Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8106
Gene name
LocationContig_97:57961..60927
Strand-
Gene length (bp)2966
Transcript length (bp)2634
Coding sequence length (bp)2634
Protein length (aa) 878

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10291 muHD Muniscin C-terminal mu homology domain 8.7E-64 606 876
PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain 7.0E-07 22 92

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43059|SYP1_SCHPO Cytoskeletal protein syp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syp1 PE=1 SV=1 3 237 3.0E-14
sp|P25623|SYP1_YEAST Suppressor of yeast profilin deletion OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SYP1 PE=1 SV=3 1 234 2.0E-07
sp|Q0JRZ9|FCHO2_HUMAN F-BAR domain only protein 2 OS=Homo sapiens GN=FCHO2 PE=1 SV=2 610 786 6.0E-07
sp|O55148|GAS7_RAT Growth arrest-specific protein 7 OS=Rattus norvegicus GN=Gas7 PE=2 SV=2 32 242 6.0E-07
sp|Q3UQN2|FCHO2_MOUSE F-BAR domain only protein 2 OS=Mus musculus GN=Fcho2 PE=1 SV=1 610 786 8.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43059|SYP1_SCHPO Cytoskeletal protein syp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syp1 PE=1 SV=1 3 237 3.0E-14
sp|P25623|SYP1_YEAST Suppressor of yeast profilin deletion OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SYP1 PE=1 SV=3 1 234 2.0E-07
sp|Q0JRZ9|FCHO2_HUMAN F-BAR domain only protein 2 OS=Homo sapiens GN=FCHO2 PE=1 SV=2 610 786 6.0E-07
sp|O55148|GAS7_RAT Growth arrest-specific protein 7 OS=Rattus norvegicus GN=Gas7 PE=2 SV=2 32 242 6.0E-07
sp|Q3UQN2|FCHO2_MOUSE F-BAR domain only protein 2 OS=Mus musculus GN=Fcho2 PE=1 SV=1 610 786 8.0E-07
sp|Q5R807|FCHO2_PONAB F-BAR domain only protein 2 OS=Pongo abelii GN=FCHO2 PE=2 SV=1 610 786 1.0E-06
sp|D3ZYR1|FCHO2_RAT F-BAR domain only protein 2 OS=Rattus norvegicus GN=Fcho2 PE=1 SV=1 610 786 1.0E-06
sp|Q60780|GAS7_MOUSE Growth arrest-specific protein 7 OS=Mus musculus GN=Gas7 PE=1 SV=1 32 242 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8106
MEVSRAEYPGMLAHLQPGSAVHILNDRIKRINKINIEIADWLQERRRVEEQYALGLRKLAQFRAPNSASELGVFE
SPWARVIESVKRMAQSHHILAERIEVDVEHQLRAYQQRHDYQNMQNISLNLASMAKDLEEAQERSEKLGRKGARA
SGQKLDAATSKLESATQQWESQAPFIFETLQALDESRINQLRDLLTQYQTLETDQAQRTQDNVVETLAAMLEIST
EREIQLFSQRTTSGKPVTSARMLMRRPSTAVAGPEGAAIPTQPVPSATFPIGSAANATAPTLAQQATNPTALTED
DTASENNSTPADSKSESKLRRLGTMFSNRRRQSIAGFGSFATSKHTPSPFGRLGSSHGRNISPRPSSSNLHQDSA
RLSSLAEAPDQPNAHDATGRQPDPGGANGVLARSHSSASATHRNGTRLGDATNATPPLGPPAAPPADAAPALSQD
SEGFTIRAPMNDPISEAQREAASDEADQLFKLNIKNNPVEEEDPEAKQAALSSVANTLKMGPATRRSSTLRGRRD
LRNTIYAPAPNSSIPESFPSSAIPSLAGSPPATSSSFSKPPAIAALASEASATGTSDTQSVRSGNSLGSLVHAKH
PDLAGPGLNVSVIESVSAMFEDGQATHLSIGGEIAFSNNSSNSTKSHEMIRINNFSRLERISPNRIFVHNASPDQ
PDQFSLDVSHLSKTTIGFSYRLLADDAHESAALVQHAPLLLKPVWKPQGDKLGLLLQYRLNPAATAFTSPVTLHN
VVFIVTYEGRASGAQTKPSGTHLKDKHIVYWRLGDVELTPDTQKLVCRIVGLEGVAPLPGHVEARWEYAAPGNEA
LGSGISISKLADDKGKAIEATEDDPFADESVNQSWLDVPLQRKLVSGKYEAK*
Coding >OphauB2|8106
ATGGAAGTGTCAAGGGCCGAGTATCCCGGCATGCTGGCTCATTTGCAGCCAGGCTCCGCCGTCCATATACTCAAC
GACAGGATAAAACGCATTAACAAGATTAATATCGAAATTGCAGACTGGCTTCAGGAACGACGCCGGGTCGAGGAG
CAGTATGCTTTAGGCTTGCGCAAACTTGCCCAATTTCGGGCCCCCAATTCTGCATCAGAACTCGGAGTGTTTGAG
TCTCCTTGGGCTAGAGTAATCGAGTCGGTCAAACGCATGGCACAATCCCATCACATTCTCGCCGAGCGCATCGAA
GTAGACGTCGAGCATCAGCTGCGCGCGTATCAACAGCGACACGACTATCAAAACATGCAGAACATCTCCCTCAAC
CTCGCCTCAATGGCTAAGGACCTTGAGGAGGCGCAGGAGAGGTCGGAAAAACTGGGCAGAAAGGGCGCCAGGGCG
AGCGGACAAAAGCTGGATGCCGCAACTTCAAAGCTAGAGTCGGCAACGCAGCAGTGGGAATCGCAGGCCCCCTTC
ATCTTCGAGACCCTACAAGCACTAGACGAGTCTCGCATCAACCAGCTACGTGACCTGCTGACGCAATACCAGACT
CTCGAGACGGATCAGGCGCAACGGACACAGGACAATGTTGTTGAAACGCTGGCAGCCATGCTCGAGATTTCGACA
GAAAGAGAAATCCAGTTATTTTCGCAGCGGACAACCAGTGGCAAGCCTGTGACTTCTGCGAGAATGCTCATGAGA
CGCCCGTCTACCGCTGTCGCTGGGCCAGAGGGTGCTGCGATACCGACCCAGCCAGTTCCATCTGCAACTTTTCCA
ATTGGTTCCGCAGCAAATGCGACGGCCCCAACACTGGCTCAACAGGCAACGAACCCTACAGCTTTGACTGAAGAT
GATACCGCCAGCGAAAACAACTCGACACCGGCAGATTCAAAGTCAGAATCCAAATTGCGGCGCCTCGGAACCATG
TTTAGCAATCGGCGGCGACAAAGCATCGCTGGGTTTGGTTCGTTTGCCACTTCCAAGCACACTCCCTCTCCCTTT
GGGCGCTTGGGTAGTAGCCACGGTCGCAACATATCGCCCCGACCGTCGTCGAGCAATCTCCACCAAGACTCGGCT
CGCCTCTCGTCTCTCGCTGAGGCACCCGACCAGCCCAACGCACACGATGCCACGGGGCGCCAGCCTGACCCTGGG
GGCGCCAATGGTGTTCTGGCCCGCAGCCACTCATCTGCCTCTGCTACACACCGCAACGGAACTCGCCTCGGCGAT
GCAACCAATGCCACCCCTCCTCTAGGCCCACCTGCAGCACCGCCGGCCGACGCAGCGCCCGCCTTGAGCCAGGAC
TCGGAAGGCTTCACGATACGCGCACCCATGAACGATCCCATCTCCGAGGCCCAGCGCGAAGCTGCGAGTGACGAG
GCCGACCAGCTCTTCAAGCTCAATATCAAGAATAACCCAGTAGAAGAGGAAGACCCCGAGGCGAAGCAAGCCGCA
CTGTCCAGCGTAGCAAATACACTCAAGATGGGTCCAGCGACGCGTCGCTCCAGCACGTTGCGAGGTCGCCGCGAC
CTGCGCAATACTATTTACGCACCTGCACCGAATTCTAGTATACCCGAGAGCTTCCCAAGCAGCGCTATTCCATCT
CTTGCTGGCTCTCCCCCAGCGACGTCTTCTTCCTTTTCAAAGCCCCCAGCAATCGCCGCACTGGCTTCCGAGGCT
AGCGCGACGGGAACGTCTGATACGCAATCCGTTCGATCGGGCAACTCGTTGGGCAGTCTAGTTCATGCCAAGCAT
CCCGATCTTGCGGGCCCTGGCCTCAACGTGTCGGTCATTGAGAGTGTTTCCGCCATGTTTGAGGATGGCCAGGCC
ACACACCTTTCGATTGGAGGGGAAATTGCCTTTTCAAACAATTCATCTAATAGCACCAAGAGTCATGAGATGATT
CGCATCAATAATTTTTCAAGGCTGGAGCGCATCAGTCCCAATCGCATATTCGTTCACAATGCTTCTCCAGACCAG
CCAGATCAATTCTCACTGGATGTTTCTCATCTTTCAAAGACGACGATTGGTTTTTCATACCGTTTACTTGCAGAT
GACGCCCACGAGTCGGCTGCGCTCGTGCAGCATGCGCCGCTGCTTCTCAAGCCAGTTTGGAAGCCACAGGGCGAT
AAGCTTGGTCTTTTGCTACAATACCGGCTCAATCCGGCAGCCACGGCCTTCACGTCGCCCGTGACGCTGCACAAC
GTTGTGTTTATCGTGACGTATGAAGGACGGGCAAGCGGCGCTCAAACAAAGCCCAGTGGCACGCATTTGAAGGAT
AAACATATTGTCTACTGGCGCCTGGGCGATGTAGAGCTCACGCCTGACACGCAGAAGCTGGTTTGTCGCATCGTC
GGATTAGAAGGCGTGGCGCCTCTGCCGGGTCATGTCGAGGCAAGATGGGAGTACGCGGCTCCTGGAAACGAGGCT
CTTGGCAGTGGCATTTCCATTTCGAAACTCGCAGATGACAAAGGCAAGGCCATCGAGGCAACCGAGGACGATCCA
TTTGCAGACGAAAGCGTCAATCAGAGCTGGTTGGACGTTCCGCTTCAACGAAAATTAGTAAGTGGCAAGTATGAG
GCCAAGTGA
Transcript >OphauB2|8106
ATGGAAGTGTCAAGGGCCGAGTATCCCGGCATGCTGGCTCATTTGCAGCCAGGCTCCGCCGTCCATATACTCAAC
GACAGGATAAAACGCATTAACAAGATTAATATCGAAATTGCAGACTGGCTTCAGGAACGACGCCGGGTCGAGGAG
CAGTATGCTTTAGGCTTGCGCAAACTTGCCCAATTTCGGGCCCCCAATTCTGCATCAGAACTCGGAGTGTTTGAG
TCTCCTTGGGCTAGAGTAATCGAGTCGGTCAAACGCATGGCACAATCCCATCACATTCTCGCCGAGCGCATCGAA
GTAGACGTCGAGCATCAGCTGCGCGCGTATCAACAGCGACACGACTATCAAAACATGCAGAACATCTCCCTCAAC
CTCGCCTCAATGGCTAAGGACCTTGAGGAGGCGCAGGAGAGGTCGGAAAAACTGGGCAGAAAGGGCGCCAGGGCG
AGCGGACAAAAGCTGGATGCCGCAACTTCAAAGCTAGAGTCGGCAACGCAGCAGTGGGAATCGCAGGCCCCCTTC
ATCTTCGAGACCCTACAAGCACTAGACGAGTCTCGCATCAACCAGCTACGTGACCTGCTGACGCAATACCAGACT
CTCGAGACGGATCAGGCGCAACGGACACAGGACAATGTTGTTGAAACGCTGGCAGCCATGCTCGAGATTTCGACA
GAAAGAGAAATCCAGTTATTTTCGCAGCGGACAACCAGTGGCAAGCCTGTGACTTCTGCGAGAATGCTCATGAGA
CGCCCGTCTACCGCTGTCGCTGGGCCAGAGGGTGCTGCGATACCGACCCAGCCAGTTCCATCTGCAACTTTTCCA
ATTGGTTCCGCAGCAAATGCGACGGCCCCAACACTGGCTCAACAGGCAACGAACCCTACAGCTTTGACTGAAGAT
GATACCGCCAGCGAAAACAACTCGACACCGGCAGATTCAAAGTCAGAATCCAAATTGCGGCGCCTCGGAACCATG
TTTAGCAATCGGCGGCGACAAAGCATCGCTGGGTTTGGTTCGTTTGCCACTTCCAAGCACACTCCCTCTCCCTTT
GGGCGCTTGGGTAGTAGCCACGGTCGCAACATATCGCCCCGACCGTCGTCGAGCAATCTCCACCAAGACTCGGCT
CGCCTCTCGTCTCTCGCTGAGGCACCCGACCAGCCCAACGCACACGATGCCACGGGGCGCCAGCCTGACCCTGGG
GGCGCCAATGGTGTTCTGGCCCGCAGCCACTCATCTGCCTCTGCTACACACCGCAACGGAACTCGCCTCGGCGAT
GCAACCAATGCCACCCCTCCTCTAGGCCCACCTGCAGCACCGCCGGCCGACGCAGCGCCCGCCTTGAGCCAGGAC
TCGGAAGGCTTCACGATACGCGCACCCATGAACGATCCCATCTCCGAGGCCCAGCGCGAAGCTGCGAGTGACGAG
GCCGACCAGCTCTTCAAGCTCAATATCAAGAATAACCCAGTAGAAGAGGAAGACCCCGAGGCGAAGCAAGCCGCA
CTGTCCAGCGTAGCAAATACACTCAAGATGGGTCCAGCGACGCGTCGCTCCAGCACGTTGCGAGGTCGCCGCGAC
CTGCGCAATACTATTTACGCACCTGCACCGAATTCTAGTATACCCGAGAGCTTCCCAAGCAGCGCTATTCCATCT
CTTGCTGGCTCTCCCCCAGCGACGTCTTCTTCCTTTTCAAAGCCCCCAGCAATCGCCGCACTGGCTTCCGAGGCT
AGCGCGACGGGAACGTCTGATACGCAATCCGTTCGATCGGGCAACTCGTTGGGCAGTCTAGTTCATGCCAAGCAT
CCCGATCTTGCGGGCCCTGGCCTCAACGTGTCGGTCATTGAGAGTGTTTCCGCCATGTTTGAGGATGGCCAGGCC
ACACACCTTTCGATTGGAGGGGAAATTGCCTTTTCAAACAATTCATCTAATAGCACCAAGAGTCATGAGATGATT
CGCATCAATAATTTTTCAAGGCTGGAGCGCATCAGTCCCAATCGCATATTCGTTCACAATGCTTCTCCAGACCAG
CCAGATCAATTCTCACTGGATGTTTCTCATCTTTCAAAGACGACGATTGGTTTTTCATACCGTTTACTTGCAGAT
GACGCCCACGAGTCGGCTGCGCTCGTGCAGCATGCGCCGCTGCTTCTCAAGCCAGTTTGGAAGCCACAGGGCGAT
AAGCTTGGTCTTTTGCTACAATACCGGCTCAATCCGGCAGCCACGGCCTTCACGTCGCCCGTGACGCTGCACAAC
GTTGTGTTTATCGTGACGTATGAAGGACGGGCAAGCGGCGCTCAAACAAAGCCCAGTGGCACGCATTTGAAGGAT
AAACATATTGTCTACTGGCGCCTGGGCGATGTAGAGCTCACGCCTGACACGCAGAAGCTGGTTTGTCGCATCGTC
GGATTAGAAGGCGTGGCGCCTCTGCCGGGTCATGTCGAGGCAAGATGGGAGTACGCGGCTCCTGGAAACGAGGCT
CTTGGCAGTGGCATTTCCATTTCGAAACTCGCAGATGACAAAGGCAAGGCCATCGAGGCAACCGAGGACGATCCA
TTTGCAGACGAAAGCGTCAATCAGAGCTGGTTGGACGTTCCGCTTCAACGAAAATTAGTAAGTGGCAAGTATGAG
GCCAAGTGA
Gene >OphauB2|8106
ATGGAAGTGTCAAGGGCCGAGTATCCCGGCATGCTGGTAAGCCTCATACCGCGCCCCGTTAGCTCATCTAACGCT
CCGTCGCTAACTGCTGCGCTTGTGTCTTGTCCCTTCGAGCAGGCTCATTTGCAGCCAGGCTCCGCCGTCCATATA
CTCAACGACAGGATAAAACGCATTAACAAGATTAATATCGAAATTGCAGACTGGCTTCAGGTATAGCCCTGACTG
AGCCCTGTTTGAATCTTAGCGGGCGTCTGACATGCGCCAAAATCAGGAACGACGCCGGGTCGAGGAGCAGTATGC
TTTAGGCTTGCGCAAACTTGCCCAATTTCGGGCCCCCAATTCTGCATCAGAACTCGGGTGCGCTTTCTTTCCCTC
CTAAGCACTGGCAAGACTCTGGGAGTTGCTGACGCGAGCTCTTCTGAGCATACAGAGTGTTTGAGTCTCCTTGGG
CTAGAGTAATCGAGTCGGTCAAACGCATGGCACAATCCCATCACATTCTCGCCGAGCGCATCGAAGTAGACGTCG
AGCATCAGCTGCGCGCGTATCAACAGCGACACGACTATCAAAACATGCAGAACATCTCCCTCAACCTCGCCTCAA
TGGCTAAGGACCTTGAGGAGGCGCAGGAGAGGTCGGAAAAACTGGGCAGAAAGGGCGCCAGGGCGAGCGGACAAA
AGCTGGATGCCGCAACTTCAAAGCTAGAGTCGGCAACGCAGCAGTGGGAATCGCAGGCCCCCTTCATCTTCGAGA
CCCTACAAGCACTAGACGAGTCTCGCATCAACCAGCTACGTGACCTGCTGACGCAATACCAGACTCTCGAGACGG
ATCAGGCGCAACGGACACAGGACAATGTTGTTGAAACGCTGGCAGCCATGCTCGAGATTTCGACAGAAAGAGAAA
TCCAGTTATTTTCGCAGCGGACAACCAGTGGCAAGCCTGTGACTTCTGCGAGAATGCTCATGAGACGCCCGTCTA
CCGCTGTCGCTGGGCCAGAGGGTGCTGCGATACCGACCCAGCCAGTTCCATCTGCAACTTTTCCAATTGGTTCCG
CAGCAAATGCGACGGCCCCAACACTGGCTCAACAGGCAACGAACCCTACAGCTTTGACTGAAGATGATACCGCCA
GCGAAAACAACTCGACACCGGCAGATTCAAAGTCAGGTAGGATTGCACTCCCCACTCCATTGGGCCATGCTCCAT
TATCTCACAGGCTTGAAGAATCCAAATTGCGGCGCCTCGGAACCATGTTTAGCAATCGGCGGCGACAAAGCATCG
CTGGGTTTGGTTCGTTTGCCACTTCCAAGCACACTCCCTCTCCCTTTGGGCGCTTGGGTAGTAGCCACGGTCGCA
ACATATCGCCCCGACCGTCGTCGAGCAATCTCCACCAAGACTCGGCTCGCCTCTCGTCTCTCGCTGAGGCACCCG
ACCAGCCCAACGCACACGATGCCACGGGGCGCCAGCCTGACCCTGGGGGCGCCAATGGTGTTCTGGCCCGCAGCC
ACTCATCTGCCTCTGCTACACACCGCAACGGAACTCGCCTCGGCGATGCAACCAATGCCACCCCTCCTCTAGGCC
CACCTGCAGCACCGCCGGCCGACGCAGCGCCCGCCTTGAGCCAGGACTCGGAAGGCTTCACGATACGCGCACCCA
TGAACGATCCCATCTCCGAGGCCCAGCGCGAAGCTGCGAGTGACGAGGCCGACCAGCTCTTCAAGCTCAATATCA
AGAATAACCCAGTAGAAGAGGAAGACCCCGAGGCGAAGCAAGCCGCACTGTCCAGCGTAGCAAATACACTCAAGA
TGGGTCCAGCGACGCGTCGCTCCAGCACGTTGCGAGGTCGCCGCGACCTGCGCAATACTATTTACGCACCTGCAC
CGAATTCTAGTATACCCGAGAGCTTCCCAAGCAGCGCTATTCCATCTCTTGCTGGCTCTCCCCCAGCGACGTCTT
CTTCCTTTTCAAAGCCCCCAGCAATCGCCGCACTGGCTTCCGAGGCTAGCGCGACGGGAACGTCTGATACGCAAT
CCGTTCGATCGGGCAACTCGTTGGGCAGTCTAGTTCATGCCAAGCATCCCGATCTTGCGGGCCCTGGCCTCAACG
TGTCGGTCATTGAGAGTGTTTCCGCCATGTTTGAGGATGGCCAGGCCACACACCTTTCGATTGGAGGGGAAATTG
CCTTTTCAAACAATTCATCTAATAGCACCAAGAGTAAGCAAGATGCTCCATTGATAAGCGTCTATAGTCTTTAGT
GTCGTTGACGTGGTTTAGGTCATGAGATGATTCGCATCAATAATTTTTCAAGGCTGGAGCGCATCAGTCCCAATC
GCATATTCGTTCACAATGCTTCTCCAGACCAGCCAGATCAATTCTCACTGGATGTTTCTCATCTTTCAAAGACGA
CGATTGGTTTTTCATACCGTTTACTTGCAGATGACGCCCACGAGTCGGCTGCGCTCGTGCAGCATGCGCCGCTGC
TTCTCAAGCCAGTTTGGAAGCCACAGGGCGATAAGCTTGGTCTTTTGCTACAATACCGGCTCAATCCGGCAGCCA
CGGCCTTCACGTCGCCCGTGACGCTGCACAACGTTGTGTTTATCGTGACGTATGAAGGACGGGCAAGCGGCGCTC
AAACAAAGCCCAGTGGCACGCATTTGAAGGATAAACATATTGTCTACTGGCGCCTGGGCGATGTAGAGCTCACGC
CTGACACGCAGAAGCTGGTTTGTCGCATCGTCGGATTAGAAGGCGTGGCGCCTCTGCCGGGTCATGTCGAGGCAA
GATGGGAGTACGCGGCTCCTGGAAACGAGGCTCTTGGCAGTGGCATTTCCATTTCGAAACTCGCAGATGACAAAG
GCAAGGCCATCGAGGCAACCGAGGACGATCCATTTGCAGACGAAAGCGTCAATCAGAGCTGGTTGGACGTTCCGC
TTCAACGAAAATTAGTAAGTGGCAAGTATGAGGCCAAGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail