Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8109
Gene name
LocationContig_97:67937..70578
Strand-
Gene length (bp)2641
Transcript length (bp)2565
Coding sequence length (bp)2565
Protein length (aa) 855

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9JM99|PRG4_MOUSE Proteoglycan 4 OS=Mus musculus GN=Prg4 PE=1 SV=2 332 452 2.0E-13

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8109
MVTVNRFVTAAVLACAWGAAGKESEKPVKGLGLDNGSNGVASSVHGLVQAANPAFQVNDGSYLTRRQSDDDDPFG
ESSEDEESDDDPFATGNEAPRPPSRPNPVAEAPKEDKPKEEERPKGQSAFFPSTGNSQPTTPEEEDKPKEEEKPK
GQSAFFPATGNSQPATPEDEEKPKEEEKPEEESAFTSIGNSQSATPEEEKPKEEEKPKEESAFTSIGNSQPVTPK
EEKPKEEEKPKEEEKPKEESAFTSVGNSQPATPKEEKPKEEEKPKEEEKPKEESAFTSVGNSQPATPQDEEKPKE
EEKPKEESAFTSVGNSQSASSSEPKEEEAPKKEEMPTNSKEEEPTTSKEEEPTTSKEEEKSTTPKEEEKSTTPKE
EEEPATSKEEEPTTSKEEEESTTPKEEEEPATSKEEEPTTSKEEEESTTPKEEEEPATSEEEEPTTPKEEEPTTS
KEEEKPATSSKPAELPKPVTLSKSIRVLEPTSKSSQSAQPAATSSLGKTSQAAAATSSVKSIPTSSFKTLAATAD
DKVGENGAKTTPASSNDMATVVVDSVMSKVTGCPASTSCAGDVYTTKTVPVYTVICPQDMLDVFIKPTAAPDASG
SDKPNASSPDASSPQPAAVPGTAGKDVSQINISATVIIIYTVTSCPQANGQCALGSTMTKEVPVNYRPAEKKDLT
ITLEYSEGCVNISDVAKIESSSGNNTVSSNEPGPDNVNQPRPAGQTTPAGGEGLDNGSGAPSGPQGDATADNDEP
CPTCTGSGNTSSDNVSQGDATINKPCPTCTGTGNTGSDNASQGDANPNTQPHDSPKTPTGPKSSDTESQGDASIP
ASPAVKTSGTGRSGTLKCMRARAVSNAGA*
Coding >OphauB2|8109
ATGGTTACCGTCAATCGCTTCGTCACCGCAGCTGTCCTGGCCTGTGCCTGGGGCGCTGCTGGAAAGGAATCCGAA
AAGCCAGTAAAAGGCCTAGGCCTCGACAATGGCAGCAATGGTGTCGCCAGCTCCGTCCACGGGCTTGTTCAGGCC
GCCAACCCTGCGTTTCAAGTCAACGACGGCAGCTATCTCACCCGCCGACAGTCTGACGACGACGACCCGTTTGGA
GAGTCTTCTGAAGACGAAGAGTCTGATGATGACCCGTTTGCAACGGGGAATGAAGCCCCGCGGCCTCCCTCGAGG
CCTAACCCAGTGGCAGAGGCCCCCAAGGAAGACAAGCCTAAGGAGGAAGAAAGGCCCAAGGGACAGTCTGCCTTT
TTCCCTTCGACGGGAAATTCACAGCCCACGACTCCCGAGGAGGAAGACAAGCCTAAGGAGGAAGAAAAGCCCAAG
GGACAGTCTGCCTTTTTCCCTGCGACGGGAAATTCGCAGCCCGCCACTCCCGAGGATGAAGAAAAGCCTAAAGAG
GAAGAAAAGCCCGAGGAAGAGTCCGCCTTTACTTCGATAGGAAACTCCCAGTCCGCGACTCCTGAGGAAGAAAAG
CCCAAGGAGGAAGAAAAGCCTAAGGAAGAGTCTGCCTTTACTTCGATAGGAAACTCCCAGCCCGTGACTCCTAAG
GAAGAAAAGCCTAAAGAGGAAGAAAAGCCCAAGGAGGAAGAAAAGCCCAAGGAAGAGTCTGCCTTTACTTCGGTA
GGAAACTCCCAGCCCGCGACTCCTAAGGAAGAAAAGCCTAAAGAGGAAGAAAAGCCCAAGGAGGAAGAAAAGCCT
AAGGAAGAGTCTGCCTTTACTTCGGTAGGAAACTCCCAGCCCGCGACTCCTCAGGATGAAGAGAAGCCCAAGGAG
GAAGAAAAGCCCAAGGAAGAGTCTGCCTTTACTTCGGTAGGAAACTCCCAGTCCGCTAGCTCCTCGGAGCCTAAG
GAAGAAGAAGCTCCCAAGAAAGAGGAGATGCCTACGAATTCTAAGGAGGAAGAGCCTACGACTTCTAAGGAGGAA
GAGCCTACGACTTCCAAGGAAGAGGAGAAGTCTACGACTCCCAAGGAAGAGGAGAAGTCTACGACTCCCAAGGAA
GAGGAGGAGCCTGCGACTTCTAAGGAGGAAGAGCCTACGACTTCCAAGGAAGAGGAGGAGTCTACGACTCCCAAG
GAAGAAGAGGAGCCTGCGACTTCTAAGGAGGAAGAGCCTACGACTTCCAAGGAAGAGGAGGAGTCTACGACTCCC
AAGGAAGAGGAGGAGCCTGCCACTTCTGAGGAGGAAGAGCCTACGACTCCTAAGGAGGAAGAGCCTACGACTTCC
AAGGAAGAGGAGAAGCCTGCCACTTCCTCCAAGCCGGCCGAGCTTCCCAAGCCCGTCACGCTGTCAAAGTCAATC
AGGGTTTTGGAGCCCACCTCCAAGTCCAGCCAGTCTGCCCAGCCAGCCGCCACCTCTAGCCTCGGCAAGACGTCC
CAGGCAGCAGCAGCCACAAGCTCCGTCAAGAGCATCCCCACCAGCAGCTTCAAGACGCTCGCTGCTACTGCGGAT
GACAAGGTTGGCGAGAATGGCGCAAAAACCACGCCCGCCTCTTCCAACGACATGGCGACTGTTGTGGTTGACAGC
GTAATGAGCAAAGTGACTGGCTGCCCTGCCTCGACGAGCTGCGCCGGCGACGTCTACACCACCAAGACTGTTCCA
GTATACACTGTTATTTGCCCACAAGACATGCTGGATGTCTTTATCAAGCCCACGGCCGCCCCCGACGCAAGTGGC
AGTGACAAGCCCAACGCTTCTTCTCCCGACGCTTCTTCCCCTCAGCCTGCCGCCGTCCCTGGCACCGCTGGCAAG
GACGTGTCGCAGATTAACATTAGCGCCACTGTCATCATTATTTACACCGTCACGAGCTGCCCCCAGGCCAACGGA
CAGTGCGCACTTGGTAGCACCATGACCAAGGAGGTGCCTGTAAACTACCGCCCTGCCGAGAAGAAGGATCTTACA
ATCACGCTCGAGTATAGCGAGGGCTGCGTCAATATTTCCGACGTGGCCAAGATTGAGTCGTCGTCTGGCAACAAC
ACGGTTTCCAGCAACGAGCCCGGACCTGACAATGTCAACCAGCCTCGTCCTGCTGGCCAAACGACTCCTGCGGGT
GGCGAGGGTTTGGATAACGGCTCTGGTGCCCCCTCTGGACCCCAGGGAGATGCTACCGCTGACAATGATGAGCCT
TGCCCTACCTGCACTGGCTCTGGCAACACGAGCTCGGACAATGTATCCCAAGGAGACGCCACCATCAATAAGCCT
TGCCCTACTTGCACTGGCACTGGCAACACGGGCTCAGACAATGCATCTCAAGGAGACGCCAACCCCAACACCCAG
CCCCATGATAGCCCCAAGACTCCCACGGGTCCCAAGAGCTCAGACACTGAATCCCAGGGCGACGCGTCCATTCCT
GCTTCCCCCGCCGTCAAGACGTCTGGAACTGGCCGCTCGGGCACTCTCAAGTGCATGCGCGCCAGGGCGGTTTCC
AATGCTGGCGCTTAA
Transcript >OphauB2|8109
ATGGTTACCGTCAATCGCTTCGTCACCGCAGCTGTCCTGGCCTGTGCCTGGGGCGCTGCTGGAAAGGAATCCGAA
AAGCCAGTAAAAGGCCTAGGCCTCGACAATGGCAGCAATGGTGTCGCCAGCTCCGTCCACGGGCTTGTTCAGGCC
GCCAACCCTGCGTTTCAAGTCAACGACGGCAGCTATCTCACCCGCCGACAGTCTGACGACGACGACCCGTTTGGA
GAGTCTTCTGAAGACGAAGAGTCTGATGATGACCCGTTTGCAACGGGGAATGAAGCCCCGCGGCCTCCCTCGAGG
CCTAACCCAGTGGCAGAGGCCCCCAAGGAAGACAAGCCTAAGGAGGAAGAAAGGCCCAAGGGACAGTCTGCCTTT
TTCCCTTCGACGGGAAATTCACAGCCCACGACTCCCGAGGAGGAAGACAAGCCTAAGGAGGAAGAAAAGCCCAAG
GGACAGTCTGCCTTTTTCCCTGCGACGGGAAATTCGCAGCCCGCCACTCCCGAGGATGAAGAAAAGCCTAAAGAG
GAAGAAAAGCCCGAGGAAGAGTCCGCCTTTACTTCGATAGGAAACTCCCAGTCCGCGACTCCTGAGGAAGAAAAG
CCCAAGGAGGAAGAAAAGCCTAAGGAAGAGTCTGCCTTTACTTCGATAGGAAACTCCCAGCCCGTGACTCCTAAG
GAAGAAAAGCCTAAAGAGGAAGAAAAGCCCAAGGAGGAAGAAAAGCCCAAGGAAGAGTCTGCCTTTACTTCGGTA
GGAAACTCCCAGCCCGCGACTCCTAAGGAAGAAAAGCCTAAAGAGGAAGAAAAGCCCAAGGAGGAAGAAAAGCCT
AAGGAAGAGTCTGCCTTTACTTCGGTAGGAAACTCCCAGCCCGCGACTCCTCAGGATGAAGAGAAGCCCAAGGAG
GAAGAAAAGCCCAAGGAAGAGTCTGCCTTTACTTCGGTAGGAAACTCCCAGTCCGCTAGCTCCTCGGAGCCTAAG
GAAGAAGAAGCTCCCAAGAAAGAGGAGATGCCTACGAATTCTAAGGAGGAAGAGCCTACGACTTCTAAGGAGGAA
GAGCCTACGACTTCCAAGGAAGAGGAGAAGTCTACGACTCCCAAGGAAGAGGAGAAGTCTACGACTCCCAAGGAA
GAGGAGGAGCCTGCGACTTCTAAGGAGGAAGAGCCTACGACTTCCAAGGAAGAGGAGGAGTCTACGACTCCCAAG
GAAGAAGAGGAGCCTGCGACTTCTAAGGAGGAAGAGCCTACGACTTCCAAGGAAGAGGAGGAGTCTACGACTCCC
AAGGAAGAGGAGGAGCCTGCCACTTCTGAGGAGGAAGAGCCTACGACTCCTAAGGAGGAAGAGCCTACGACTTCC
AAGGAAGAGGAGAAGCCTGCCACTTCCTCCAAGCCGGCCGAGCTTCCCAAGCCCGTCACGCTGTCAAAGTCAATC
AGGGTTTTGGAGCCCACCTCCAAGTCCAGCCAGTCTGCCCAGCCAGCCGCCACCTCTAGCCTCGGCAAGACGTCC
CAGGCAGCAGCAGCCACAAGCTCCGTCAAGAGCATCCCCACCAGCAGCTTCAAGACGCTCGCTGCTACTGCGGAT
GACAAGGTTGGCGAGAATGGCGCAAAAACCACGCCCGCCTCTTCCAACGACATGGCGACTGTTGTGGTTGACAGC
GTAATGAGCAAAGTGACTGGCTGCCCTGCCTCGACGAGCTGCGCCGGCGACGTCTACACCACCAAGACTGTTCCA
GTATACACTGTTATTTGCCCACAAGACATGCTGGATGTCTTTATCAAGCCCACGGCCGCCCCCGACGCAAGTGGC
AGTGACAAGCCCAACGCTTCTTCTCCCGACGCTTCTTCCCCTCAGCCTGCCGCCGTCCCTGGCACCGCTGGCAAG
GACGTGTCGCAGATTAACATTAGCGCCACTGTCATCATTATTTACACCGTCACGAGCTGCCCCCAGGCCAACGGA
CAGTGCGCACTTGGTAGCACCATGACCAAGGAGGTGCCTGTAAACTACCGCCCTGCCGAGAAGAAGGATCTTACA
ATCACGCTCGAGTATAGCGAGGGCTGCGTCAATATTTCCGACGTGGCCAAGATTGAGTCGTCGTCTGGCAACAAC
ACGGTTTCCAGCAACGAGCCCGGACCTGACAATGTCAACCAGCCTCGTCCTGCTGGCCAAACGACTCCTGCGGGT
GGCGAGGGTTTGGATAACGGCTCTGGTGCCCCCTCTGGACCCCAGGGAGATGCTACCGCTGACAATGATGAGCCT
TGCCCTACCTGCACTGGCTCTGGCAACACGAGCTCGGACAATGTATCCCAAGGAGACGCCACCATCAATAAGCCT
TGCCCTACTTGCACTGGCACTGGCAACACGGGCTCAGACAATGCATCTCAAGGAGACGCCAACCCCAACACCCAG
CCCCATGATAGCCCCAAGACTCCCACGGGTCCCAAGAGCTCAGACACTGAATCCCAGGGCGACGCGTCCATTCCT
GCTTCCCCCGCCGTCAAGACGTCTGGAACTGGCCGCTCGGGCACTCTCAAGTGCATGCGCGCCAGGGCGGTTTCC
AATGCTGGCGCTTAA
Gene >OphauB2|8109
ATGGTTACCGTCAATCGCTTCGTCACCGCAGCTGTCCTGGCCTGTGCCTGGGGCGCTGCTGGAAAGGAATCCGAA
AAGCCAGTAAAAGGCCTAGGCCTCGACAATGCAAGTCTTGCCCCCTTCATTGCTATACAAGTAAAAACAAAATAA
AAAAAGAAGGACTAACACAGCCATGGTGTAGGGCAGCAATGGTGTCGCCAGCTCCGTCCACGGGCTTGTTCAGGC
CGCCAACCCTGCGTTTCAAGTCAACGACGGCAGCTATCTCACCCGCCGACAGTCTGACGACGACGACCCGTTTGG
AGAGTCTTCTGAAGACGAAGAGTCTGATGATGACCCGTTTGCAACGGGGAATGAAGCCCCGCGGCCTCCCTCGAG
GCCTAACCCAGTGGCAGAGGCCCCCAAGGAAGACAAGCCTAAGGAGGAAGAAAGGCCCAAGGGACAGTCTGCCTT
TTTCCCTTCGACGGGAAATTCACAGCCCACGACTCCCGAGGAGGAAGACAAGCCTAAGGAGGAAGAAAAGCCCAA
GGGACAGTCTGCCTTTTTCCCTGCGACGGGAAATTCGCAGCCCGCCACTCCCGAGGATGAAGAAAAGCCTAAAGA
GGAAGAAAAGCCCGAGGAAGAGTCCGCCTTTACTTCGATAGGAAACTCCCAGTCCGCGACTCCTGAGGAAGAAAA
GCCCAAGGAGGAAGAAAAGCCTAAGGAAGAGTCTGCCTTTACTTCGATAGGAAACTCCCAGCCCGTGACTCCTAA
GGAAGAAAAGCCTAAAGAGGAAGAAAAGCCCAAGGAGGAAGAAAAGCCCAAGGAAGAGTCTGCCTTTACTTCGGT
AGGAAACTCCCAGCCCGCGACTCCTAAGGAAGAAAAGCCTAAAGAGGAAGAAAAGCCCAAGGAGGAAGAAAAGCC
TAAGGAAGAGTCTGCCTTTACTTCGGTAGGAAACTCCCAGCCCGCGACTCCTCAGGATGAAGAGAAGCCCAAGGA
GGAAGAAAAGCCCAAGGAAGAGTCTGCCTTTACTTCGGTAGGAAACTCCCAGTCCGCTAGCTCCTCGGAGCCTAA
GGAAGAAGAAGCTCCCAAGAAAGAGGAGATGCCTACGAATTCTAAGGAGGAAGAGCCTACGACTTCTAAGGAGGA
AGAGCCTACGACTTCCAAGGAAGAGGAGAAGTCTACGACTCCCAAGGAAGAGGAGAAGTCTACGACTCCCAAGGA
AGAGGAGGAGCCTGCGACTTCTAAGGAGGAAGAGCCTACGACTTCCAAGGAAGAGGAGGAGTCTACGACTCCCAA
GGAAGAAGAGGAGCCTGCGACTTCTAAGGAGGAAGAGCCTACGACTTCCAAGGAAGAGGAGGAGTCTACGACTCC
CAAGGAAGAGGAGGAGCCTGCCACTTCTGAGGAGGAAGAGCCTACGACTCCTAAGGAGGAAGAGCCTACGACTTC
CAAGGAAGAGGAGAAGCCTGCCACTTCCTCCAAGCCGGCCGAGCTTCCCAAGCCCGTCACGCTGTCAAAGTCAAT
CAGGGTTTTGGAGCCCACCTCCAAGTCCAGCCAGTCTGCCCAGCCAGCCGCCACCTCTAGCCTCGGCAAGACGTC
CCAGGCAGCAGCAGCCACAAGCTCCGTCAAGAGCATCCCCACCAGCAGCTTCAAGACGCTCGCTGCTACTGCGGA
TGACAAGGTTGGCGAGAATGGCGCAAAAACCACGCCCGCCTCTTCCAACGACATGGCGACTGTTGTGGTTGACAG
CGTAATGAGCAAAGTGACTGGCTGCCCTGCCTCGACGAGCTGCGCCGGCGACGTCTACACCACCAAGACTGTTCC
AGTATACACTGTTATTTGCCCACAAGACATGCTGGATGTCTTTATCAAGCCCACGGCCGCCCCCGACGCAAGTGG
CAGTGACAAGCCCAACGCTTCTTCTCCCGACGCTTCTTCCCCTCAGCCTGCCGCCGTCCCTGGCACCGCTGGCAA
GGACGTGTCGCAGATTAACATTAGCGCCACTGTCATCATTATTTACACCGTCACGAGCTGCCCCCAGGCCAACGG
ACAGTGCGCACTTGGTAGCACCATGACCAAGGAGGTGCCTGTAAACTACCGCCCTGCCGAGAAGAAGGATCTTAC
AATCACGCTCGAGTATAGCGAGGGCTGCGTCAATATTTCCGACGTGGCCAAGATTGAGTCGTCGTCTGGCAACAA
CACGGTTTCCAGCAACGAGCCCGGACCTGACAATGTCAACCAGCCTCGTCCTGCTGGCCAAACGACTCCTGCGGG
TGGCGAGGGTTTGGATAACGGCTCTGGTGCCCCCTCTGGACCCCAGGGAGATGCTACCGCTGACAATGATGAGCC
TTGCCCTACCTGCACTGGCTCTGGCAACACGAGCTCGGACAATGTATCCCAAGGAGACGCCACCATCAATAAGCC
TTGCCCTACTTGCACTGGCACTGGCAACACGGGCTCAGACAATGCATCTCAAGGAGACGCCAACCCCAACACCCA
GCCCCATGATAGCCCCAAGACTCCCACGGGTCCCAAGAGCTCAGACACTGAATCCCAGGGCGACGCGTCCATTCC
TGCTTCCCCCGCCGTCAAGACGTCTGGAACTGGCCGCTCGGGCACTCTCAAGTGCATGCGCGCCAGGGCGGTTTC
CAATGCTGGCGCTTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail