Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8111
Gene name
LocationContig_97:73588..74855
Strand-
Gene length (bp)1267
Transcript length (bp)1038
Coding sequence length (bp)1038
Protein length (aa) 346

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 6.1E-12 173 276
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 2.0E-08 29 92

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AUY5|CIPB_EMENI Zinc-binding alcohol dehydrogenase domain-containing protein cipB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cipB PE=1 SV=1 8 343 3.0E-59
sp|Q9P7F4|YKK1_SCHPO Zinc-type alcohol dehydrogenase-like protein C2E1P3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E1P3.01 PE=3 SV=1 17 222 1.0E-30
sp|Q9Y7D0|LOVC_ASPTE Enoyl reductase LovC OS=Aspergillus terreus GN=lovC PE=1 SV=1 21 344 6.0E-30
sp|P54006|TOXD_COCCA Protein TOXD OS=Cochliobolus carbonum GN=TOXD PE=3 SV=1 1 237 1.0E-27
sp|Q8H0M1|QORH_SPIOL Quinone-oxidoreductase homolog, chloroplastic OS=Spinacia oleracea GN=QOR PE=1 SV=1 23 214 3.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AUY5|CIPB_EMENI Zinc-binding alcohol dehydrogenase domain-containing protein cipB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cipB PE=1 SV=1 8 343 3.0E-59
sp|Q9P7F4|YKK1_SCHPO Zinc-type alcohol dehydrogenase-like protein C2E1P3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E1P3.01 PE=3 SV=1 17 222 1.0E-30
sp|Q9Y7D0|LOVC_ASPTE Enoyl reductase LovC OS=Aspergillus terreus GN=lovC PE=1 SV=1 21 344 6.0E-30
sp|P54006|TOXD_COCCA Protein TOXD OS=Cochliobolus carbonum GN=TOXD PE=3 SV=1 1 237 1.0E-27
sp|Q8H0M1|QORH_SPIOL Quinone-oxidoreductase homolog, chloroplastic OS=Spinacia oleracea GN=QOR PE=1 SV=1 23 214 3.0E-24
sp|Q9SV68|QORH_ARATH Putative quinone-oxidoreductase homolog, chloroplastic OS=Arabidopsis thaliana GN=At4g13010 PE=2 SV=1 22 214 5.0E-24
sp|P53912|YNN4_YEAST Uncharacterized protein YNL134C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL134C PE=1 SV=1 5 343 7.0E-20
sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 23 220 6.0E-19
sp|Q9ZUC1|QORL_ARATH Quinone oxidoreductase-like protein At1g23740, chloroplastic OS=Arabidopsis thaliana GN=At1g23740 PE=2 SV=2 23 218 6.0E-19
sp|Q5HE19|ZDH1_STAAC Zinc-type alcohol dehydrogenase-like protein SACOL2177 OS=Staphylococcus aureus (strain COL) GN=SACOL2177 PE=3 SV=1 24 253 1.0E-18
sp|Q5R4S7|QOR_PONAB Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 23 292 3.0E-18
sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 23 220 4.0E-18
sp|P25608|YCZ2_YEAST Uncharacterized protein YCR102C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR102C PE=3 SV=1 5 344 7.0E-18
sp|P54007|YL460_YEAST Uncharacterized protein YLR460C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR460C PE=1 SV=1 5 245 8.0E-18
sp|Q8NVD1|ZDH1_STAAW Zinc-type alcohol dehydrogenase-like protein MW2112 OS=Staphylococcus aureus (strain MW2) GN=MW2112 PE=3 SV=1 24 253 2.0E-17
sp|Q6G7C8|ZDH1_STAAS Zinc-type alcohol dehydrogenase-like protein SAS2087 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2087 PE=3 SV=1 24 253 2.0E-17
sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 23 289 2.0E-17
sp|Q8WWV3|RT4I1_HUMAN Reticulon-4-interacting protein 1, mitochondrial OS=Homo sapiens GN=RTN4IP1 PE=1 SV=2 28 220 3.0E-17
sp|P99173|ZDH1_STAAN Zinc-type alcohol dehydrogenase-like protein SA1988 OS=Staphylococcus aureus (strain N315) GN=SA1988 PE=1 SV=1 24 253 4.0E-17
sp|P63475|ZDH1_STAAM Zinc-type alcohol dehydrogenase-like protein SAV2186 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2186 PE=3 SV=1 24 253 4.0E-17
sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 23 292 6.0E-17
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 23 222 1.0E-16
sp|Q0VC50|RT4I1_BOVIN Reticulon-4-interacting protein 1, mitochondrial OS=Bos taurus GN=RTN4IP1 PE=2 SV=1 28 216 2.0E-16
sp|Q6GEP3|ZDH1_STAAR Zinc-type alcohol dehydrogenase-like protein SAR2277 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2277 PE=3 SV=1 24 340 2.0E-16
sp|Q924D0|RT4I1_MOUSE Reticulon-4-interacting protein 1, mitochondrial OS=Mus musculus GN=Rtn4ip1 PE=1 SV=2 28 255 6.0E-16
sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 23 287 9.0E-16
sp|O42909|YBI2_SCHPO Zinc-type alcohol dehydrogenase-like protein C16A3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.02c PE=3 SV=1 19 264 5.0E-15
sp|Q84V25|ENOXE_FRAAN 2-methylene-furan-3-one reductase OS=Fragaria ananassa GN=EO PE=1 SV=1 1 218 2.0E-14
sp|Q7T3C7|RT4I1_DANRE Reticulon-4-interacting protein 1 homolog, mitochondrial OS=Danio rerio GN=rtn4ip1 PE=2 SV=2 28 236 2.0E-14
sp|Q28452|QOR_LAMGU Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 23 343 3.0E-14
sp|Q8CRJ7|ZDH1_STAES Zinc-type alcohol dehydrogenase-like protein SE_1777 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1777 PE=3 SV=1 23 232 8.0E-14
sp|Q5HM44|ZDH1_STAEQ Zinc-type alcohol dehydrogenase-like protein SERP1785 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1785 PE=3 SV=1 23 232 1.0E-13
sp|O94564|YGD6_SCHPO Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 18 212 3.0E-13
sp|K4BW79|ENOX_SOLLC 2-methylene-furan-3-one reductase OS=Solanum lycopersicum GN=EO PE=1 SV=1 23 218 3.0E-13
sp|C5E3S4|YIM11_LACTC Protein YIM1-1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=YIM1-1 PE=3 SV=1 30 282 5.0E-13
sp|O13309|ADH2_PICST Alcohol dehydrogenase 2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ADH2 PE=3 SV=1 1 249 2.0E-12
sp|P12311|ADH1_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adhT PE=1 SV=2 5 271 2.0E-12
sp|O23939|ENOX_FRAVE 2-methylene-furan-3-one reductase OS=Fragaria vesca GN=EO PE=2 SV=2 1 218 1.0E-11
sp|Q3IZ91|CCR_RHOS4 Crotonyl-CoA reductase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ccr PE=3 SV=1 58 223 2.0E-11
sp|P42328|ADH3_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus PE=1 SV=1 5 345 2.0E-11
sp|Q941I0|ENOXC_FRAAN 2-methylene-furan-3-one reductase OS=Fragaria ananassa GN=EO PE=1 SV=2 1 218 3.0E-11
sp|Q82LU9|CCRA2_STRAW Crotonyl-CoA reductase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ccrA2 PE=1 SV=1 22 210 4.0E-11
sp|O74489|QOR_SCHPO Probable quinone oxidoreductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zta1 PE=1 SV=2 23 269 6.0E-11
sp|Q59I44|CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. GN=caa43 PE=1 SV=1 23 249 2.0E-10
sp|Q80TB8|VAT1L_MOUSE Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 23 256 2.0E-10
sp|Q54II4|RT4I1_DICDI Reticulon-4-interacting protein 1 homolog, mitochondrial OS=Dictyostelium discoideum GN=rtn4ip1 PE=3 SV=1 22 219 8.0E-10
sp|Q9HCJ6|VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 23 256 8.0E-10
sp|Q8U259|TDH_PYRFU Probable L-threonine 3-dehydrogenase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=tdh PE=3 SV=1 23 343 9.0E-10
sp|P0DN30|RTAI1_ARTBC Probable zinc-binding oxidoreductase, mitochondrial OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02327-2 PE=3 SV=1 11 216 1.0E-09
sp|P43903|QOR_PSEAE Quinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=qor PE=3 SV=2 9 244 1.0E-09
sp|O58389|TDH_PYRHO Probable L-threonine 3-dehydrogenase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=tdh PE=1 SV=1 23 343 1.0E-09
sp|O07615|YHFP_BACSU Putative quinone oxidoreductase YhfP OS=Bacillus subtilis (strain 168) GN=yhfP PE=1 SV=1 38 261 2.0E-09
sp|Q9UYX0|TDH_PYRAB Probable L-threonine 3-dehydrogenase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=tdh PE=3 SV=1 23 343 2.0E-09
sp|Q8JFV8|VAT1_DANRE Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 24 243 6.0E-09
sp|C5E3S5|YIM12_LACTC Protein YIM1-2 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=YIM1-2 PE=3 SV=1 28 250 1.0E-08
sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 9 253 1.0E-08
sp|Q53865|CCR_STRCU Crotonyl-CoA reductase OS=Streptomyces collinus GN=ccr PE=1 SV=1 22 210 1.0E-08
sp|A4YGN2|ACAR_METS5 Acryloyl-coenzyme A reductase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1426 PE=1 SV=1 5 196 2.0E-08
sp|O31186|ADHA_RHIME Alcohol dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=adhA PE=3 SV=1 15 271 3.0E-08
sp|O34812|YFMJ_BACSU Putative NADP-dependent oxidoreductase YfmJ OS=Bacillus subtilis (strain 168) GN=yfmJ PE=2 SV=1 22 225 7.0E-08
sp|P26646|ACUI_ECOLI Probable acrylyl-CoA reductase AcuI OS=Escherichia coli (strain K12) GN=acuI PE=1 SV=1 55 277 8.0E-08
sp|E7QJD3|YIM1_YEASZ Protein YIM1 OS=Saccharomyces cerevisiae (strain Zymaflore VL3) GN=YIM1 PE=3 SV=1 30 250 8.0E-08
sp|E7LYS5|YIM1_YEASV Protein YIM1 OS=Saccharomyces cerevisiae (strain VIN 13) GN=YIM1 PE=3 SV=1 30 250 8.0E-08
sp|E7KGT3|YIM1_YEASA Protein YIM1 OS=Saccharomyces cerevisiae (strain AWRI796) GN=YIM1 PE=3 SV=1 30 250 8.0E-08
sp|C8ZF09|YIM1_YEAS8 Protein YIM1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=YIM1 PE=3 SV=1 30 250 8.0E-08
sp|A6ZML0|YIM1_YEAS7 Protein YIM1 OS=Saccharomyces cerevisiae (strain YJM789) GN=YIM1 PE=3 SV=1 30 250 8.0E-08
sp|B5VPS4|YIM1_YEAS6 Protein YIM1 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=YIM1 PE=3 SV=1 30 250 8.0E-08
sp|C7GQ91|YIM1_YEAS2 Protein YIM1 OS=Saccharomyces cerevisiae (strain JAY291) GN=YIM1 PE=3 SV=1 30 250 8.0E-08
sp|B3LM39|YIM1_YEAS1 Protein YIM1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=YIM1 PE=3 SV=1 30 250 8.0E-08
sp|P28625|YIM1_YEAST Protein YIM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIM1 PE=1 SV=2 30 250 9.0E-08
sp|E7NLM5|YIM1_YEASO Protein YIM1 OS=Saccharomyces cerevisiae (strain FostersO) GN=YIM1 PE=3 SV=1 30 250 1.0E-07
sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 30 243 1.0E-07
sp|Q53FA7|QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 16 245 1.0E-07
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 19 205 4.0E-07
sp|P28304|QOR1_ECOLI Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) GN=qorA PE=1 SV=1 26 253 4.0E-07
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 25 237 5.0E-07
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 25 237 5.0E-07
sp|B6YTJ5|TDH_THEON Probable L-threonine 3-dehydrogenase OS=Thermococcus onnurineus (strain NA1) GN=tdh PE=3 SV=1 11 341 1.0E-06
sp|Q5JI69|TDH_THEKO Probable L-threonine 3-dehydrogenase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=tdh PE=1 SV=1 23 341 1.0E-06
sp|Q72L62|TDH_THET2 L-threonine 3-dehydrogenase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=tdh PE=3 SV=1 22 185 2.0E-06
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 63 237 2.0E-06
sp|O45687|ADH2_CAEEL Alcohol dehydrogenase 2 OS=Caenorhabditis elegans GN=sodh-2 PE=3 SV=1 1 264 4.0E-06
sp|Q921W4|QORL1_MOUSE Quinone oxidoreductase-like protein 1 OS=Mus musculus GN=Cryzl1 PE=1 SV=1 23 192 4.0E-06
sp|A7RK30|QORL2_NEMVE Quinone oxidoreductase-like protein 2 homolog OS=Nematostella vectensis GN=v1g238856 PE=3 SV=1 58 341 4.0E-06
sp|O95825|QORL1_HUMAN Quinone oxidoreductase-like protein 1 OS=Homo sapiens GN=CRYZL1 PE=1 SV=2 23 193 6.0E-06
sp|P43067|ADH1_CANAX Alcohol dehydrogenase 1 OS=Candida albicans GN=ADH1 PE=1 SV=1 3 249 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055114 oxidation-reduction process Yes
GO:0008150 biological_process No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8111
MPSNQAAWFEASKAPLVVKPAPVPKPEPGRVIIRNAAVAVNPIDWKIQDLLSASLIKKFPFILGQDTAGVIEQVG
PDVKGFSKGQRVIAQCSSLATQDPSISAFQLYSNVSTDIISVIPDTLAFKDAVVLPLAISTAATALYQDSHLGLP
LPSIQDAKPAGKTILVWGASSSVGSMAVQLAHASGVDVVATASQHNHDFVKSLGVKTVLDYKSPTIIDDLVKVLK
GGNLAGIVDSISHTDTFKSIAEIRKQLGSSVKVAGVLPLMEAIPDFTPTTVMATTIFHDPNEHIGAYIWGKFVPK
TLESGKLKALPKSQVVGRGLESIQKGLDVQKQGVSASKVVIVLDD*
Coding >OphauB2|8111
ATGCCTTCCAATCAAGCTGCGTGGTTCGAGGCCTCTAAAGCACCCCTTGTTGTAAAGCCTGCTCCAGTACCAAAG
CCGGAACCTGGAAGGGTCATTATACGCAATGCTGCGGTGGCTGTTAACCCGATAGACTGGAAAATTCAGGACTTG
CTGTCGGCATCATTGATCAAAAAGTTTCCCTTTATTCTAGGCCAGGACACTGCTGGAGTTATTGAACAGGTTGGA
CCCGACGTCAAGGGCTTTTCCAAGGGCCAGAGAGTGATTGCACAATGCAGCAGCCTTGCTACGCAGGATCCCTCC
ATTTCAGCTTTCCAGCTGTATTCCAATGTTTCCACCGATATCATATCCGTCATTCCCGATACGCTCGCCTTCAAA
GATGCCGTCGTCTTGCCCCTGGCCATATCGACCGCAGCGACTGCGCTGTACCAAGACAGCCACTTGGGTCTCCCG
CTGCCCTCGATTCAAGACGCCAAGCCGGCGGGCAAGACAATACTCGTCTGGGGAGCATCGTCTTCAGTCGGCAGC
ATGGCTGTGCAGCTTGCCCACGCGTCTGGCGTCGACGTGGTTGCCACTGCGTCCCAGCACAACCACGACTTTGTC
AAGTCTCTTGGCGTCAAGACGGTCCTCGATTACAAGTCGCCCACCATTATCGACGACTTGGTAAAGGTGCTCAAG
GGGGGCAATCTAGCTGGAATAGTCGACTCCATATCTCACACGGATACATTCAAGTCTATTGCAGAGATTCGCAAA
CAACTCGGCTCATCGGTAAAGGTTGCTGGCGTTTTGCCATTGATGGAGGCGATTCCAGACTTTACTCCAACCACT
GTCATGGCGACGACTATTTTCCACGATCCGAATGAGCACATTGGCGCTTACATTTGGGGCAAGTTTGTCCCCAAA
ACATTGGAAAGCGGGAAATTAAAGGCACTTCCCAAGAGTCAAGTTGTTGGTCGTGGACTTGAGTCGATTCAAAAG
GGATTGGATGTGCAGAAGCAGGGAGTTTCGGCTAGCAAGGTGGTTATAGTGTTGGATGATTAA
Transcript >OphauB2|8111
ATGCCTTCCAATCAAGCTGCGTGGTTCGAGGCCTCTAAAGCACCCCTTGTTGTAAAGCCTGCTCCAGTACCAAAG
CCGGAACCTGGAAGGGTCATTATACGCAATGCTGCGGTGGCTGTTAACCCGATAGACTGGAAAATTCAGGACTTG
CTGTCGGCATCATTGATCAAAAAGTTTCCCTTTATTCTAGGCCAGGACACTGCTGGAGTTATTGAACAGGTTGGA
CCCGACGTCAAGGGCTTTTCCAAGGGCCAGAGAGTGATTGCACAATGCAGCAGCCTTGCTACGCAGGATCCCTCC
ATTTCAGCTTTCCAGCTGTATTCCAATGTTTCCACCGATATCATATCCGTCATTCCCGATACGCTCGCCTTCAAA
GATGCCGTCGTCTTGCCCCTGGCCATATCGACCGCAGCGACTGCGCTGTACCAAGACAGCCACTTGGGTCTCCCG
CTGCCCTCGATTCAAGACGCCAAGCCGGCGGGCAAGACAATACTCGTCTGGGGAGCATCGTCTTCAGTCGGCAGC
ATGGCTGTGCAGCTTGCCCACGCGTCTGGCGTCGACGTGGTTGCCACTGCGTCCCAGCACAACCACGACTTTGTC
AAGTCTCTTGGCGTCAAGACGGTCCTCGATTACAAGTCGCCCACCATTATCGACGACTTGGTAAAGGTGCTCAAG
GGGGGCAATCTAGCTGGAATAGTCGACTCCATATCTCACACGGATACATTCAAGTCTATTGCAGAGATTCGCAAA
CAACTCGGCTCATCGGTAAAGGTTGCTGGCGTTTTGCCATTGATGGAGGCGATTCCAGACTTTACTCCAACCACT
GTCATGGCGACGACTATTTTCCACGATCCGAATGAGCACATTGGCGCTTACATTTGGGGCAAGTTTGTCCCCAAA
ACATTGGAAAGCGGGAAATTAAAGGCACTTCCCAAGAGTCAAGTTGTTGGTCGTGGACTTGAGTCGATTCAAAAG
GGATTGGATGTGCAGAAGCAGGGAGTTTCGGCTAGCAAGGTGGTTATAGTGTTGGATGATTAA
Gene >OphauB2|8111
ATGCCTTCCAATCAAGCTGCGTGGTTCGAGGCCTCTAAAGCACCCCTTGTTGTAAAGCCTGCTCCAGTACCAAAG
CCGGAACCTGGAAGGGTCATTATACGCAATGCTGCGGTGGCTGTTGTATGTATCGATATTGGCACCAATTTTGCC
TTGGTTTCTTACTAACATGGCACTCTAGAACCCGATAGACTGGAAAATTCAGTGCGGATATTGAACCGCCATGCC
TACTTGTTGATGAGCTGCTAATATCGTGTAGGGACTTGCTGTCGGCATCATTGATCAAAAAGTTTCCCTTTATTC
TAGGCCAGGACACTGCTGGAGTTATTGAACAGGTTGGACCCGACGTCAAGGGCTTTTCCAAGGGCCAGAGAGTGA
TTGCGTTGGTCCCACGTCTCCTTTTCATGTTGAGCTCTTTTTCTAATCGATGCCTTGATACAGACAATGCAGCAG
CCTTGCTACGCAGGATCCCTCCATTTCAGCTTTCCAGCTGTATTCCAATGTTTCCACCGATATCATATCCGTCAT
TCCCGATACGCTCGCCTTCAAAGATGCCGTCGTCTTGCCCCTGGCCATATCGACCGCAGCGACTGCGCTGTACCA
AGACAGCCACTTGGGTCTCCCGCTGCCCTCGATTCAAGACGCCAAGCCGGCGGGCAAGACAATACTCGTCTGGGG
AGCATCGTCTTCAGTCGGCAGCATGGCTGTGCAGCTTGCCCACGCGTCTGGCGTCGACGTGGTTGCCACTGCGTC
CCAGCACAACCACGACTTTGTCAAGTCTCTTGGCGTCAAGACGGTCCTCGATTACAAGTCGCCCACCATTATCGA
CGACTTGGTAAAGGTGCTCAAGGGGGGCAATCTAGCTGGAATAGTCGACTCCATATCTCACACGGATACATTCAA
GTCTATTGCAGAGATTCGCAAACAACTCGGCTCATCGGTAAAGGTTGCTGGCGTTTTGCCATTGATGGAGGCGAT
TCCAGACTTTACTCCAACCACTGGTGCGTGTGGGGATTGCATTCTTGGCAACTGACTCGGTGGCTAACATGGTTG
CATAGTCATGGCGACGACTATTTTCCACGATCCGAATGAGCACATTGGCGCTTACATTTGGGGCAAGTTTGTCCC
CAAAACATTGGAAAGCGGGAAATTAAAGGCACTTCCCAAGAGTCAAGTTGTTGGTCGTGGACTTGAGTCGATTCA
AAAGGGATTGGATGTGCAGAAGCAGGGAGTTTCGGCTAGCAAGGTGGTTATAGTGTTGGATGATTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail