Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8107
Gene name
LocationContig_97:61331..66360
Strand+
Gene length (bp)5029
Transcript length (bp)4872
Coding sequence length (bp)4872
Protein length (aa) 1624

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 1.6E-08 1556 1603
PF11793 FANCL_C FANCL C-terminal domain 3.1E-05 1555 1606
PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger 9.0E-05 1555 1604

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74349|LTN1_SCHPO E3 ubiquitin-protein ligase listerin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkr1 PE=3 SV=1 1081 1609 3.0E-70
sp|Q04781|LTN1_YEAST E3 ubiquitin-protein ligase listerin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RKR1 PE=1 SV=1 1088 1608 2.0E-53
sp|A0JM49|LTN1_XENTR E3 ubiquitin-protein ligase listerin OS=Xenopus tropicalis GN=ltn1 PE=2 SV=1 1289 1603 8.0E-43
sp|Q6A009|LTN1_MOUSE E3 ubiquitin-protein ligase listerin OS=Mus musculus GN=Ltn1 PE=1 SV=3 1247 1603 4.0E-41
sp|E1C231|LTN1_CHICK E3 ubiquitin-protein ligase listerin OS=Gallus gallus GN=LTN1 PE=3 SV=1 1310 1603 2.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74349|LTN1_SCHPO E3 ubiquitin-protein ligase listerin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkr1 PE=3 SV=1 1081 1609 3.0E-70
sp|Q04781|LTN1_YEAST E3 ubiquitin-protein ligase listerin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RKR1 PE=1 SV=1 1088 1608 2.0E-53
sp|A0JM49|LTN1_XENTR E3 ubiquitin-protein ligase listerin OS=Xenopus tropicalis GN=ltn1 PE=2 SV=1 1289 1603 8.0E-43
sp|Q6A009|LTN1_MOUSE E3 ubiquitin-protein ligase listerin OS=Mus musculus GN=Ltn1 PE=1 SV=3 1247 1603 4.0E-41
sp|E1C231|LTN1_CHICK E3 ubiquitin-protein ligase listerin OS=Gallus gallus GN=LTN1 PE=3 SV=1 1310 1603 2.0E-40
sp|O94822|LTN1_HUMAN E3 ubiquitin-protein ligase listerin OS=Homo sapiens GN=LTN1 PE=1 SV=6 1247 1603 1.0E-39
sp|Q9FGI1|LTN1_ARATH E3 ubiquitin-protein ligase listerin OS=Arabidopsis thaliana GN=At5g58410 PE=3 SV=1 1402 1605 8.0E-32
sp|Q555H8|LTN1_DICDI E3 ubiquitin-protein ligase listerin OS=Dictyostelium discoideum GN=rnf160 PE=3 SV=1 1401 1603 5.0E-30
sp|Q9VW09|LTN1_DROME E3 ubiquitin-protein ligase listerin OS=Drosophila melanogaster GN=l(3)76BDr PE=1 SV=2 1315 1604 4.0E-28
sp|Q65XX2|LTN1_CAEEL E3 ubiquitin-protein ligase listerin OS=Caenorhabditis elegans GN=Y54E10A.11 PE=3 SV=1 1436 1604 1.0E-25
sp|Q04781|LTN1_YEAST E3 ubiquitin-protein ligase listerin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RKR1 PE=1 SV=1 32 263 3.0E-21
sp|Q6A009|LTN1_MOUSE E3 ubiquitin-protein ligase listerin OS=Mus musculus GN=Ltn1 PE=1 SV=3 17 431 3.0E-21
sp|B6IFN4|LTN1_CAEBR E3 ubiquitin-protein ligase listerin OS=Caenorhabditis briggsae GN=CBG25264 PE=3 SV=1 1436 1604 7.0E-21
sp|O94822|LTN1_HUMAN E3 ubiquitin-protein ligase listerin OS=Homo sapiens GN=LTN1 PE=1 SV=6 17 424 5.0E-19
sp|O74349|LTN1_SCHPO E3 ubiquitin-protein ligase listerin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkr1 PE=3 SV=1 5 234 1.0E-18
sp|E1C231|LTN1_CHICK E3 ubiquitin-protein ligase listerin OS=Gallus gallus GN=LTN1 PE=3 SV=1 17 424 1.0E-16
sp|A0JM49|LTN1_XENTR E3 ubiquitin-protein ligase listerin OS=Xenopus tropicalis GN=ltn1 PE=2 SV=1 86 400 2.0E-14
sp|Q9VW09|LTN1_DROME E3 ubiquitin-protein ligase listerin OS=Drosophila melanogaster GN=l(3)76BDr PE=1 SV=2 4 258 7.0E-14
sp|Q555H8|LTN1_DICDI E3 ubiquitin-protein ligase listerin OS=Dictyostelium discoideum GN=rnf160 PE=3 SV=1 4 359 2.0E-09
sp|Q9FGI1|LTN1_ARATH E3 ubiquitin-protein ligase listerin OS=Arabidopsis thaliana GN=At5g58410 PE=3 SV=1 11 355 3.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005680 anaphase-promoting complex Yes
GO:0004842 ubiquitin-protein transferase activity Yes
GO:0044446 intracellular organelle part No
GO:0005575 cellular_component No
GO:0031461 cullin-RING ubiquitin ligase complex No
GO:1990234 transferase complex No
GO:0140096 catalytic activity, acting on a protein No
GO:0044428 nuclear part No
GO:0000152 nuclear ubiquitin ligase complex No
GO:0000151 ubiquitin ligase complex No
GO:0032991 protein-containing complex No
GO:0003674 molecular_function No
GO:0019787 ubiquitin-like protein transferase activity No
GO:1902494 catalytic complex No
GO:0044424 intracellular part No
GO:0044464 cell part No
GO:0016740 transferase activity No
GO:0044422 organelle part No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8107
MDRAQSGKGAASRLAVGAAAFGSASSSPLSYLTEPPSLNAVSDPHVVVSLKNLNKKDSITKTKALEDLLQHVQTH
AQDEVASVDEALLDVWAQLYPRTSIDNSRRVRELSHTLQFELVKTARKRMERHIPKIVGAWLAGLYDRDRVVARA
ARNGLSSLLSSPEKMSAFWVKCRSQILDFATQAVQETQDTLSDERSTTFEDAEAKYFRVIAASLSLVLGLLNRDE
ESVKLARDKFDAFFAEDVVWKSVTFKDSHVRRAASQLLVACLGRHLPYAETSHARQAFITGGLKTNQTGSVRDYL
DALISLTTHKPDIWTTSSNDKKSSFNRLQAFIARGPQGDPPAFWQGLSQLLSCLPTDLLTLESSSSLLKSLQTGA
TSRDQTRSDAPSAWKCYTSTVRRCLAALPAQDHLSLAKDRLFPLIQQLLFPITDSLELQPQDTIAQSVIADIHLA
LMQSSPHISEALCDEWTRMGTLFCTNISASFPEVSEKLQDLQTKIGKQGHHWFGVVGNLHCKLQDVASSMTDPSL
EPSIKVVEHSISLLKSCNLKPFGAAQVLEYAMDTSPHLFIGKSRKTVVNFLLGVAQDPEGLFQSPSWEPLLSCVV
NMSVISELADDNEAICDAWIEGALALPPSLRNKALVDLVSKPRIAFIAQQSSGVQELLLAEFQVANTSTETDEQA
SAKELLMTAILHKALHMTSRHQLSALLVKLLGSQPENTDVILELLEALIRTHAELFSLKDSLRTDLLAQLLATSE
IAEDATSAKAASIRSILDGEQQDLSSVVGILRSNLEQATSQSLEIGTMVDLAMNATETGASWEQIFPNTDIWTSQ
LLHFMERPINPSLSITSRIGGVILLAKSGSDTQSFRNLPRDRKGRSIATRMALYTSQLLNEALQDINVSQQRHAQ
LLYLIGISCRLASNQIMCSDDDGLWTSLDQDTAMSEAQELIESYNRLLYTLIQSASRPLTDEDKKAFGVLHEVAK
VMMKEASQLTVGGAHSAEALAGLLEALAETSCAHQLESLLVQQEVLKTKPNTILAAAGLVAGFGERLSASKDISN
FCNRLVSDTAAAVPGQENTLATLDLLTLCAQVYHSKRCPVANNRVVFAVKQITSWMDSADKLDANLRASMCRTLT
QLLPWMKDVYGSYWEMTLDFCASLWQGAGSLALAESLPIIHASLKLLITLETVEEPNDDLQDALKEFDAEKSKRL
MELLKLPRNKVSQPLKMVDSMLCREIDKIRVSRIPEPEELFPLVGSKSHEVQTAAFSMLHKKIAEQQQQESVNVL
LDKREARLPGELISLLLEAPTLDKFSDEDLALFPCSVRCYLLAWKLLFDAFDASSFKVRSDFTEQIKEQGYMTPL
LDFLFDVLGHSAAHPLNLDKEKLGPQQIRHWDVDMAEAETAEQGMHWLLVHVFYLVVKFTPGLFKAWFMNCRSKQ
TRIAVEAWTQKYFSPLIIADTLDDVEQWADSQEQSEGEQPLQIKVLRTAREVTAGYEVDELQATIAIALPPTYPL
EGVSVTGVRRVAVSERKWQSWVLATQGVIAFSGGSIIDGLLAFRRNVAGAMRGQGECAICYSIISADRRMPDKRC
TTCKNSFHRSCLYKWFTTSSQNTCPLCRNPIDYLGADTVKRRHGAPEM*
Coding >OphauB2|8107
ATGGACCGCGCCCAGTCGGGCAAAGGTGCTGCGTCGAGACTCGCTGTAGGTGCTGCCGCGTTTGGCAGCGCTTCT
AGCAGCCCTCTGTCCTACCTGACTGAGCCGCCGTCCTTGAATGCCGTTTCAGATCCCCACGTCGTCGTGTCTCTC
AAAAACCTGAACAAAAAGGACAGCATCACCAAGACAAAGGCTCTAGAGGATTTGCTGCAGCATGTTCAGACTCAC
GCCCAAGATGAAGTGGCCAGCGTGGATGAGGCCCTTCTCGACGTCTGGGCCCAGCTGTACCCGCGCACGTCGATT
GACAACTCGCGCCGAGTTCGAGAATTATCCCACACCCTGCAATTCGAGTTGGTCAAGACGGCCCGCAAGCGCATG
GAACGGCACATTCCCAAGATTGTAGGCGCATGGCTGGCTGGGCTCTATGATCGCGACAGAGTAGTGGCACGAGCA
GCCAGGAATGGACTGTCGTCCTTGCTCAGCTCCCCAGAAAAAATGTCGGCCTTCTGGGTCAAGTGTCGGTCACAG
ATTCTCGACTTTGCCACCCAGGCTGTCCAAGAAACCCAAGACACCTTGAGTGATGAGAGGTCAACCACTTTCGAG
GATGCCGAAGCCAAGTACTTTCGAGTCATTGCTGCCAGCCTCTCTCTCGTCCTCGGCCTGCTCAATAGAGACGAA
GAAAGTGTTAAACTGGCACGCGACAAGTTTGATGCATTCTTTGCCGAGGATGTCGTGTGGAAGAGCGTCACATTC
AAGGACTCGCACGTCAGAAGGGCCGCATCTCAGTTGCTGGTGGCATGCCTCGGGCGTCATCTGCCTTATGCCGAG
ACCTCCCACGCAAGACAAGCCTTCATCACTGGCGGCCTCAAGACAAACCAGACGGGATCTGTACGAGACTATCTC
GATGCGTTGATAAGTCTCACAACGCACAAGCCCGACATTTGGACAACGAGCTCCAATGATAAGAAGTCGTCATTT
AATCGATTGCAGGCATTCATTGCCAGGGGTCCTCAGGGAGATCCGCCTGCATTTTGGCAGGGCCTGAGCCAGTTG
CTCTCTTGCCTACCTACAGATCTTTTGACCCTTGAATCATCATCTTCTCTATTAAAATCTCTACAAACTGGCGCT
ACTAGCCGTGACCAAACTCGCTCGGATGCACCGTCTGCCTGGAAATGCTACACCAGCACAGTGAGGCGCTGTCTT
GCTGCTCTTCCAGCGCAAGACCACCTTAGCCTGGCAAAGGATCGTTTGTTTCCGCTCATACAACAACTCCTTTTT
CCTATTACGGACAGCCTAGAATTGCAACCTCAGGATACCATTGCCCAATCAGTTATTGCGGATATTCACCTCGCT
CTAATGCAATCCTCCCCTCACATTTCAGAAGCTCTGTGTGATGAATGGACACGCATGGGCACCTTGTTTTGTACG
AATATATCGGCCTCTTTTCCTGAAGTTTCCGAAAAGCTTCAAGATTTACAGACCAAAATTGGCAAACAAGGACAC
CATTGGTTTGGTGTGGTGGGAAATCTTCATTGCAAGCTCCAAGATGTGGCAAGCTCCATGACTGATCCCAGCCTT
GAGCCTTCGATCAAAGTTGTCGAACACTCAATCTCGCTCCTCAAAAGTTGCAATTTGAAACCTTTCGGCGCCGCT
CAAGTCTTGGAGTATGCCATGGACACATCGCCCCATTTATTCATAGGCAAGAGTCGCAAAACGGTTGTTAATTTC
TTGCTTGGCGTTGCGCAGGATCCCGAGGGCCTATTCCAATCACCTTCCTGGGAGCCCCTTTTGTCTTGTGTGGTC
AACATGAGCGTGATCTCGGAGCTCGCGGATGACAACGAAGCTATTTGCGATGCCTGGATAGAAGGTGCATTGGCT
CTCCCTCCGTCGCTACGGAATAAGGCATTAGTAGATCTCGTATCAAAACCGCGGATCGCATTCATTGCTCAACAG
TCTTCTGGAGTCCAGGAGCTCCTGCTTGCTGAATTCCAGGTAGCAAACACCTCGACGGAAACAGACGAGCAAGCA
AGTGCCAAGGAATTGCTCATGACAGCCATATTACACAAGGCTCTGCACATGACATCACGTCACCAATTGTCTGCC
CTCTTGGTCAAACTCTTGGGAAGTCAGCCTGAAAATACTGATGTCATTTTGGAGCTTTTAGAGGCTCTTATTAGG
ACACATGCGGAGCTATTCTCACTAAAAGACAGTCTGCGCACAGATCTGCTGGCTCAATTGCTAGCAACATCAGAA
ATTGCGGAAGACGCCACGTCAGCCAAGGCGGCATCAATACGATCAATTCTCGACGGCGAACAACAAGACTTGTCA
TCAGTAGTTGGCATATTGAGGTCAAATCTCGAGCAAGCCACCTCCCAATCACTAGAAATAGGAACCATGGTGGAC
CTTGCCATGAACGCAACCGAGACCGGCGCATCATGGGAACAAATCTTTCCCAATACCGATATCTGGACGTCTCAG
CTTTTACATTTCATGGAGCGCCCTATTAACCCGTCCTTGTCTATTACAAGTCGTATTGGTGGCGTCATCCTGCTG
GCAAAGTCGGGCTCTGACACTCAATCATTTCGAAACCTGCCGAGGGATCGCAAGGGACGCTCTATTGCCACGCGG
ATGGCTCTCTATACTAGTCAGCTTTTGAATGAAGCGTTGCAGGATATCAATGTTTCGCAACAGCGCCATGCCCAA
TTGTTATATTTGATCGGCATTTCTTGTCGACTTGCTTCGAACCAGATAATGTGCTCCGACGACGATGGATTGTGG
ACGTCGCTGGATCAAGACACCGCCATGTCAGAAGCTCAAGAGCTGATTGAGTCGTACAATAGACTACTCTATACC
CTCATTCAATCGGCGTCTCGACCACTGACTGATGAAGACAAAAAGGCGTTTGGCGTTTTGCATGAAGTCGCCAAA
GTAATGATGAAAGAGGCCTCACAATTGACTGTTGGCGGTGCGCACAGCGCAGAAGCACTGGCCGGACTTCTGGAG
GCTTTGGCCGAGACAAGCTGCGCGCACCAACTGGAGAGCCTTCTTGTCCAGCAAGAGGTGCTCAAAACGAAGCCT
AATACTATTTTGGCTGCGGCTGGGCTTGTTGCAGGCTTTGGTGAGAGGCTCTCGGCGTCCAAGGATATCTCCAAC
TTTTGCAACCGGCTGGTGAGCGACACAGCTGCCGCGGTCCCCGGACAAGAGAACACACTGGCAACGTTGGATCTC
TTGACGCTCTGCGCTCAAGTATATCATTCGAAACGCTGTCCGGTTGCGAATAACCGAGTTGTATTTGCCGTGAAG
CAGATTACATCTTGGATGGACAGTGCCGACAAGCTGGATGCCAATTTGAGAGCCTCAATGTGTCGAACATTGACG
CAACTGCTTCCGTGGATGAAGGACGTCTACGGGTCCTATTGGGAGATGACGCTGGACTTTTGCGCCAGCTTGTGG
CAAGGTGCTGGCAGTTTGGCGCTTGCAGAATCGCTTCCCATTATTCATGCTTCACTCAAGCTATTGATTACGTTG
GAAACAGTTGAAGAGCCAAATGACGATTTGCAGGACGCCTTGAAAGAATTTGACGCGGAAAAGTCGAAAAGATTG
ATGGAGCTACTCAAGTTGCCTCGCAATAAGGTGTCGCAGCCGTTGAAAATGGTGGATTCCATGTTGTGTCGAGAA
ATTGACAAGATTCGCGTTTCACGAATCCCCGAGCCAGAAGAACTATTTCCGCTTGTGGGGTCCAAGTCGCATGAA
GTGCAGACGGCGGCTTTTAGCATGCTGCACAAAAAGATAGCAGAGCAGCAACAGCAGGAATCCGTCAATGTGCTT
CTGGACAAGAGGGAGGCCAGGTTACCGGGCGAACTGATTTCACTACTGCTCGAGGCGCCGACATTGGACAAGTTC
TCGGATGAGGATCTCGCGCTATTTCCATGCAGTGTGCGCTGCTATCTCCTGGCATGGAAGTTGCTATTCGACGCC
TTTGACGCCTCGTCTTTCAAAGTGCGCAGCGATTTCACAGAACAGATAAAGGAGCAAGGCTACATGACGCCTCTG
CTTGACTTTTTGTTTGATGTCTTGGGCCACTCGGCTGCGCACCCGCTCAATCTCGACAAGGAAAAGCTCGGTCCG
CAGCAGATTCGGCATTGGGATGTAGACATGGCCGAGGCCGAGACTGCGGAACAAGGCATGCACTGGCTGCTAGTG
CACGTCTTTTACCTCGTGGTCAAATTCACGCCTGGGCTCTTCAAGGCGTGGTTTATGAATTGCCGCTCAAAGCAG
ACGCGCATTGCTGTCGAGGCATGGACGCAAAAGTATTTCTCACCACTAATCATTGCCGACACGCTCGACGACGTG
GAGCAGTGGGCAGACAGCCAGGAGCAGAGCGAGGGCGAGCAGCCACTGCAGATCAAGGTGCTACGGACAGCGCGC
GAGGTGACGGCCGGGTACGAAGTGGACGAGCTGCAGGCAACAATTGCCATTGCTCTGCCGCCCACGTATCCGCTC
GAGGGCGTGTCGGTGACTGGAGTGCGGCGCGTGGCCGTGTCGGAGCGCAAGTGGCAGAGCTGGGTGCTTGCGACA
CAAGGCGTCATTGCCTTTTCAGGGGGCAGCATCATTGATGGCTTGCTCGCCTTTAGGCGCAACGTGGCGGGTGCG
ATGCGGGGCCAGGGCGAGTGCGCCATTTGCTACAGCATCATCTCGGCCGATCGGCGCATGCCCGACAAGCGATGC
ACAACGTGCAAAAACTCGTTTCACCGCTCGTGCTTGTATAAATGGTTTACGACGAGCAGCCAAAACACGTGTCCG
CTGTGCCGGAATCCGATTGATTACCTGGGCGCGGACACGGTCAAGAGGAGACATGGGGCCCCCGAGATGTGA
Transcript >OphauB2|8107
ATGGACCGCGCCCAGTCGGGCAAAGGTGCTGCGTCGAGACTCGCTGTAGGTGCTGCCGCGTTTGGCAGCGCTTCT
AGCAGCCCTCTGTCCTACCTGACTGAGCCGCCGTCCTTGAATGCCGTTTCAGATCCCCACGTCGTCGTGTCTCTC
AAAAACCTGAACAAAAAGGACAGCATCACCAAGACAAAGGCTCTAGAGGATTTGCTGCAGCATGTTCAGACTCAC
GCCCAAGATGAAGTGGCCAGCGTGGATGAGGCCCTTCTCGACGTCTGGGCCCAGCTGTACCCGCGCACGTCGATT
GACAACTCGCGCCGAGTTCGAGAATTATCCCACACCCTGCAATTCGAGTTGGTCAAGACGGCCCGCAAGCGCATG
GAACGGCACATTCCCAAGATTGTAGGCGCATGGCTGGCTGGGCTCTATGATCGCGACAGAGTAGTGGCACGAGCA
GCCAGGAATGGACTGTCGTCCTTGCTCAGCTCCCCAGAAAAAATGTCGGCCTTCTGGGTCAAGTGTCGGTCACAG
ATTCTCGACTTTGCCACCCAGGCTGTCCAAGAAACCCAAGACACCTTGAGTGATGAGAGGTCAACCACTTTCGAG
GATGCCGAAGCCAAGTACTTTCGAGTCATTGCTGCCAGCCTCTCTCTCGTCCTCGGCCTGCTCAATAGAGACGAA
GAAAGTGTTAAACTGGCACGCGACAAGTTTGATGCATTCTTTGCCGAGGATGTCGTGTGGAAGAGCGTCACATTC
AAGGACTCGCACGTCAGAAGGGCCGCATCTCAGTTGCTGGTGGCATGCCTCGGGCGTCATCTGCCTTATGCCGAG
ACCTCCCACGCAAGACAAGCCTTCATCACTGGCGGCCTCAAGACAAACCAGACGGGATCTGTACGAGACTATCTC
GATGCGTTGATAAGTCTCACAACGCACAAGCCCGACATTTGGACAACGAGCTCCAATGATAAGAAGTCGTCATTT
AATCGATTGCAGGCATTCATTGCCAGGGGTCCTCAGGGAGATCCGCCTGCATTTTGGCAGGGCCTGAGCCAGTTG
CTCTCTTGCCTACCTACAGATCTTTTGACCCTTGAATCATCATCTTCTCTATTAAAATCTCTACAAACTGGCGCT
ACTAGCCGTGACCAAACTCGCTCGGATGCACCGTCTGCCTGGAAATGCTACACCAGCACAGTGAGGCGCTGTCTT
GCTGCTCTTCCAGCGCAAGACCACCTTAGCCTGGCAAAGGATCGTTTGTTTCCGCTCATACAACAACTCCTTTTT
CCTATTACGGACAGCCTAGAATTGCAACCTCAGGATACCATTGCCCAATCAGTTATTGCGGATATTCACCTCGCT
CTAATGCAATCCTCCCCTCACATTTCAGAAGCTCTGTGTGATGAATGGACACGCATGGGCACCTTGTTTTGTACG
AATATATCGGCCTCTTTTCCTGAAGTTTCCGAAAAGCTTCAAGATTTACAGACCAAAATTGGCAAACAAGGACAC
CATTGGTTTGGTGTGGTGGGAAATCTTCATTGCAAGCTCCAAGATGTGGCAAGCTCCATGACTGATCCCAGCCTT
GAGCCTTCGATCAAAGTTGTCGAACACTCAATCTCGCTCCTCAAAAGTTGCAATTTGAAACCTTTCGGCGCCGCT
CAAGTCTTGGAGTATGCCATGGACACATCGCCCCATTTATTCATAGGCAAGAGTCGCAAAACGGTTGTTAATTTC
TTGCTTGGCGTTGCGCAGGATCCCGAGGGCCTATTCCAATCACCTTCCTGGGAGCCCCTTTTGTCTTGTGTGGTC
AACATGAGCGTGATCTCGGAGCTCGCGGATGACAACGAAGCTATTTGCGATGCCTGGATAGAAGGTGCATTGGCT
CTCCCTCCGTCGCTACGGAATAAGGCATTAGTAGATCTCGTATCAAAACCGCGGATCGCATTCATTGCTCAACAG
TCTTCTGGAGTCCAGGAGCTCCTGCTTGCTGAATTCCAGGTAGCAAACACCTCGACGGAAACAGACGAGCAAGCA
AGTGCCAAGGAATTGCTCATGACAGCCATATTACACAAGGCTCTGCACATGACATCACGTCACCAATTGTCTGCC
CTCTTGGTCAAACTCTTGGGAAGTCAGCCTGAAAATACTGATGTCATTTTGGAGCTTTTAGAGGCTCTTATTAGG
ACACATGCGGAGCTATTCTCACTAAAAGACAGTCTGCGCACAGATCTGCTGGCTCAATTGCTAGCAACATCAGAA
ATTGCGGAAGACGCCACGTCAGCCAAGGCGGCATCAATACGATCAATTCTCGACGGCGAACAACAAGACTTGTCA
TCAGTAGTTGGCATATTGAGGTCAAATCTCGAGCAAGCCACCTCCCAATCACTAGAAATAGGAACCATGGTGGAC
CTTGCCATGAACGCAACCGAGACCGGCGCATCATGGGAACAAATCTTTCCCAATACCGATATCTGGACGTCTCAG
CTTTTACATTTCATGGAGCGCCCTATTAACCCGTCCTTGTCTATTACAAGTCGTATTGGTGGCGTCATCCTGCTG
GCAAAGTCGGGCTCTGACACTCAATCATTTCGAAACCTGCCGAGGGATCGCAAGGGACGCTCTATTGCCACGCGG
ATGGCTCTCTATACTAGTCAGCTTTTGAATGAAGCGTTGCAGGATATCAATGTTTCGCAACAGCGCCATGCCCAA
TTGTTATATTTGATCGGCATTTCTTGTCGACTTGCTTCGAACCAGATAATGTGCTCCGACGACGATGGATTGTGG
ACGTCGCTGGATCAAGACACCGCCATGTCAGAAGCTCAAGAGCTGATTGAGTCGTACAATAGACTACTCTATACC
CTCATTCAATCGGCGTCTCGACCACTGACTGATGAAGACAAAAAGGCGTTTGGCGTTTTGCATGAAGTCGCCAAA
GTAATGATGAAAGAGGCCTCACAATTGACTGTTGGCGGTGCGCACAGCGCAGAAGCACTGGCCGGACTTCTGGAG
GCTTTGGCCGAGACAAGCTGCGCGCACCAACTGGAGAGCCTTCTTGTCCAGCAAGAGGTGCTCAAAACGAAGCCT
AATACTATTTTGGCTGCGGCTGGGCTTGTTGCAGGCTTTGGTGAGAGGCTCTCGGCGTCCAAGGATATCTCCAAC
TTTTGCAACCGGCTGGTGAGCGACACAGCTGCCGCGGTCCCCGGACAAGAGAACACACTGGCAACGTTGGATCTC
TTGACGCTCTGCGCTCAAGTATATCATTCGAAACGCTGTCCGGTTGCGAATAACCGAGTTGTATTTGCCGTGAAG
CAGATTACATCTTGGATGGACAGTGCCGACAAGCTGGATGCCAATTTGAGAGCCTCAATGTGTCGAACATTGACG
CAACTGCTTCCGTGGATGAAGGACGTCTACGGGTCCTATTGGGAGATGACGCTGGACTTTTGCGCCAGCTTGTGG
CAAGGTGCTGGCAGTTTGGCGCTTGCAGAATCGCTTCCCATTATTCATGCTTCACTCAAGCTATTGATTACGTTG
GAAACAGTTGAAGAGCCAAATGACGATTTGCAGGACGCCTTGAAAGAATTTGACGCGGAAAAGTCGAAAAGATTG
ATGGAGCTACTCAAGTTGCCTCGCAATAAGGTGTCGCAGCCGTTGAAAATGGTGGATTCCATGTTGTGTCGAGAA
ATTGACAAGATTCGCGTTTCACGAATCCCCGAGCCAGAAGAACTATTTCCGCTTGTGGGGTCCAAGTCGCATGAA
GTGCAGACGGCGGCTTTTAGCATGCTGCACAAAAAGATAGCAGAGCAGCAACAGCAGGAATCCGTCAATGTGCTT
CTGGACAAGAGGGAGGCCAGGTTACCGGGCGAACTGATTTCACTACTGCTCGAGGCGCCGACATTGGACAAGTTC
TCGGATGAGGATCTCGCGCTATTTCCATGCAGTGTGCGCTGCTATCTCCTGGCATGGAAGTTGCTATTCGACGCC
TTTGACGCCTCGTCTTTCAAAGTGCGCAGCGATTTCACAGAACAGATAAAGGAGCAAGGCTACATGACGCCTCTG
CTTGACTTTTTGTTTGATGTCTTGGGCCACTCGGCTGCGCACCCGCTCAATCTCGACAAGGAAAAGCTCGGTCCG
CAGCAGATTCGGCATTGGGATGTAGACATGGCCGAGGCCGAGACTGCGGAACAAGGCATGCACTGGCTGCTAGTG
CACGTCTTTTACCTCGTGGTCAAATTCACGCCTGGGCTCTTCAAGGCGTGGTTTATGAATTGCCGCTCAAAGCAG
ACGCGCATTGCTGTCGAGGCATGGACGCAAAAGTATTTCTCACCACTAATCATTGCCGACACGCTCGACGACGTG
GAGCAGTGGGCAGACAGCCAGGAGCAGAGCGAGGGCGAGCAGCCACTGCAGATCAAGGTGCTACGGACAGCGCGC
GAGGTGACGGCCGGGTACGAAGTGGACGAGCTGCAGGCAACAATTGCCATTGCTCTGCCGCCCACGTATCCGCTC
GAGGGCGTGTCGGTGACTGGAGTGCGGCGCGTGGCCGTGTCGGAGCGCAAGTGGCAGAGCTGGGTGCTTGCGACA
CAAGGCGTCATTGCCTTTTCAGGGGGCAGCATCATTGATGGCTTGCTCGCCTTTAGGCGCAACGTGGCGGGTGCG
ATGCGGGGCCAGGGCGAGTGCGCCATTTGCTACAGCATCATCTCGGCCGATCGGCGCATGCCCGACAAGCGATGC
ACAACGTGCAAAAACTCGTTTCACCGCTCGTGCTTGTATAAATGGTTTACGACGAGCAGCCAAAACACGTGTCCG
CTGTGCCGGAATCCGATTGATTACCTGGGCGCGGACACGGTCAAGAGGAGACATGGGGCCCCCGAGATGTGA
Gene >OphauB2|8107
ATGGACCGCGCCCAGTCGGGCAAAGGTGCTGCGTCGAGACTCGCTGTAGGTGCTGCCGCGTTTGGCAGCGCTTCT
AGCAGCCCTCTGTCCTACCTGACTGAGCCGCCGTCCTTGAATGCCGTTTCAGATCCCCACGTCGTCGTGTCTCTC
AAAAACCTGAACAAAAAGGACAGCATCACCAAGACAAAGGCTCTAGAGGATTTGCTGCAGCATGTTCAGACTCAC
GCCCAAGATGAAGTGGCCAGCGTGGATGAGGCCCTTCTCGACGTCTGGGTAAGCTCTAGACCTCTAGCTAGCCCA
TGCCAATTCTAACCGTCTGCTAGGCCCAGCTGTACCCGCGCACGTCGATTGACAACTCGCGCCGAGTTCGAGAAT
TATCCCACACCCTGCAATTCGAGTTGGTCAAGACGGCCCGCAAGCGCATGGAACGGCACATTCCCAAGATTGTAG
GCGCATGGCTGGCTGGGCTCTATGATCGCGACAGAGTAGTGGCACGAGCAGCCAGGAATGGACTGTCGTCCTTGC
TCAGCTCCCCAGAAAAAATGTCGGCCTTCTGGGTCAAGTGTCGGTCACAGATTCTCGACTTTGCCACCCAGGCTG
TCCAAGAAACCCAAGACACCTTGAGTGATGAGAGGTCAACCACTTTCGAGGATGCCGAAGCCAAGTACTTTCGAG
TCATTGCTGCCAGCCTCTCTCTCGTCCTCGGCCTGCTCAATAGAGACGAAGAAAGTGTTAAACTGGCACGCGACA
AGTTTGATGCATTCTTTGCCGAGGATGTCGTGTGGAAGAGCGTCACATTCAAGGACTCGCACGTCAGAAGGGCCG
CATCTCAGTTGCTGGTGGCATGCCTCGGGCGTCATCTGCCTTATGCCGAGACCTCCCACGCAAGACAAGCCTTCA
TCACTGGCGGCCTCAAGACAAACCAGACGGGATCTGTACGAGACTATCTCGATGCGTTGATAAGTCTCACAACGC
ACAAGCCCGACATTTGGACAACGAGCTCCAATGATAAGAAGTCGTCATTTAATCGATTGCAGGCATTCATTGCCA
GGGGTCCTCAGGGAGATCCGCCTGCATTTTGGCAGGGCCTGAGCCAGTTGCTCTCTTGCCTACCTACAGATCTTT
TGACCCTTGAATCATCATCTTCTCTATTAAAATCTCTACAAACTGGCGCTACTAGCCGTGACCAAACTCGCTCGG
ATGCACCGTCTGCCTGGAAATGCTACACCAGCACAGTGAGGCGCTGTCTTGCTGCTCTTCCAGCGCAAGACCACC
TTAGCCTGGCAAAGGATCGTTTGTTTCCGCTCATACAACAACTCCTTTTTCCTATTACGGACAGCCTAGAATTGC
AACCTCAGGATACCATTGCCCAATCAGTTATTGCGGATATTCACCTCGCTCTAATGCAATCCTCCCCTCACATTT
CAGAAGCTCTGTGTGATGAATGGACACGCATGGGCACCTTGTTTTGTACGAATATATCGGCCTCTTTTCCTGAAG
TTTCCGAAAAGCTTCAAGATTTACAGACCAAAATTGGCAAACAAGGACACCATTGGTTTGGTGTGGTGGGAAATC
TTCATTGCAAGCTCCAAGATGTGGCAAGCTCCATGACTGATCCCAGCCTTGAGCCTTCGATCAAAGTTGTCGAAC
ACTCAATCTCGCTCCTCAAAAGTTGCAATTTGAAACCTTTCGGCGCCGCTCAAGTCTTGGAGTATGCCATGGACA
CATCGCCCCATTTATTCATAGGCAAGAGTCGCAAAACGGTTGTTAATTTCTTGCTTGGCGTTGCGCAGGATCCCG
AGGGCCTATTCCAATCACCTTCCTGGGAGCCCCTTTTGTCTTGTGTGGTCAACATGAGCGTGATCTCGGAGCTCG
CGGATGACAACGAAGCTATTTGCGATGCCTGGATAGAAGGTGCATTGGCTCTCCCTCCGTCGCTACGGAATAAGG
CATTAGTAGATCTCGTATCAAAACCGCGGATCGCATTCATTGCTCAACAGTCTTCTGGAGTCCAGGAGCTCCTGC
TTGCTGAATTCCAGGTAGCAAACACCTCGACGGAAACAGACGAGCAAGCAAGTGCCAAGGAATTGCTCATGACAG
CCATATTACACAAGGCTCTGCACATGACATCACGTCACCAATTGTCTGCCCTCTTGGTCAAACTCTTGGGAAGTC
AGCCTGAAAATACTGATGTCATTTTGGAGCTTTTAGAGGCTCTTATTAGGACACATGCGGAGCTATTCTCACTAA
AAGACAGTCTGCGCACAGATCTGCTGGCTCAATTGCTAGCAACATCAGAAATTGCGGAAGACGCCACGTCAGCCA
AGGCGGCATCAATACGATCAATTCTCGACGGCGAACAACAAGACTTGTCATCAGTAGTTGGCATATTGAGGTCAA
ATCTCGAGCAAGCCACCTCCCAATCACTAGAGTAAGTTCTGTATTGACCTGAGAGCAAGAATTCAGCTGACATCT
TGCAGAATAGGAACCATGGTGGACCTTGCCATGAACGCAACCGAGACCGGCGCATCATGGGAACAAATCTTTCCC
AATACCGATATCTGGACGTCTCAGCTTTTACATTTCATGGAGCGCCCTATTAACCCGTCCTTGTCTATTACAAGT
CGTATTGGTGGCGTCATCCTGCTGGCAAAGTCGGGCTCTGACACTCAATCATTTCGAAACCTGCCGAGGGATCGC
AAGGGACGCTCTATTGCCACGCGGATGGCTCTCTATACTAGTCAGCTTTTGAATGAAGCGTTGCAGGATATCAAT
GTTTCGCAACAGCGCCATGCCCAATTGTTATATTTGATCGGCATTTCTTGTCGACTTGCTTCGAACCAGATAATG
TGCTCCGACGACGATGGATTGTGGACGTCGCTGGATCAAGACACCGCCATGTCAGAAGCTCAAGAGCTGATTGAG
TCGTACAATAGACTACTCTATACCCTCATTCAATCGGCGTCTCGACCACTGACTGATGAAGACAAAAAGGCGTTT
GGCGTTTTGCATGAAGTCGCCAAAGTAATGATGAAAGAGGCCTCACAATTGACTGTTGGCGGTGCGCACAGCGCA
GAAGCACTGGCCGGACTTCTGGAGGCTTTGGCCGAGACAAGCTGCGCGCACCAACTGGAGAGCCTTCTTGTCCAG
CAAGAGGTGCTCAAAACGAAGCCTAATACTATTTTGGCTGCGGCTGGGCTTGTTGCAGGCTTTGGTGAGAGGCTC
TCGGCGTCCAAGGATATCTCCAACTTTTGCAACCGGCTGGTGAGCGACACAGCTGCCGCGGTCCCCGGACAAGAG
AACACACTGGCAACGTTGGATCTCTTGACGCTCTGCGCTCAAGTATATCATTCGAAACGCTGTCCGGTTGCGAAT
AACCGAGTTGTATTTGCCGTGAAGCAGATTACATCTTGGATGGACAGTGCCGACAAGCTGGATGCCAATTTGAGA
GCCTCAATGTGTCGAACATTGACGCAACTGCTTCCGTGGATGAAGGACGTCTACGGGTCCTATTGGGAGATGACG
CTGGACTTTTGCGCCAGCTTGTGGCAAGGTGCTGGCAGTTTGGCGCTTGCAGAATCGCTTCCCATTATTCATGCT
TCACTCAAGCTATTGATTACGTTGGAAACAGTTGAAGAGCCAAATGACGATTTGCAGGACGCCTTGAAAGAATTT
GACGCGGAAAAGTCGAAAAGATTGATGGAGCTACTCAAGTTGCCTCGCAATAAGGTGTCGCAGCCGTTGAAAATG
GTGGATTCCATGTTGTGTCGAGAAATTGACAAGATTCGCGTTTCACGAATCCCCGAGCCAGAAGAACTATTTCCG
CTTGTGGGGTCCAAGTCGCATGAAGTGCAGACGGCGGCTTTTAGCATGCTGCACAAAAAGATAGCAGAGCAGCAA
CAGCAGGAATCCGTCAATGTGCTTCTGGACAAGAGGGGTAAGTGGCTTTGGCAAAAGGATCTAGGCATTGTATAA
ATACTAACGGCATGATGCAGAGGCCAGGTTACCGGGCGAACTGATTTCACTACTGCTCGAGGCGCCGACATTGGA
CAAGTTCTCGGATGAGGATCTCGCGCTATTTCCATGCAGTGTGCGCTGCTATCTCCTGGCATGGAAGTTGCTATT
CGACGCCTTTGACGCCTCGTCTTTCAAAGTGCGCAGCGATTTCACAGAACAGATAAAGGAGCAAGGCTACATGAC
GCCTCTGCTTGACTTTTTGTTTGATGTCTTGGGCCACTCGGCTGCGCACCCGCTCAATCTCGACAAGGAAAAGCT
CGGTCCGCAGCAGATTCGGCATTGGGATGTAGACATGGCCGAGGCCGAGACTGCGGAACAAGGCATGCACTGGCT
GCTAGTGCACGTCTTTTACCTCGTGGTCAAATTCACGCCTGGGCTCTTCAAGGCGTGGTTTATGAATTGCCGCTC
AAAGCAGACGCGCATTGCTGTCGAGGCATGGACGCAAAAGTATTTCTCACCACTAATCATTGCCGACACGCTCGA
CGACGTGGAGCAGTGGGCAGACAGCCAGGAGCAGAGCGAGGGCGAGCAGCCACTGCAGATCAAGGTGCTACGGAC
AGCGCGCGAGGTGACGGCCGGGTACGAAGTGGACGAGCTGCAGGCAACAATTGCCATTGCTCTGCCGCCCACGTA
TCCGCTCGAGGGCGTGTCGGTGACTGGAGTGCGGCGCGTGGCCGTGTCGGAGCGCAAGTGGCAGAGCTGGGTGCT
TGCGACACAAGGCGTCATTGCCTTTTCAGGGGGCAGCATCATTGATGGCTTGCTCGCCTTTAGGCGCAACGTGGC
GGGTGCGATGCGGGGCCAGGGCGAGTGCGCCATTTGCTACAGCATCATCTCGGCCGATCGGCGCATGCCCGACAA
GCGATGCACAACGTGCAAAAACTCGTTTCACCGCTCGTGCTTGTATAAATGGTTTACGACGAGCAGCCAAAACAC
GTGTCCGCTGTGCCGGAATCCGATTGATTACCTGGGCGCGGACACGGTCAAGAGGAGACATGGGGCCCCCGAGAT
GTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail