1 13 381 6.0E-23
sp|Q5V3G6|PELO_HALMA Protein pelota homolog OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=pelA PE=3 SV=1 15 381 9.0E-23
sp|Q8PVZ0|PELO_METMA Protein pelota homolog OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pelA PE=3 SV=1 14 381 1.0E-21
sp|O29421|PELO_ARCFU Protein pelota homolog OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pelA PE=1 SV=1 14 379 1.0E-21
sp|Q46C69|PELO_METBF Protein pelota homolog OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=pelA PE=3 SV=1 14 381 2.0E-21
sp|Q8U150|PELO_PYRFU Protein pelota homolog OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pelA PE=3 SV=1 14 381 1.0E-20
sp|Q9HPR5|PELO_HALSA Protein pelota homolog OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pelA PE=3 SV=1 15 381 1.0E-20
sp|B0R5R9|PELO_HALS3 Protein pelota homolog OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=pelA PE=3 SV=1 15 381 1.0E-20
sp|Q8TSZ1|PELO_METAC Protein pelota homolog OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pelA PE=3 SV=1 14 381 1.0E-20
sp|A2SQV7|PELO_METLZ Protein pelota homolog OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=pelA PE=3 SV=1 16 381 1.0E-20
sp|Q3INN9|PELO_NATPD Protein pelota homolog OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=pelA PE=3 SV=1 1 381 2.0E-20
sp|Q18J81|PELO_HALWD Protein pelota homolog OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=pelA PE=3 SV=1 15 381 3.0E-19
sp|A8A935|PELO_IGNH4 Protein pelota homolog OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=pelA PE=3 SV=1 6 381 1.0E-15
sp|Q9HJ74|PELO_THEAC Protein pelota homolog OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=pelA PE=1 SV=1 6 379 2.0E-15
sp|Q9YAZ5|PELO_AERPE Protein pelota homolog OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pelA PE=1 SV=2 6 381 4.0E-13
sp|A4YIP3|PELO_METS5 Protein pelota homolog OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=pelA PE=3 SV=1 22 379 2.0E-11
sp|B8D691|PELO_DESK1 Protein pelota homolog OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=pelA PE=3 SV=1 6 382 7.0E-11
sp|A2BL82|PELO_HYPBU Protein pelota homolog OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=pelA PE=3 SV=1 6 136 1.0E-10
sp|C3N8Q8|PELO_SULIY Protein pelota homolog OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=pelA PE=3 SV=1 6 379 1.0E-10
sp|C3NMR0|PELO_SULIN Protein pelota homolog OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=pelA PE=3 SV=1 6 379 1.0E-10
sp|C3MJN7|PELO_SULIL Protein pelota homolog OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=pelA PE=3 SV=1 6 379 1.0E-10
sp|C3MYZ5|PELO_SULIM Protein pelota homolog OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=pelA PE=3 SV=1 6 379 2.0E-10
sp|C4KJ83|PELO_SULIK Protein pelota homolog OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=pelA PE=3 SV=1 6 379 2.0E-10
sp|C3N044|PELO_SULIA Protein pelota homolog OS=Sulfolobus islandicus (strain M.16.27) GN=pelA PE=3 SV=1 6 379 6.0E-10
sp|P96026|PELO_SULSO Protein pelota homolog OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pelA PE=1 SV=1 6 379 1.0E-09
sp|Q4JCI0|PELO_SULAC Protein pelota homolog OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=pelA PE=3 SV=1 22 379 3.0E-09
sp|Q6L2M8|PELO_PICTO Protein pelota homolog OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=pelA PE=3 SV=1 8 381 1.0E-08
sp|Q97BJ3|PELO_THEVO Protein pelota homolog OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=pelA PE=3 SV=1 16 381 2.0E-08
sp|A0RWD1|PELO_CENSY Protein pelota homolog OS=Cenarchaeum symbiosum (strain A) GN=pelA PE=3 SV=1 12 128 2.0E-06
sp|A3MX13|PELO_PYRCJ Protein pelota homolog OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=pelA PE=3 SV=1 11 379 2.0E-06
sp|B1Y9M9|PELO_PYRNV Protein pelota homolog OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=pelA PE=3 SV=1 11 379 2.0E-06
sp|Q96VH2|YC01B_YEAST Putative pelota-like protein YCL001W-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCL001W-B PE=3 SV=1 285 359 8.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5522
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|846
Ophiocordyceps australis map64 (Brazil) OphauB2|8129 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01677
Ophiocordyceps camponoti-rufipedis Ophun1|5411
Ophiocordyceps kimflemingae Ophio5|4498
Ophiocordyceps subramaniannii Hirsu2|6828

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8129
MKLVARTVATDVEEQQVSLLPEDPEDMWHAYNLIVPGDLVNAHAVRKVVSVNVGTNASSAERVHTDLTICVKSTF
FDPAVSSLRVSGVVAAENDHVARGAHHTLDLEVNRTFTIIKPDLDGSGGWDSVCKDTLAQALSDDKDGAMAAVVM
NEGLANICLITRFRTVLKTRVESVVPKKRDTTAEQDAGMRRFFDKTLASLLRALDFSASRPLLLASPGFVASGFK
DYIARQGRDKSDKVLIAVAKQATVVHANSGHVHSLNEVLRSPEVLAKMRDMNYAKEAQYMDNLFDMLKLDDGRAW
YGSKAVEKAVAEGAVGPGGGVLLVNNSLFRSHDLTTRKKYVALVDKVKADGGEARILSSDHESGQRLKMLGDIAA
ILNYPMLDLDDDDEEQDVDIGKTRDGDTRHEQDETMLESII*
Coding >OphauB2|8129
ATGAAGCTGGTGGCACGAACCGTGGCGACCGATGTGGAGGAGCAGCAAGTGTCTCTGCTACCCGAGGACCCGGAA
GACATGTGGCATGCCTATAACCTCATAGTTCCTGGGGATCTTGTCAATGCCCATGCCGTCCGCAAAGTCGTGTCT
GTCAATGTCGGCACCAACGCGTCCTCGGCAGAACGCGTCCATACAGATCTGACGATTTGCGTCAAGTCGACCTTT
TTCGACCCGGCAGTGTCGTCCCTGCGTGTTTCCGGAGTGGTGGCAGCTGAAAATGACCATGTCGCCCGCGGTGCC
CATCACACTCTGGATCTCGAAGTCAATCGCACCTTTACCATCATCAAGCCAGACCTTGATGGTAGCGGTGGCTGG
GATTCGGTCTGCAAGGACACTCTTGCCCAAGCCTTGTCAGACGACAAGGACGGCGCCATGGCGGCCGTTGTCATG
AATGAGGGCCTAGCAAACATCTGTCTCATTACCCGGTTTCGGACGGTGCTCAAAACACGAGTCGAGAGCGTCGTG
CCCAAGAAGCGAGACACCACGGCCGAGCAGGATGCCGGTATGCGCCGCTTCTTCGACAAGACTCTGGCCTCGTTG
CTTCGCGCACTAGACTTCTCTGCATCGCGGCCCCTGCTACTCGCGAGCCCGGGCTTCGTTGCGTCTGGCTTCAAG
GACTATATAGCACGCCAAGGACGCGACAAGTCTGACAAGGTGCTCATTGCTGTAGCCAAGCAGGCAACAGTTGTG
CACGCCAATTCAGGCCACGTGCACAGCCTCAATGAGGTACTCCGCAGCCCTGAAGTACTGGCAAAGATGCGCGAC
ATGAATTATGCAAAAGAGGCTCAGTACATGGATAACTTGTTTGACATGCTCAAGCTGGACGATGGACGTGCGTGG
TATGGATCCAAAGCAGTGGAAAAGGCGGTGGCCGAGGGTGCCGTCGGCCCCGGCGGTGGTGTGCTGCTCGTCAAC
AACTCCCTATTCCGCAGCCATGACTTGACGACGCGCAAAAAGTATGTGGCCCTTGTCGACAAGGTCAAGGCCGAC
GGCGGGGAAGCGCGCATCCTCAGCAGCGATCATGAAAGTGGGCAACGACTCAAGATGCTGGGCGACATTGCCGCC
ATCCTAAACTATCCAATGCTTGATCTTGATGATGACGATGAAGAGCAAGATGTGGACATAGGAAAGACTCGAGAC
GGTGACACAAGACACGAACAAGACGAGACGATGCTTGAGAGTATTATCTGA
Transcript >OphauB2|8129
ATGAAGCTGGTGGCACGAACCGTGGCGACCGATGTGGAGGAGCAGCAAGTGTCTCTGCTACCCGAGGACCCGGAA
GACATGTGGCATGCCTATAACCTCATAGTTCCTGGGGATCTTGTCAATGCCCATGCCGTCCGCAAAGTCGTGTCT
GTCAATGTCGGCACCAACGCGTCCTCGGCAGAACGCGTCCATACAGATCTGACGATTTGCGTCAAGTCGACCTTT
TTCGACCCGGCAGTGTCGTCCCTGCGTGTTTCCGGAGTGGTGGCAGCTGAAAATGACCATGTCGCCCGCGGTGCC
CATCACACTCTGGATCTCGAAGTCAATCGCACCTTTACCATCATCAAGCCAGACCTTGATGGTAGCGGTGGCTGG
GATTCGGTCTGCAAGGACACTCTTGCCCAAGCCTTGTCAGACGACAAGGACGGCGCCATGGCGGCCGTTGTCATG
AATGAGGGCCTAGCAAACATCTGTCTCATTACCCGGTTTCGGACGGTGCTCAAAACACGAGTCGAGAGCGTCGTG
CCCAAGAAGCGAGACACCACGGCCGAGCAGGATGCCGGTATGCGCCGCTTCTTCGACAAGACTCTGGCCTCGTTG
CTTCGCGCACTAGACTTCTCTGCATCGCGGCCCCTGCTACTCGCGAGCCCGGGCTTCGTTGCGTCTGGCTTCAAG
GACTATATAGCACGCCAAGGACGCGACAAGTCTGACAAGGTGCTCATTGCTGTAGCCAAGCAGGCAACAGTTGTG
CACGCCAATTCAGGCCACGTGCACAGCCTCAATGAGGTACTCCGCAGCCCTGAAGTACTGGCAAAGATGCGCGAC
ATGAATTATGCAAAAGAGGCTCAGTACATGGATAACTTGTTTGACATGCTCAAGCTGGACGATGGACGTGCGTGG
TATGGATCCAAAGCAGTGGAAAAGGCGGTGGCCGAGGGTGCCGTCGGCCCCGGCGGTGGTGTGCTGCTCGTCAAC
AACTCCCTATTCCGCAGCCATGACTTGACGACGCGCAAAAAGTATGTGGCCCTTGTCGACAAGGTCAAGGCCGAC
GGCGGGGAAGCGCGCATCCTCAGCAGCGATCATGAAAGTGGGCAACGACTCAAGATGCTGGGCGACATTGCCGCC
ATCCTAAACTATCCAATGCTTGATCTTGATGATGACGATGAAGAGCAAGATGTGGACATAGGAAAGACTCGAGAC
GGTGACACAAGACACGAACAAGACGAGACGATGCTTGAGAGTATTATCTGA
Gene >OphauB2|8129
ATGAAGCTGGTGGCACGAACCGTGGCGACCGATGTGGAGGAGCAGCAAGTGTCTCTGCTACCCGAGGACCCGGAA
GACATGGTTAGTTAGTATACCAAGCCAGCTCTGGCCATGGAGTATTCGGGCTGACGACATGGCAAGTGGCATGCC
TATAACCTCATAGTTCCTGGGGATCTTGTCAATGCCCATGCCGTCCGCAAAGTCGTGTCTGTCAATGTCGGCACC
AACGCGTCCTCGGCAGAACGCGTCCATACAGATCTGACGATTTGCGTCAAGTCGACCTTTTTCGACCCGGCAGTG
TCGTCCCTGCGTGTTTCCGGAGTGGTGGCAGCTGAAAATGACCATGTCGCCCGCGGTGCCCATCACACTCTGGAT
CTCGAAGTCAATCGCACCTTTACCATCATCAAGCCAGACCTTGATGGTAGCGGTGGCTGGGATTCGGTCTGCAAG
GACACTCTTGCCCAAGCCTTGTCAGACGACAAGGACGGCGCCATGGCGGCCGTTGTCATGAATGAGGGCCTAGCA
AACATCTGTCTCATTACCCGGTTTCGGACGGTGCTCAAAACACGAGTCGAGAGCGTCGTGCCCAAGAAGCGAGAC
ACCACGGCCGAGCAGGATGCCGGTATGCGCCGCTTCTTCGACAAGACTCTGGCCTCGTTGCTTCGCGCACTAGAC
TTCTCTGCATCGCGGCCCCTGCTACTCGCGAGCCCGGGCTTCGTTGCGTCTGGCTTCAAGGACTATATAGCACGC
CAAGGACGCGACAAGTCTGACAAGGTGCTCATTGCTGTAGCCAAGCAGGCAACAGTTGTGCACGCCAATTCAGGC
CACGTGCACAGCCTCAATGAGGTACTCCGCAGCCCTGAAGTACTGGCAAAGATGCGCGACATGAATTATGCAAAA
GAGGCTCAGTACATGGATAACTTGTTTGACATGCTCAAGCTGGACGATGGACGTGCGTGGTATGGATCCAAAGCA
GTGGAAAAGGCGGTGGCCGAGGGTGCCGTCGGCCCCGGCGGTGGTGTGCTGCTCGTCAACAACTCCCTATTCCGC
AGCCATGACTTGACGACGCGCAAAAAGTATGTGGCCCTTGTCGACAAGGTCAAGGCCGACGGCGGGGAAGCGCGC
ATCCTCAGCAGCGATCATGAAAGTGGGCAACGACTCAAGATGCTGGGCGACATTGCCGCCATCCTAAACTATCCA
ATGCTTGATCTTGATGATGACGATGAAGAGCAAGATGTGGACATAGGAAAGACTCGAGACGGTGACACAAGACAC
GAACAAGACGAGACGATGCTTGAGAGTATTATCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail