Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8117
Gene name
LocationContig_98:11875..12223
Strand+
Gene length (bp)348
Transcript length (bp)348
Coding sequence length (bp)348
Protein length (aa) 116

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 6.6E-22 7 102
PF04756 OST3_OST6 OST3 / OST6 family, transporter family 1.9E-06 30 87
PF14595 Thioredoxin_9 Thioredoxin 8.8E-06 19 103

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P29429|THIO_EMENI Thioredoxin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=TRX1 PE=1 SV=2 4 106 1.0E-23
sp|P25372|TRX3_YEAST Thioredoxin-3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX3 PE=1 SV=1 2 104 4.0E-23
sp|O14463|TRX1_SCHPO Thioredoxin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trx1 PE=3 SV=3 4 102 1.0E-21
sp|Q9USR1|TXL1_SCHPO Thioredoxin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=txl1 PE=3 SV=1 3 115 2.0E-21
sp|P22217|TRX1_YEAST Thioredoxin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX1 PE=1 SV=3 4 101 2.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P29429|THIO_EMENI Thioredoxin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=TRX1 PE=1 SV=2 4 106 1.0E-23
sp|P25372|TRX3_YEAST Thioredoxin-3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX3 PE=1 SV=1 2 104 4.0E-23
sp|O14463|TRX1_SCHPO Thioredoxin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trx1 PE=3 SV=3 4 102 1.0E-21
sp|Q9USR1|TXL1_SCHPO Thioredoxin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=txl1 PE=3 SV=1 3 115 2.0E-21
sp|P22217|TRX1_YEAST Thioredoxin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX1 PE=1 SV=3 4 101 2.0E-20
sp|P22803|TRX2_YEAST Thioredoxin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX2 PE=1 SV=3 4 101 8.0E-20
sp|Q9UW02|THIO_COPCM Thioredoxin OS=Coprinus comatus PE=1 SV=1 4 102 5.0E-19
sp|Q9AS75|TRH41_ORYSJ Thioredoxin H4-1 OS=Oryza sativa subsp. japonica GN=Os01g0168200 PE=2 SV=1 18 108 6.0E-19
sp|P34723|THIO_PENCH Thioredoxin OS=Penicillium chrysogenum GN=TRXA PE=1 SV=1 3 104 2.0E-18
sp|Q09433|THIO1_CAEEL Thioredoxin-1 OS=Caenorhabditis elegans GN=trx-1 PE=2 SV=1 10 101 2.0E-18
sp|Q38879|TRXH2_ARATH Thioredoxin H2 OS=Arabidopsis thaliana GN=TRX2 PE=2 SV=2 8 106 3.0E-18
sp|P08628|THIO_RABIT Thioredoxin OS=Oryctolagus cuniculus GN=TXN PE=1 SV=2 4 104 4.0E-18
sp|P29451|THIO_MACMU Thioredoxin OS=Macaca mulatta GN=TXN PE=3 SV=2 4 105 4.0E-18
sp|Q0DKF1|TRH42_ORYSJ Thioredoxin H4-2 OS=Oryza sativa subsp. japonica GN=Os05g0169000 PE=2 SV=1 12 105 5.0E-18
sp|Q7KQL8|THIO_PLAF7 Thioredoxin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0545 PE=1 SV=1 7 106 5.0E-18
sp|P10599|THIO_HUMAN Thioredoxin OS=Homo sapiens GN=TXN PE=1 SV=3 4 105 1.0E-17
sp|P42115|THIO_NEUCR Thioredoxin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=trx PE=3 SV=1 4 111 1.0E-17
sp|P08629|THIO_CHICK Thioredoxin OS=Gallus gallus GN=TXN PE=3 SV=2 23 105 2.0E-17
sp|O97508|THIO_HORSE Thioredoxin OS=Equus caballus GN=TXN PE=3 SV=3 4 104 2.0E-17
sp|P50413|THIO_SHEEP Thioredoxin OS=Ovis aries GN=TXN PE=3 SV=2 4 104 2.0E-17
sp|Q5R9M3|THIO_PONAB Thioredoxin OS=Pongo abelii GN=TXN PE=3 SV=3 4 105 3.0E-17
sp|O65049|TRXH_PICMA Thioredoxin H-type OS=Picea mariana GN=SB09 PE=2 SV=1 10 101 4.0E-17
sp|Q9C9Y6|TRXH9_ARATH Thioredoxin H9 OS=Arabidopsis thaliana GN=TRX9 PE=1 SV=1 7 101 5.0E-17
sp|Q7X8R5|TRXM2_ORYSJ Thioredoxin M2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os04g0530600 PE=2 SV=2 9 96 5.0E-17
sp|P82460|THIO_PIG Thioredoxin OS=Sus scrofa GN=TXN PE=1 SV=3 4 104 6.0E-17
sp|Q6XHI1|THIO2_DROYA Thioredoxin-2 OS=Drosophila yakuba GN=Trx-2 PE=3 SV=1 23 102 7.0E-17
sp|O97680|THIO_BOVIN Thioredoxin OS=Bos taurus GN=TXN PE=3 SV=3 4 104 8.0E-17
sp|Q6H7E4|TRXM1_ORYSJ Thioredoxin M1, chloroplastic OS=Oryza sativa subsp. japonica GN=Os02g0639900 PE=2 SV=1 9 96 2.0E-16
sp|Q9XIF4|TRXH7_ARATH Thioredoxin H7 OS=Arabidopsis thaliana GN=TRX7 PE=2 SV=1 4 102 2.0E-16
sp|Q9V429|THIO2_DROME Thioredoxin-2 OS=Drosophila melanogaster GN=Trx-2 PE=1 SV=2 23 102 4.0E-16
sp|Q9BDJ3|THIO_CALJA Thioredoxin OS=Callithrix jacchus GN=TXN PE=3 SV=3 4 105 5.0E-16
sp|Q98TX1|THIO_OPHHA Thioredoxin OS=Ophiophagus hannah GN=TXN PE=3 SV=3 23 102 5.0E-16
sp|Q9R6P9|THIO_MYCGA Thioredoxin OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=trxA PE=3 SV=2 7 96 6.0E-16
sp|P10639|THIO_MOUSE Thioredoxin OS=Mus musculus GN=Txn PE=1 SV=3 7 105 6.0E-16
sp|Q6ES52|TDX_ORYSJ TPR repeat-containing thioredoxin TDX OS=Oryza sativa subsp. japonica GN=Os09g0401200 PE=2 SV=1 23 111 6.0E-16
sp|P11232|THIO_RAT Thioredoxin OS=Rattus norvegicus GN=Txn PE=1 SV=2 7 105 7.0E-16
sp|P29447|THIO3_DICDI Thioredoxin-3 OS=Dictyostelium discoideum GN=trxC PE=3 SV=2 1 102 7.0E-16
sp|P07591|TRXM_SPIOL Thioredoxin M-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2 1 96 8.0E-16
sp|Q9DGI3|THIO_ICTPU Thioredoxin OS=Ictalurus punctatus GN=txn PE=3 SV=1 29 103 2.0E-15
sp|A2YIW7|TRXH_ORYSI Thioredoxin H-type OS=Oryza sativa subsp. indica GN=TRXH PE=1 SV=1 29 111 3.0E-15
sp|Q0D840|TRXH1_ORYSJ Thioredoxin H1 OS=Oryza sativa subsp. japonica GN=TRXH PE=1 SV=1 29 111 3.0E-15
sp|P47370|THIO_MYCGE Thioredoxin OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=trxA PE=3 SV=1 4 96 3.0E-15
sp|P50254|THIO_PYRYE Thioredoxin OS=Pyropia yezoensis GN=trxA PE=3 SV=1 1 96 4.0E-15
sp|P85801|TRXH_POPJC Thioredoxin H-type OS=Populus jackii PE=1 SV=1 7 101 4.0E-15
sp|Q9RD25|THIO2_STRCO Putative thioredoxin-2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxC PE=2 SV=1 1 108 5.0E-15
sp|Q6Z4I3|TRH21_ORYSJ Thioredoxin H2-1 OS=Oryza sativa subsp. japonica GN=Os07g0190800 PE=2 SV=1 2 101 1.0E-14
sp|Q851R5|TRH22_ORYSJ Thioredoxin H2-2 OS=Oryza sativa subsp. japonica GN=Os03g0800700 PE=2 SV=1 20 101 1.0E-14
sp|P51225|THIO_PORPU Thioredoxin OS=Porphyra purpurea GN=trxA PE=3 SV=1 1 96 1.0E-14
sp|P75512|THIO_MYCPN Thioredoxin OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=trxA PE=3 SV=1 4 94 2.0E-14
sp|O22022|THIO_CYAME Thioredoxin OS=Cyanidioschyzon merolae GN=trxA PE=3 SV=1 13 97 2.0E-14
sp|P29446|THIO2_DICDI Thioredoxin-2 (Fragment) OS=Dictyostelium discoideum GN=trxB PE=2 SV=1 1 87 3.0E-14
sp|P23400|TRXM_CHLRE Thioredoxin M-type, chloroplastic OS=Chlamydomonas reinhardtii GN=TRXM PE=1 SV=3 13 94 8.0E-14
sp|P29445|THIO1_DICDI Thioredoxin-1 OS=Dictyostelium discoideum GN=trxA PE=1 SV=1 4 102 8.0E-14
sp|P33791|THIO_STRAU Thioredoxin (Fragment) OS=Streptomyces aureofaciens GN=trxA PE=3 SV=1 16 94 9.0E-14
sp|O96952|THIO_GEOCY Thioredoxin OS=Geodia cydonium GN=THIO PE=3 SV=1 7 102 1.0E-13
sp|Q54KN7|THIO5_DICDI Putative thioredoxin-5 OS=Dictyostelium discoideum GN=trxE PE=3 SV=1 8 104 1.0E-13
sp|Q8VWG7|TDX_ARATH TPR repeat-containing thioredoxin TDX OS=Arabidopsis thaliana GN=TDX PE=1 SV=1 29 101 2.0E-13
sp|P37395|THIO_CYACA Thioredoxin OS=Cyanidium caldarium GN=trxA PE=3 SV=1 23 96 2.0E-13
sp|Q9SEU6|TRXM4_ARATH Thioredoxin M4, chloroplastic OS=Arabidopsis thaliana GN=At3g15360 PE=2 SV=2 12 102 3.0E-13
sp|O17486|THIO_ECHGR Thioredoxin OS=Echinococcus granulosus GN=TRX PE=3 SV=2 13 102 3.0E-13
sp|P00275|THIO1_CORNE Thioredoxin C-1 OS=Corynebacterium nephridii PE=1 SV=1 15 96 3.0E-13
sp|Q8TFM8|THIO_FUSCU Thioredoxin-like protein OS=Fusarium culmorum PE=1 SV=1 4 108 4.0E-13
sp|P48384|TRXM_PEA Thioredoxin M-type, chloroplastic OS=Pisum sativum PE=2 SV=1 29 94 5.0E-13
sp|P0A4L2|THIO1_NOSSO Thioredoxin-1 OS=Nostoc sp. (strain ATCC 29151 / PCC 7119) GN=trxA PE=1 SV=2 1 94 5.0E-13
sp|P0A4L1|THIO1_NOSS1 Thioredoxin-1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trxA PE=3 SV=2 1 94 5.0E-13
sp|Q6P902|TXND2_MOUSE Thioredoxin domain-containing protein 2 OS=Mus musculus GN=Txndc2 PE=1 SV=1 7 104 5.0E-13
sp|P12243|THIO1_SYNE7 Thioredoxin-1 OS=Synechococcus elongatus (strain PCC 7942) GN=trxA PE=3 SV=2 29 94 7.0E-13
sp|O64394|TRXH_WHEAT Thioredoxin H-type OS=Triticum aestivum PE=2 SV=3 12 97 9.0E-13
sp|Q43636|TRXH_RICCO Thioredoxin H-type OS=Ricinus communis PE=3 SV=1 29 110 1.0E-12
sp|Q7M1B9|THIO_CHLAA Thioredoxin OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=trxA PE=1 SV=3 14 103 1.0E-12
sp|P29449|TRXH1_TOBAC Thioredoxin H-type 1 OS=Nicotiana tabacum PE=2 SV=1 13 108 1.0E-12
sp|Q9ZP20|TRXM5_ORYSJ Thioredoxin M5, chloroplastic OS=Oryza sativa subsp. japonica GN=TRXM PE=2 SV=1 23 94 1.0E-12
sp|Q9ZP21|TRXM_WHEAT Thioredoxin M-type, chloroplastic OS=Triticum aestivum PE=2 SV=1 23 94 1.0E-12
sp|Q5XHX6|TXND2_RAT Thioredoxin domain-containing protein 2 OS=Rattus norvegicus GN=Txndc2 PE=1 SV=2 7 104 1.0E-12
sp|Q75GM1|TRXH5_ORYSJ Thioredoxin H5 OS=Oryza sativa subsp. japonica GN=Os05g0480200 PE=2 SV=1 4 104 1.0E-12
sp|Q17424|THIO2_CAEEL Probable thioredoxin-2 OS=Caenorhabditis elegans GN=trx-2 PE=3 SV=2 2 106 1.0E-12
sp|P10472|THIO_CHLTI Thioredoxin OS=Chlorobaculum thiosulfatiphilum GN=trxA PE=1 SV=5 9 97 2.0E-12
sp|Q69AB2|TXND8_MOUSE Thioredoxin domain-containing protein 8 OS=Mus musculus GN=Txndc8 PE=1 SV=1 4 87 2.0E-12
sp|Q41864|TRXM_MAIZE Thioredoxin M-type, chloroplastic OS=Zea mays GN=TRM1 PE=2 SV=1 23 96 3.0E-12
sp|P52231|THIO_SYNY3 Thioredoxin OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trxA PE=1 SV=3 1 94 3.0E-12
sp|Q5XJ54|GLRX3_DANRE Glutaredoxin 3 OS=Danio rerio GN=glrx3 PE=2 SV=1 1 104 3.0E-12
sp|O48737|TRXM1_ARATH Thioredoxin M1, chloroplastic OS=Arabidopsis thaliana GN=At1g03680 PE=2 SV=1 16 92 4.0E-12
sp|Q69AB1|TXND8_RAT Thioredoxin domain-containing protein 8 OS=Rattus norvegicus GN=Txndc8 PE=2 SV=1 4 87 4.0E-12
sp|Q07090|TRXH2_TOBAC Thioredoxin H-type 2 OS=Nicotiana tabacum PE=3 SV=1 17 115 4.0E-12
sp|P29448|TRXH1_ARATH Thioredoxin H1 OS=Arabidopsis thaliana GN=TRX1 PE=1 SV=1 9 101 5.0E-12
sp|Q8L7S9|TRXY2_ARATH Thioredoxin Y2, chloroplastic OS=Arabidopsis thaliana GN=At1g43560 PE=2 SV=1 8 94 5.0E-12
sp|P50338|THIO_GRIPA Thioredoxin OS=Griffithsia pacifica GN=trxA PE=3 SV=2 14 94 5.0E-12
sp|P0AA30|THIO_SHIFL Thioredoxin-1 OS=Shigella flexneri GN=trxA PE=3 SV=2 15 92 5.0E-12
sp|P0AA28|THIO_SALTY Thioredoxin-1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=trxA PE=3 SV=2 15 92 5.0E-12
sp|P0AA29|THIO_SALTI Thioredoxin-1 OS=Salmonella typhi GN=trxA PE=3 SV=2 15 92 5.0E-12
sp|P0AA25|THIO_ECOLI Thioredoxin-1 OS=Escherichia coli (strain K12) GN=trxA PE=1 SV=2 15 92 5.0E-12
sp|P0AA26|THIO_ECOL6 Thioredoxin-1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trxA PE=3 SV=2 15 92 5.0E-12
sp|P0AA27|THIO_ECO57 Thioredoxin-1 OS=Escherichia coli O157:H7 GN=trxA PE=1 SV=2 15 92 5.0E-12
sp|Q1ZXE0|THIO4_DICDI Putative thioredoxin-4 OS=Dictyostelium discoideum GN=trxD PE=3 SV=2 1 104 6.0E-12
sp|P68176|TRXH_BRAOL Thioredoxin H-type OS=Brassica oleracea GN=BOPC17 PE=2 SV=1 20 98 6.0E-12
sp|P68177|TRXH1_BRANA Thioredoxin H-type 1 OS=Brassica napus GN=THL-1 PE=2 SV=1 20 98 6.0E-12
sp|O64432|TRXH_BRACM Thioredoxin H-type OS=Brassica campestris GN=PEC-2 PE=2 SV=1 20 98 1.0E-11
sp|P08058|THIO_RHOSH Thioredoxin OS=Rhodobacter sphaeroides GN=trxA PE=1 SV=3 4 94 1.0E-11
sp|Q39239|TRXH4_ARATH Thioredoxin H4 OS=Arabidopsis thaliana GN=TRX4 PE=3 SV=2 11 101 1.0E-11
sp|Q39241|TRXH5_ARATH Thioredoxin H5 OS=Arabidopsis thaliana GN=TRX5 PE=1 SV=1 29 102 1.0E-11
sp|P9WG67|THIO_MYCTU Thioredoxin OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=trxA PE=1 SV=1 15 92 2.0E-11
sp|P9WG66|THIO_MYCTO Thioredoxin OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=trxA PE=3 SV=1 15 92 2.0E-11
sp|P0A617|THIO_MYCBO Thioredoxin OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=trxA PE=3 SV=2 15 92 2.0E-11
sp|Q9CAS1|TRXH8_ARATH Thioredoxin H8 OS=Arabidopsis thaliana GN=TRX8 PE=2 SV=1 4 101 2.0E-11
sp|Q9TW67|NGLY1_CAEEL Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Caenorhabditis elegans GN=png-1 PE=1 SV=1 4 102 2.0E-11
sp|Q96419|TRXH_FAGES Thioredoxin H-type OS=Fagopyrum esculentum PE=3 SV=1 29 97 2.0E-11
sp|O48897|TRXF_BRANA Thioredoxin F-type, chloroplastic OS=Brassica napus GN=TRXF PE=2 SV=1 23 112 2.0E-11
sp|O81332|TRXF_MESCR Thioredoxin F-type, chloroplastic OS=Mesembryanthemum crystallinum PE=2 SV=1 19 92 3.0E-11
sp|Q6NPF9|TRXY1_ARATH Thioredoxin Y1, chloroplastic OS=Arabidopsis thaliana GN=At1g76760 PE=2 SV=1 13 92 3.0E-11
sp|Q9XGS0|TRXM_BRANA Thioredoxin M-type, chloroplastic OS=Brassica napus PE=1 SV=1 13 94 3.0E-11
sp|Q8GXV2|CXXS2_ARATH Thioredoxin-like protein CXXS2 OS=Arabidopsis thaliana GN=CXXS2 PE=2 SV=1 29 99 3.0E-11
sp|Q9SEU8|TRXM2_ARATH Thioredoxin M2, chloroplastic OS=Arabidopsis thaliana GN=At4g03520 PE=1 SV=2 23 94 3.0E-11
sp|Q655X0|TRXO_ORYSJ Thioredoxin O, mitochondrial OS=Oryza sativa subsp. japonica GN=Os06g0665900 PE=2 SV=2 3 104 4.0E-11
sp|P0AGG7|THIO2_SHIFL Thioredoxin-2 OS=Shigella flexneri GN=trxC PE=3 SV=1 9 94 4.0E-11
sp|P0AGG4|THIO2_ECOLI Thioredoxin-2 OS=Escherichia coli (strain K12) GN=trxC PE=1 SV=1 9 94 4.0E-11
sp|P0AGG5|THIO2_ECOL6 Thioredoxin-2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trxC PE=3 SV=1 9 94 4.0E-11
sp|P0AGG6|THIO2_ECO57 Thioredoxin-2 OS=Escherichia coli O157:H7 GN=trxC PE=3 SV=1 9 94 4.0E-11
sp|Q9ZPH2|GRS17_ARATH Monothiol glutaredoxin-S17 OS=Arabidopsis thaliana GN=GRXS17 PE=1 SV=1 2 111 4.0E-11
sp|Q42403|TRXH3_ARATH Thioredoxin H3 OS=Arabidopsis thaliana GN=TRX3 PE=1 SV=1 29 97 4.0E-11
sp|Q9XFH9|TRXF2_ARATH Thioredoxin F2, chloroplastic OS=Arabidopsis thaliana GN=At5g16400 PE=2 SV=1 23 109 5.0E-11
sp|Q8KEA4|THIO1_CHLTE Thioredoxin-1 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=trx1 PE=3 SV=1 13 94 5.0E-11
sp|Q9LXZ8|TRH10_ARATH Putative thioredoxin H10 OS=Arabidopsis thaliana GN=At3g56420 PE=3 SV=2 29 99 6.0E-11
sp|P09856|TRXF_SPIOL Thioredoxin F-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2 1 102 6.0E-11
sp|Q5WNE3|NGLY1_CAEBR Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Caenorhabditis briggsae GN=png-1 PE=3 SV=1 20 102 6.0E-11
sp|P46843|TRXB_MYCLE Bifunctional thioredoxin reductase/thioredoxin OS=Mycobacterium leprae (strain TN) GN=trxB/A PE=3 SV=1 13 92 7.0E-11
sp|Q39362|TRXH2_BRANA Thioredoxin H-type 2 OS=Brassica napus GN=THL-2 PE=2 SV=1 11 101 8.0E-11
sp|Q8S091|TRXF_ORYSJ Thioredoxin F, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0913000 PE=2 SV=1 22 104 8.0E-11
sp|P07887|THIO2_CORNE Thioredoxin C-2 OS=Corynebacterium nephridii PE=1 SV=3 29 96 8.0E-11
sp|Q7XQQ2|TRXM3_ORYSJ Thioredoxin M3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os04g0430800 PE=2 SV=4 14 103 9.0E-11
sp|Q8KE49|THIO2_CHLTE Thioredoxin-2 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=trx2 PE=3 SV=3 9 97 9.0E-11
sp|P60226|THIO1_DROYA Thioredoxin-1 OS=Drosophila yakuba GN=dhd PE=2 SV=2 7 97 1.0E-10
sp|P52233|THIO_ACIFR Thioredoxin OS=Acidithiobacillus ferrooxidans GN=trxA PE=3 SV=1 15 92 1.0E-10
sp|Q9XFH8|TRXF1_ARATH Thioredoxin F1, chloroplastic OS=Arabidopsis thaliana GN=At3g02730 PE=1 SV=2 23 112 1.0E-10
sp|Q4UNK3|THIO_RICFE Thioredoxin OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=trxA PE=3 SV=2 23 91 1.0E-10
sp|P96611|YDBP_BACSU Thioredoxin-like protein YdbP OS=Bacillus subtilis (strain 168) GN=ydbP PE=2 SV=1 7 105 2.0E-10
sp|P52228|THIO3_CORNE Thioredoxin C-3 OS=Corynebacterium nephridii PE=3 SV=1 9 92 2.0E-10
sp|Q8CPL5|THIO_STAES Thioredoxin OS=Staphylococcus epidermidis (strain ATCC 12228) GN=trxA PE=3 SV=1 29 94 3.0E-10
sp|Q5HQ29|THIO_STAEQ Thioredoxin OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=trxA PE=3 SV=1 29 94 3.0E-10
sp|Q5UR29|TR548_MIMIV Thioredoxin-like protein R548 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R548 PE=3 SV=1 2 101 3.0E-10
sp|P52232|THIO1_SYNY3 Thioredoxin-like protein slr0233 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0233 PE=1 SV=1 7 92 3.0E-10
sp|Q4L5F0|THIO_STAHJ Thioredoxin OS=Staphylococcus haemolyticus (strain JCSC1435) GN=trxA PE=3 SV=1 29 94 3.0E-10
sp|Q49WR2|THIO_STAS1 Thioredoxin OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=trxA PE=3 SV=1 29 94 4.0E-10
sp|Q8LCH9|TRL33_ARATH Thioredoxin-like 3-3 OS=Arabidopsis thaliana GN=At3g53220 PE=2 SV=1 29 97 4.0E-10
sp|P80579|THIO_ALIAC Thioredoxin OS=Alicyclobacillus acidocaldarius GN=trxA PE=1 SV=1 9 104 4.0E-10
sp|P47938|THIO1_DROME Thioredoxin-1 OS=Drosophila melanogaster GN=dhd PE=1 SV=1 7 97 5.0E-10
sp|O83889|THIO_TREPA Thioredoxin OS=Treponema pallidum (strain Nichols) GN=trxA PE=3 SV=1 17 91 5.0E-10
sp|Q7XSQ7|TRL33_ORYSJ Thioredoxin-like 3-3 OS=Oryza sativa subsp. japonica GN=Os04g0560200 PE=2 SV=2 2 97 5.0E-10
sp|Q9FF55|PDI14_ARATH Protein disulfide isomerase-like 1-4 OS=Arabidopsis thaliana GN=PDIL1-4 PE=1 SV=1 13 102 6.0E-10
sp|Q9CM49|THIO_PASMU Thioredoxin OS=Pasteurella multocida (strain Pm70) GN=trxA PE=3 SV=1 23 94 6.0E-10
sp|Q1RKN1|THIO_RICBR Thioredoxin OS=Rickettsia bellii (strain RML369-C) GN=trxA PE=3 SV=2 2 91 6.0E-10
sp|P0A0K5|THIO_STAAW Thioredoxin OS=Staphylococcus aureus (strain MW2) GN=trxA PE=3 SV=1 29 94 7.0E-10
sp|P0A0K6|THIO_STAAU Thioredoxin OS=Staphylococcus aureus GN=trxA PE=1 SV=1 29 94 7.0E-10
sp|Q6GA69|THIO_STAAS Thioredoxin OS=Staphylococcus aureus (strain MSSA476) GN=trxA PE=3 SV=1 29 94 7.0E-10
sp|Q6GHU0|THIO_STAAR Thioredoxin OS=Staphylococcus aureus (strain MRSA252) GN=trxA PE=3 SV=1 29 94 7.0E-10
sp|P99122|THIO_STAAN Thioredoxin OS=Staphylococcus aureus (strain N315) GN=trxA PE=1 SV=1 29 94 7.0E-10
sp|P0A0K4|THIO_STAAM Thioredoxin OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=trxA PE=3 SV=1 29 94 7.0E-10
sp|Q5HGT9|THIO_STAAC Thioredoxin OS=Staphylococcus aureus (strain COL) GN=trxA PE=3 SV=1 29 94 7.0E-10
sp|Q2YXD0|THIO_STAAB Thioredoxin OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=trxA PE=3 SV=1 29 94 7.0E-10
sp|Q2FZD2|THIO_STAA8 Thioredoxin OS=Staphylococcus aureus (strain NCTC 8325) GN=trxA PE=2 SV=1 29 94 7.0E-10
sp|Q2FHT6|THIO_STAA3 Thioredoxin OS=Staphylococcus aureus (strain USA300) GN=trxA PE=3 SV=1 29 94 7.0E-10
sp|Q5JMR9|TRXY_ORYSJ Thioredoxin Y, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0963400 PE=3 SV=2 8 94 7.0E-10
sp|P66928|THIO_HELPY Thioredoxin OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trxA PE=3 SV=1 9 92 1.0E-09
sp|P66929|THIO_HELPJ Thioredoxin OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trxA PE=3 SV=1 9 92 1.0E-09
sp|Q92JR5|THIO_RICCN Thioredoxin OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=trxA PE=3 SV=1 23 91 1.0E-09
sp|Q68Y00|THIO_RICTY Thioredoxin OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=trxA PE=3 SV=1 1 91 1.0E-09
sp|Q28ID3|GLRX3_XENTR Glutaredoxin-3 OS=Xenopus tropicalis GN=glrx3 PE=2 SV=2 1 106 2.0E-09
sp|O51088|THIO_BORBU Thioredoxin OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=trxA PE=3 SV=1 19 104 2.0E-09
sp|Q8LDI5|CXXS1_ARATH Thioredoxin-like protein CXXS1 OS=Arabidopsis thaliana GN=CXXS1 PE=2 SV=2 29 101 2.0E-09
sp|Q86VQ3|TXND2_HUMAN Thioredoxin domain-containing protein 2 OS=Homo sapiens GN=TXNDC2 PE=2 SV=4 7 104 2.0E-09
sp|P29450|TRXF_PEA Thioredoxin F-type, chloroplastic OS=Pisum sativum PE=2 SV=1 23 101 2.0E-09
sp|Q39591|DYL4_CHLRE Dynein 14 kDa light chain, flagellar outer arm OS=Chlamydomonas reinhardtii PE=1 SV=1 1 107 3.0E-09
sp|P32642|GLRX4_YEAST Monothiol glutaredoxin-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRX4 PE=1 SV=1 3 115 3.0E-09
sp|O64764|TRXO1_ARATH Thioredoxin O1, mitochondrial OS=Arabidopsis thaliana GN=At2g35010 PE=2 SV=1 29 104 3.0E-09
sp|Q8LEK4|TRL21_ARATH Thioredoxin-like 2-1, chloroplastic OS=Arabidopsis thaliana GN=At4g26160 PE=2 SV=2 3 84 3.0E-09
sp|Q86H62|GLRX3_DICDI Glutaredoxin-3 homolog OS=Dictyostelium discoideum GN=glrx3 PE=3 SV=1 7 97 4.0E-09
sp|Q9ZEE0|THIO_RICPR Thioredoxin OS=Rickettsia prowazekii (strain Madrid E) GN=trxA PE=3 SV=2 9 91 5.0E-09
sp|Q8IFW4|THIOT_DROME Thioredoxin-T OS=Drosophila melanogaster GN=TrxT PE=2 SV=1 16 102 6.0E-09
sp|P59527|THIO_BUCBP Thioredoxin OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=trxA PE=3 SV=1 23 92 6.0E-09
sp|Q8VX13|PDI13_ARATH Protein disulfide isomerase-like 1-3 OS=Arabidopsis thaliana GN=PDIL1-3 PE=2 SV=1 7 91 6.0E-09
sp|P07237|PDIA1_HUMAN Protein disulfide-isomerase OS=Homo sapiens GN=P4HB PE=1 SV=3 10 114 7.0E-09
sp|Q2HWU2|PDIA1_MACFU Protein disulfide-isomerase OS=Macaca fuscata fuscata GN=P4HB PE=2 SV=1 10 114 7.0E-09
sp|P52230|THIO1_STRCO Thioredoxin-1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxA PE=1 SV=4 9 104 8.0E-09
sp|P0A4L3|THIO_LISMO Thioredoxin OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=trxA PE=3 SV=1 29 94 1.0E-08
sp|P0A4L4|THIO_LISIN Thioredoxin OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=trxA PE=3 SV=1 29 94 1.0E-08
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 23 111 1.0E-08
sp|Q58DA7|GLRX3_BOVIN Glutaredoxin-3 OS=Bos taurus GN=GLRX3 PE=2 SV=1 12 102 1.0E-08
sp|O76003|GLRX3_HUMAN Glutaredoxin-3 OS=Homo sapiens GN=GLRX3 PE=1 SV=2 12 113 1.0E-08
sp|P97493|THIOM_MOUSE Thioredoxin, mitochondrial OS=Mus musculus GN=Txn2 PE=1 SV=1 23 91 1.0E-08
sp|Q99757|THIOM_HUMAN Thioredoxin, mitochondrial OS=Homo sapiens GN=TXN2 PE=1 SV=2 23 91 1.0E-08
sp|O74790|GLRX4_SCHPO Monothiol glutaredoxin-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=grx4 PE=1 SV=1 5 103 1.0E-08
sp|P57653|THIO_BUCAI Thioredoxin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=trxA PE=3 SV=1 1 93 1.0E-08
sp|Q05739|THIO_STRC2 Thioredoxin OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=trxA PE=1 SV=1 1 94 1.0E-08
sp|P05307|PDIA1_BOVIN Protein disulfide-isomerase OS=Bos taurus GN=P4HB PE=1 SV=1 10 87 1.0E-08
sp|P52227|THIO_CHLCV Thioredoxin OS=Chlamydophila caviae (strain GPIC) GN=trxA PE=3 SV=1 22 91 1.0E-08
sp|Q86XW9|TXND6_HUMAN Thioredoxin domain-containing protein 6 OS=Homo sapiens GN=NME9 PE=2 SV=1 5 103 2.0E-08
sp|P97615|THIOM_RAT Thioredoxin, mitochondrial OS=Rattus norvegicus GN=Txn2 PE=2 SV=1 23 91 2.0E-08
sp|Q9PJK3|THIO_CHLMU Thioredoxin OS=Chlamydia muridarum (strain MoPn / Nigg) GN=trxA PE=3 SV=1 29 91 2.0E-08
sp|Q5R5B6|PDIA1_PONAB Protein disulfide-isomerase OS=Pongo abelii GN=P4HB PE=2 SV=1 7 87 2.0E-08
sp|Q95108|THIOM_BOVIN Thioredoxin, mitochondrial OS=Bos taurus GN=TXN2 PE=1 SV=2 23 91 2.0E-08
sp|Q17967|PDI1_CAEEL Protein disulfide-isomerase 1 OS=Caenorhabditis elegans GN=pdi-1 PE=3 SV=1 7 114 2.0E-08
sp|O84544|THIO_CHLTR Thioredoxin OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=trxA PE=3 SV=1 22 91 2.0E-08
sp|P43785|THIO_HAEIN Thioredoxin OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trxA PE=3 SV=1 1 94 3.0E-08
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 12 114 3.0E-08
sp|Q9X2T1|THIO_PSEAE Thioredoxin OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trxA PE=3 SV=1 9 96 4.0E-08
sp|Q93VQ9|TRXO2_ARATH Thioredoxin O2, mitochondrial OS=Arabidopsis thaliana GN=At1g31020 PE=2 SV=1 29 104 4.0E-08
sp|O94504|TRX2_SCHPO Thioredoxin-2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trx2 PE=1 SV=2 1 97 4.0E-08
sp|P09857|THIO_ALLVI Thioredoxin OS=Allochromatium vinosum GN=trxA PE=1 SV=1 9 93 5.0E-08
sp|O30974|THIO_MYCSM Thioredoxin OS=Mycobacterium smegmatis GN=trxA PE=3 SV=1 29 92 5.0E-08
sp|Q9JLZ1|GLRX3_RAT Glutaredoxin-3 OS=Rattus norvegicus GN=Glrx3 PE=1 SV=2 12 102 7.0E-08
sp|Q0IWL9|GRS11_ORYSJ Monothiol glutaredoxin-S11 OS=Oryza sativa subsp. japonica GN=GRXS11 PE=2 SV=2 1 108 7.0E-08
sp|Q9CQM9|GLRX3_MOUSE Glutaredoxin-3 OS=Mus musculus GN=Glrx3 PE=1 SV=1 12 102 7.0E-08
sp|Q9SEU7|TRXM3_ARATH Thioredoxin M3, chloroplastic OS=Arabidopsis thaliana GN=GAT1 PE=2 SV=2 2 94 1.0E-07
sp|P14949|THIO_BACSU Thioredoxin OS=Bacillus subtilis (strain 168) GN=trxA PE=1 SV=3 29 107 1.0E-07
sp|Q0J9V5|CXXS1_ORYSJ Thioredoxin-like protein CXXS1 OS=Oryza sativa subsp. japonica GN=Os04g0629500 PE=2 SV=1 29 115 1.0E-07
sp|P09102|PDIA1_CHICK Protein disulfide-isomerase OS=Gallus gallus GN=P4HB PE=1 SV=3 13 87 1.0E-07
sp|P09103|PDIA1_MOUSE Protein disulfide-isomerase OS=Mus musculus GN=P4hb PE=1 SV=2 10 114 1.0E-07
sp|P21195|PDIA1_RABIT Protein disulfide-isomerase OS=Oryctolagus cuniculus GN=P4HB PE=2 SV=1 11 114 1.0E-07
sp|Q9Z7P5|THIO_CHLPN Thioredoxin OS=Chlamydia pneumoniae GN=trxA PE=3 SV=1 23 91 1.0E-07
sp|Q6A555|TXND8_HUMAN Thioredoxin domain-containing protein 8 OS=Homo sapiens GN=TXNDC8 PE=1 SV=2 24 87 1.0E-07
sp|A2YUQ6|CITRX_ORYSI Thioredoxin-like protein CITRX, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_29059 PE=3 SV=1 9 80 1.0E-07
sp|Q10057|PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.02 PE=3 SV=1 9 91 2.0E-07
sp|P29828|PDI_MEDSA Protein disulfide-isomerase OS=Medicago sativa GN=PDI PE=2 SV=1 11 113 2.0E-07
sp|P54399|PDI_DROME Protein disulfide-isomerase OS=Drosophila melanogaster GN=Pdi PE=2 SV=1 7 83 2.0E-07
sp|Q8H2V6|CITRX_ORYSJ Thioredoxin-like protein CITRX, chloroplastic OS=Oryza sativa subsp. japonica GN=Os08g0378900 PE=2 SV=1 9 80 2.0E-07
sp|D4B2L8|PDI_ARTBC Protein disulfide-isomerase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02626 PE=3 SV=1 2 94 3.0E-07
sp|P80028|TRXH_CHLRE Thioredoxin H-type OS=Chlamydomonas reinhardtii GN=TRXH PE=1 SV=3 29 106 3.0E-07
sp|Q921X9|PDIA5_MOUSE Protein disulfide-isomerase A5 OS=Mus musculus GN=Pdia5 PE=1 SV=1 9 87 3.0E-07
sp|O51890|THIO_BUCAP Thioredoxin OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=trxA PE=3 SV=1 1 93 4.0E-07
sp|Q14554|PDIA5_HUMAN Protein disulfide-isomerase A5 OS=Homo sapiens GN=PDIA5 PE=1 SV=1 9 85 4.0E-07
sp|Q5RCH2|PDIA2_PONAB Protein disulfide-isomerase A2 OS=Pongo abelii GN=PDIA2 PE=2 SV=1 17 111 5.0E-07
sp|Q8N427|TXND3_HUMAN Thioredoxin domain-containing protein 3 OS=Homo sapiens GN=NME8 PE=2 SV=2 5 104 8.0E-07
sp|Q39592|DYL5_CHLRE Dynein 16 kDa light chain, flagellar outer arm OS=Chlamydomonas reinhardtii PE=1 SV=1 7 104 9.0E-07
sp|Q8R4U2|PDIA1_CRIGR Protein disulfide-isomerase OS=Cricetulus griseus GN=P4HB PE=2 SV=1 10 114 1.0E-06
sp|Q5I0H9|PDIA5_RAT Protein disulfide-isomerase A5 OS=Rattus norvegicus GN=Pdia5 PE=2 SV=1 9 87 1.0E-06
sp|P04785|PDIA1_RAT Protein disulfide-isomerase OS=Rattus norvegicus GN=P4hb PE=1 SV=2 10 114 1.0E-06
sp|Q5TKD8|TRL2_ORYSJ Thioredoxin-like 2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os05g0200100 PE=2 SV=1 3 84 1.0E-06
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 2 85 2.0E-06
sp|D3Z6P0|PDIA2_MOUSE Protein disulfide-isomerase A2 OS=Mus musculus GN=Pdia2 PE=1 SV=1 17 113 2.0E-06
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 7 92 2.0E-06
sp|P17967|PDI_YEAST Protein disulfide-isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDI1 PE=1 SV=2 2 102 3.0E-06
sp|P12244|GSBP_CHICK Dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Gallus gallus PE=2 SV=2 7 114 3.0E-06
sp|Q17770|PDI2_CAEEL Protein disulfide-isomerase 2 OS=Caenorhabditis elegans GN=pdi-2 PE=1 SV=1 7 97 4.0E-06
sp|Q13087|PDIA2_HUMAN Protein disulfide-isomerase A2 OS=Homo sapiens GN=PDIA2 PE=1 SV=2 17 111 4.0E-06
sp|O13811|PDI2_SCHPO Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.14c PE=3 SV=1 2 80 4.0E-06
sp|Q2KIL5|PDIA5_BOVIN Protein disulfide-isomerase A5 OS=Bos taurus GN=PDIA5 PE=2 SV=1 13 103 5.0E-06
sp|Q9FF55|PDI14_ARATH Protein disulfide isomerase-like 1-4 OS=Arabidopsis thaliana GN=PDIL1-4 PE=1 SV=1 14 87 6.0E-06
sp|Q920J4|TXNL1_RAT Thioredoxin-like protein 1 OS=Rattus norvegicus GN=Txnl1 PE=1 SV=3 32 114 6.0E-06
sp|O43396|TXNL1_HUMAN Thioredoxin-like protein 1 OS=Homo sapiens GN=TXNL1 PE=1 SV=3 32 114 6.0E-06
sp|P55059|PDI_HUMIN Protein disulfide-isomerase OS=Humicola insolens PE=1 SV=1 2 91 6.0E-06
sp|Q8CDN6|TXNL1_MOUSE Thioredoxin-like protein 1 OS=Mus musculus GN=Txnl1 PE=1 SV=3 32 102 6.0E-06
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 4 84 7.0E-06
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 16 92 8.0E-06
sp|Q43116|PDI_RICCO Protein disulfide-isomerase OS=Ricinus communis PE=2 SV=1 11 86 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8117
MSSVTDIKTKTQFENLIKDNPYVALQAHATWCGPCKAISPIFQKHADSFKTLVFARFDTDEVPDLAHELNIRSIP
AFFFFENGEKTSNVAGATPPSLEKAVKDLAAKAGSSGTTA*
Coding >OphauB2|8117
ATGAGTTCGGTTACGGATATCAAAACCAAGACCCAATTCGAAAATCTCATCAAGGACAACCCCTACGTTGCTCTC
CAGGCGCATGCTACCTGGTGCGGGCCTTGCAAAGCCATCTCGCCAATTTTTCAAAAGCACGCCGACAGCTTCAAA
ACGCTAGTCTTTGCCCGCTTCGACACGGATGAGGTGCCTGACCTCGCCCACGAACTCAACATTCGCTCTATACCC
GCCTTCTTCTTCTTTGAAAATGGCGAAAAGACCAGCAACGTAGCTGGCGCTACTCCCCCCTCCCTGGAAAAGGCC
GTCAAGGACCTTGCTGCAAAGGCAGGCTCTTCGGGTACCACCGCTTAG
Transcript >OphauB2|8117
ATGAGTTCGGTTACGGATATCAAAACCAAGACCCAATTCGAAAATCTCATCAAGGACAACCCCTACGTTGCTCTC
CAGGCGCATGCTACCTGGTGCGGGCCTTGCAAAGCCATCTCGCCAATTTTTCAAAAGCACGCCGACAGCTTCAAA
ACGCTAGTCTTTGCCCGCTTCGACACGGATGAGGTGCCTGACCTCGCCCACGAACTCAACATTCGCTCTATACCC
GCCTTCTTCTTCTTTGAAAATGGCGAAAAGACCAGCAACGTAGCTGGCGCTACTCCCCCCTCCCTGGAAAAGGCC
GTCAAGGACCTTGCTGCAAAGGCAGGCTCTTCGGGTACCACCGCTTAG
Gene >OphauB2|8117
ATGAGTTCGGTTACGGATATCAAAACCAAGACCCAATTCGAAAATCTCATCAAGGACAACCCCTACGTTGCTCTC
CAGGCGCATGCTACCTGGTGCGGGCCTTGCAAAGCCATCTCGCCAATTTTTCAAAAGCACGCCGACAGCTTCAAA
ACGCTAGTCTTTGCCCGCTTCGACACGGATGAGGTGCCTGACCTCGCCCACGAACTCAACATTCGCTCTATACCC
GCCTTCTTCTTCTTTGAAAATGGCGAAAAGACCAGCAACGTAGCTGGCGCTACTCCCCCCTCCCTGGAAAAGGCC
GTCAAGGACCTTGCTGCAAAGGCAGGCTCTTCGGGTACCACCGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail