Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8105
Gene name
LocationContig_97:54025..56622
Strand-
Gene length (bp)2597
Transcript length (bp)2547
Coding sequence length (bp)2547
Protein length (aa) 849

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00668 Condensation Condensation domain 7.2E-49 251 662
PF00501 AMP-binding AMP-binding enzyme 1.9E-16 695 801
PF00550 PP-binding Phosphopantetheine attachment site 9.8E-08 144 205

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 60 813 3.0E-104
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 75 821 1.0E-100
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 63 817 2.0E-90
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 63 830 2.0E-86
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 23 812 2.0E-85
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 60 813 3.0E-104
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 75 821 1.0E-100
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 63 817 2.0E-90
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 63 830 2.0E-86
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 23 812 2.0E-85
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 63 830 7.0E-85
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 60 678 5.0E-71
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 51 837 2.0E-62
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 27 820 6.0E-62
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 253 787 1.0E-58
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 63 816 2.0E-54
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 249 803 5.0E-54
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 221 810 4.0E-49
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 249 800 1.0E-47
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 43 816 2.0E-47
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 246 791 7.0E-47
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 247 801 1.0E-46
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 249 814 2.0E-46
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 43 821 2.0E-46
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 248 790 7.0E-46
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 245 791 9.0E-44
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 249 814 3.0E-43
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 221 793 4.0E-43
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 245 848 9.0E-42
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 253 819 1.0E-41
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 144 787 6.0E-41
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 67 787 1.0E-40
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 144 787 1.0E-40
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 222 794 3.0E-40
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 247 791 1.0E-38
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 245 791 2.0E-38
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 249 782 2.0E-38
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 73 791 5.0E-38
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 73 787 5.0E-38
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 248 791 4.0E-37
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 11 818 2.0E-36
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 225 777 6.0E-36
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 43 812 6.0E-36
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 243 791 7.0E-36
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 57 570 2.0E-35
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 247 791 2.0E-35
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 11 791 3.0E-35
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 247 787 3.0E-35
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 11 791 6.0E-35
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 273 791 7.0E-35
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 42 804 1.0E-34
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 43 791 2.0E-34
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 11 777 3.0E-34
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 238 791 3.0E-34
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 245 791 7.0E-34
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 44 554 1.0E-33
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 11 791 4.0E-33
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 248 829 6.0E-33
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 11 848 1.0E-32
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 253 791 3.0E-32
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 11 791 6.0E-32
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 248 794 1.0E-31
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 64 815 2.0E-31
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 11 787 3.0E-31
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 64 832 1.0E-30
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 249 777 7.0E-30
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 11 791 1.0E-29
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 74 791 3.0E-29
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 11 791 6.0E-29
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 249 777 6.0E-29
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 11 791 1.0E-28
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 245 787 2.0E-28
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 26 793 6.0E-28
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 11 777 7.0E-28
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 67 818 4.0E-27
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 368 791 4.0E-27
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 136 545 9.0E-27
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 38 652 1.0E-26
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 11 800 5.0E-26
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 11 791 6.0E-26
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 11 785 6.0E-26
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 52 810 6.0E-26
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 11 791 7.0E-26
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 472 835 1.0E-25
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 368 804 1.0E-25
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 139 820 2.0E-25
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 66 809 5.0E-25
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 64 791 6.0E-25
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 77 805 6.0E-25
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 32 791 8.0E-25
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 241 791 8.0E-25
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 61 848 2.0E-24
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 64 791 2.0E-24
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 169 793 2.0E-24
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 75 796 3.0E-24
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 84 837 7.0E-24
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 11 791 9.0E-24
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 119 569 1.0E-23
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 33 791 1.0E-23
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 421 793 3.0E-23
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 75 791 5.0E-23
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 11 791 6.0E-23
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 60 663 7.0E-23
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 11 777 2.0E-22
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 350 814 4.0E-22
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 42 782 7.0E-22
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 623 806 2.0E-21
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 75 801 2.0E-21
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 335 848 6.0E-21
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 151 571 3.0E-20
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 64 793 8.0E-20
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 240 554 1.0E-19
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 144 791 1.0E-19
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 61 587 2.0E-19
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 133 549 3.0E-19
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 66 572 3.0E-19
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 66 574 4.0E-19
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 25 574 7.0E-19
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 55 777 2.0E-18
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 25 574 2.0E-18
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 64 812 2.0E-18
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 136 539 2.0E-18
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 64 812 3.0E-18
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 163 563 8.0E-18
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 11 588 9.0E-18
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 626 803 1.0E-17
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 355 794 1.0E-17
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 348 828 1.0E-16
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 608 793 2.0E-16
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 256 782 2.0E-16
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 142 581 5.0E-16
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 686 830 8.0E-16
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 435 810 1.0E-15
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 671 800 2.0E-15
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 11 791 3.0E-15
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 50 615 5.0E-15
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 687 787 1.0E-14
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 365 798 2.0E-14
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 686 791 2.0E-14
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 75 791 4.0E-14
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 671 800 5.0E-14
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 671 800 5.0E-14
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 652 810 1.0E-13
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 247 542 1.0E-13
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 686 810 1.0E-13
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 607 793 3.0E-13
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 607 793 3.0E-13
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 253 575 4.0E-13
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 255 571 6.0E-13
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 55 609 9.0E-13
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 659 788 1.0E-12
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 617 791 2.0E-12
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 687 791 2.0E-11
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 687 791 2.0E-11
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 668 791 2.0E-11
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 527 785 2.0E-11
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 344 786 3.0E-11
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 683 795 6.0E-11
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 671 793 1.0E-10
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 11 392 3.0E-10
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 681 848 5.0E-10
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 16 387 2.0E-09
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 688 823 5.0E-09
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 64 402 1.0E-08
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 24 396 1.0E-08
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 41 399 2.0E-08
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 55 383 2.0E-08
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 403 816 3.0E-08
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 481 652 4.0E-07
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 50 212 4.0E-07
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 64 777 1.0E-06
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 41 205 2.0E-06
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 128 391 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8105
METATREMVMELEKNMLQDAAIKQARIVNLAARGNGEPEWTAALVLAKPRDSEQEAATVIKHARKQLRKLFDKSL
VPKRWIVLDHFPTTDLGLVDEQRLAQSLLMGTSAAAHGLTTKERRRALIDGTNKSDSVEVNEPEMVTVLQALWAQ
VLLVDASQIKHDDNFLRRGGDSILAIQLSTAALEYGINLPTRAILQNPELVRMAAAAQISDEDAHDALQEPFETL
AISKRDEILVEIEGQCALESGAKVVDAYPCSPLQEGLMALALKQPGSYISRFVWRLDNGANVRLFRQAWQKTVEL
CAILRTRIVRASSSHYQAVIEGSQSWEEHGEHGIRAFMENFENIEMGYGSCLCRYALVTEGSKTYFAIIVHHAVF
DGLSMRLILDTLHQAYQGLVPSTPKPYVGFINYVQSVESDEAAASYWAGQLQGARQALFPNRGSRSGRFASHDGS
SLVKRSFAFPKKEATSITKATVLRAAWALLLAQYCDTQDVCFGTTVSGRHAPVAGLQTMAGPVIATVPVRIKIDA
DQTVSEFLVSVQSQANEMTAFEQFGLQRIAKVCSDAKEACEFNSLFVIQPAQHLESTATSSRLLLQDGLERHLSQ
QSMEKYFNYPFVVQPWVTDDSVELEMTYDRQVLTEFQLEAFARQFETVARFLLQHDEARLCDVGVAGPWDKAQAQ
AWNELDEPQLVNACVHELVEQEARRNPEALAVQAWDGELTYRQLNEAANRLAHHILSIVDIQNDELIHVCFEKSL
WHFVSILAINKVGAAWVPLDPSHPLHRQQQVIAQTKARLALGSPSNASICEGLVPNIIEVSAQLDQELKEGLPLS
LTASGPAITVSPRPRHGTSRSVL*
Coding >OphauB2|8105
ATGGAGACAGCAACGCGCGAGATGGTTATGGAGCTGGAAAAGAACATGTTGCAAGATGCCGCGATTAAACAGGCC
AGGATCGTGAACTTGGCTGCTCGAGGGAACGGCGAACCCGAATGGACAGCGGCTCTTGTTCTTGCGAAACCAAGG
GACTCGGAGCAAGAAGCGGCAACGGTTATCAAGCACGCGCGCAAGCAGCTTCGCAAGCTTTTCGACAAGAGTCTG
GTGCCCAAGAGATGGATTGTGCTCGACCACTTCCCCACTACAGACTTGGGACTTGTTGACGAGCAGCGACTGGCG
CAAAGCCTCTTGATGGGCACCTCGGCTGCAGCGCACGGCTTGACCACCAAGGAAAGGCGACGGGCCCTCATTGAC
GGAACAAACAAGTCTGACTCAGTGGAAGTAAATGAGCCTGAAATGGTGACTGTGCTTCAAGCGCTTTGGGCTCAG
GTGCTGCTTGTCGACGCGAGCCAGATTAAGCATGACGACAACTTTTTGCGCCGAGGCGGAGACTCAATTCTGGCC
ATTCAGCTTTCGACCGCTGCTCTTGAATATGGCATTAATCTGCCTACCCGTGCCATTCTGCAAAACCCAGAGCTC
GTGCGCATGGCAGCTGCAGCGCAAATTAGCGACGAGGATGCTCATGATGCCTTGCAAGAGCCTTTTGAAACGCTT
GCAATCAGCAAGCGAGACGAAATACTAGTTGAAATTGAGGGCCAGTGTGCGCTGGAATCAGGCGCAAAAGTGGTT
GACGCGTATCCCTGCTCCCCGCTTCAAGAGGGACTCATGGCGCTGGCGTTGAAGCAGCCAGGATCATACATCTCG
CGGTTTGTGTGGCGCCTCGACAATGGCGCCAATGTGCGACTTTTTCGGCAAGCGTGGCAAAAGACGGTTGAGTTG
TGTGCGATTTTGCGCACTCGCATCGTACGCGCCAGCAGCAGCCACTATCAGGCTGTGATTGAGGGCAGCCAGTCA
TGGGAAGAGCATGGCGAGCATGGCATCCGCGCCTTTATGGAAAATTTTGAGAATATCGAGATGGGCTATGGATCT
TGTCTCTGCCGCTATGCTCTGGTTACTGAAGGAAGCAAGACTTACTTTGCAATTATTGTCCATCACGCCGTATTT
GACGGCTTGAGCATGCGACTTATTCTCGACACCCTGCACCAGGCTTATCAGGGCCTTGTTCCTTCGACGCCCAAG
CCATACGTCGGCTTCATAAATTATGTCCAGTCGGTTGAGAGTGACGAGGCTGCGGCTAGTTACTGGGCCGGGCAG
CTTCAGGGAGCAAGGCAGGCCCTGTTTCCTAATCGAGGCTCAAGAAGTGGCCGCTTTGCTTCTCATGACGGCTCA
AGCCTTGTTAAACGCTCTTTTGCATTCCCCAAGAAGGAGGCAACGTCAATCACCAAAGCCACAGTTTTGCGCGCA
GCATGGGCTCTGCTGCTCGCACAGTACTGCGATACCCAAGACGTCTGCTTCGGCACAACAGTTTCGGGGAGACAT
GCCCCCGTGGCTGGCTTGCAAACAATGGCAGGGCCAGTAATAGCAACAGTGCCGGTCAGAATCAAGATTGATGCT
GACCAGACTGTTTCCGAGTTTTTGGTCTCGGTTCAGTCGCAAGCCAATGAAATGACTGCTTTTGAGCAATTTGGT
CTTCAGCGCATCGCAAAGGTGTGCAGCGACGCCAAGGAGGCATGCGAGTTCAACAGTCTTTTTGTTATTCAGCCC
GCGCAGCACCTCGAATCGACTGCAACTTCTTCTCGCCTCTTATTGCAAGATGGTCTCGAGCGTCATCTTTCTCAG
CAGTCCATGGAAAAATACTTCAACTACCCCTTTGTCGTGCAGCCATGGGTCACAGACGACTCTGTGGAGCTGGAA
ATGACATATGATCGACAAGTCTTGACTGAATTCCAGCTCGAGGCTTTTGCCCGCCAGTTTGAGACTGTGGCTCGG
TTCCTCCTACAGCATGATGAAGCAAGACTTTGCGACGTGGGTGTTGCAGGGCCTTGGGACAAGGCTCAGGCCCAG
GCGTGGAATGAGCTGGATGAGCCGCAATTAGTCAATGCTTGTGTTCATGAGCTTGTTGAACAAGAGGCCCGCAGG
AATCCCGAGGCGCTTGCGGTGCAGGCGTGGGATGGCGAACTCACTTATCGACAACTCAACGAGGCTGCCAACCGC
CTTGCTCACCATATTCTATCCATTGTGGACATTCAAAACGACGAACTCATACACGTCTGTTTCGAGAAATCGCTT
TGGCACTTTGTGTCTATACTGGCTATTAATAAAGTCGGGGCTGCTTGGGTGCCTTTGGACCCTTCACATCCTCTT
CACCGGCAGCAGCAAGTCATTGCACAGACAAAGGCTAGACTAGCGCTAGGCTCACCGTCGAATGCCTCTATATGC
GAGGGTCTTGTACCCAACATTATCGAGGTTTCTGCCCAGCTGGACCAAGAACTCAAAGAAGGACTGCCATTATCT
CTGACAGCCTCGGGACCTGCCATTACAGTTTCTCCGAGGCCTCGTCATGGAACATCGCGCAGTGTGCTCTAG
Transcript >OphauB2|8105
ATGGAGACAGCAACGCGCGAGATGGTTATGGAGCTGGAAAAGAACATGTTGCAAGATGCCGCGATTAAACAGGCC
AGGATCGTGAACTTGGCTGCTCGAGGGAACGGCGAACCCGAATGGACAGCGGCTCTTGTTCTTGCGAAACCAAGG
GACTCGGAGCAAGAAGCGGCAACGGTTATCAAGCACGCGCGCAAGCAGCTTCGCAAGCTTTTCGACAAGAGTCTG
GTGCCCAAGAGATGGATTGTGCTCGACCACTTCCCCACTACAGACTTGGGACTTGTTGACGAGCAGCGACTGGCG
CAAAGCCTCTTGATGGGCACCTCGGCTGCAGCGCACGGCTTGACCACCAAGGAAAGGCGACGGGCCCTCATTGAC
GGAACAAACAAGTCTGACTCAGTGGAAGTAAATGAGCCTGAAATGGTGACTGTGCTTCAAGCGCTTTGGGCTCAG
GTGCTGCTTGTCGACGCGAGCCAGATTAAGCATGACGACAACTTTTTGCGCCGAGGCGGAGACTCAATTCTGGCC
ATTCAGCTTTCGACCGCTGCTCTTGAATATGGCATTAATCTGCCTACCCGTGCCATTCTGCAAAACCCAGAGCTC
GTGCGCATGGCAGCTGCAGCGCAAATTAGCGACGAGGATGCTCATGATGCCTTGCAAGAGCCTTTTGAAACGCTT
GCAATCAGCAAGCGAGACGAAATACTAGTTGAAATTGAGGGCCAGTGTGCGCTGGAATCAGGCGCAAAAGTGGTT
GACGCGTATCCCTGCTCCCCGCTTCAAGAGGGACTCATGGCGCTGGCGTTGAAGCAGCCAGGATCATACATCTCG
CGGTTTGTGTGGCGCCTCGACAATGGCGCCAATGTGCGACTTTTTCGGCAAGCGTGGCAAAAGACGGTTGAGTTG
TGTGCGATTTTGCGCACTCGCATCGTACGCGCCAGCAGCAGCCACTATCAGGCTGTGATTGAGGGCAGCCAGTCA
TGGGAAGAGCATGGCGAGCATGGCATCCGCGCCTTTATGGAAAATTTTGAGAATATCGAGATGGGCTATGGATCT
TGTCTCTGCCGCTATGCTCTGGTTACTGAAGGAAGCAAGACTTACTTTGCAATTATTGTCCATCACGCCGTATTT
GACGGCTTGAGCATGCGACTTATTCTCGACACCCTGCACCAGGCTTATCAGGGCCTTGTTCCTTCGACGCCCAAG
CCATACGTCGGCTTCATAAATTATGTCCAGTCGGTTGAGAGTGACGAGGCTGCGGCTAGTTACTGGGCCGGGCAG
CTTCAGGGAGCAAGGCAGGCCCTGTTTCCTAATCGAGGCTCAAGAAGTGGCCGCTTTGCTTCTCATGACGGCTCA
AGCCTTGTTAAACGCTCTTTTGCATTCCCCAAGAAGGAGGCAACGTCAATCACCAAAGCCACAGTTTTGCGCGCA
GCATGGGCTCTGCTGCTCGCACAGTACTGCGATACCCAAGACGTCTGCTTCGGCACAACAGTTTCGGGGAGACAT
GCCCCCGTGGCTGGCTTGCAAACAATGGCAGGGCCAGTAATAGCAACAGTGCCGGTCAGAATCAAGATTGATGCT
GACCAGACTGTTTCCGAGTTTTTGGTCTCGGTTCAGTCGCAAGCCAATGAAATGACTGCTTTTGAGCAATTTGGT
CTTCAGCGCATCGCAAAGGTGTGCAGCGACGCCAAGGAGGCATGCGAGTTCAACAGTCTTTTTGTTATTCAGCCC
GCGCAGCACCTCGAATCGACTGCAACTTCTTCTCGCCTCTTATTGCAAGATGGTCTCGAGCGTCATCTTTCTCAG
CAGTCCATGGAAAAATACTTCAACTACCCCTTTGTCGTGCAGCCATGGGTCACAGACGACTCTGTGGAGCTGGAA
ATGACATATGATCGACAAGTCTTGACTGAATTCCAGCTCGAGGCTTTTGCCCGCCAGTTTGAGACTGTGGCTCGG
TTCCTCCTACAGCATGATGAAGCAAGACTTTGCGACGTGGGTGTTGCAGGGCCTTGGGACAAGGCTCAGGCCCAG
GCGTGGAATGAGCTGGATGAGCCGCAATTAGTCAATGCTTGTGTTCATGAGCTTGTTGAACAAGAGGCCCGCAGG
AATCCCGAGGCGCTTGCGGTGCAGGCGTGGGATGGCGAACTCACTTATCGACAACTCAACGAGGCTGCCAACCGC
CTTGCTCACCATATTCTATCCATTGTGGACATTCAAAACGACGAACTCATACACGTCTGTTTCGAGAAATCGCTT
TGGCACTTTGTGTCTATACTGGCTATTAATAAAGTCGGGGCTGCTTGGGTGCCTTTGGACCCTTCACATCCTCTT
CACCGGCAGCAGCAAGTCATTGCACAGACAAAGGCTAGACTAGCGCTAGGCTCACCGTCGAATGCCTCTATATGC
GAGGGTCTTGTACCCAACATTATCGAGGTTTCTGCCCAGCTGGACCAAGAACTCAAAGAAGGACTGCCATTATCT
CTGACAGCCTCGGGACCTGCCATTACAGTTTCTCCGAGGCCTCGTCATGGAACATCGCGCAGTGTGCTCTAG
Gene >OphauB2|8105
ATGGAGACAGCAACGCGCGAGATGGTTATGGAGCTGGAAAAGAACATGTTGCAAGATGCCGCGATTAAACAGGCC
AGGATCGTGAACTTGGCTGCTCGAGGGAACGGCGAACCCGAATGGACAGCGGCTCTTGTTCTTGCGAAACCAAGG
GACTCGGAGCAAGAAGCGGCAACGGTTATCAAGCACGCGCGCAAGCAGCTTCGCAAGCTTTTCGACAAGAGTCTG
GTGCCCAAGAGATGGATTGTGCTCGACCACTTCCCCACTACAGACTTGGGACTTGTTGACGAGCAGCGACTGGCG
CAAAGCCTCTTGATGGGCACCTCGGCTGCAGCGCACGGCTTGACCACCAAGGAAAGGCGACGGGCCCTCATTGAC
GGAACAAACAAGTCTGACTCAGTGGAAGTAAATGAGCCTGAAATGGTGACTGTGCTTCAAGCGCTTTGGGCTCAG
GTGCTGCTTGTCGACGCGAGCCAGATTAAGCATGACGACAACTTTTTGCGCCGAGGCGGAGACTCAATTCTGGCC
ATTCAGCTTTCGACCGCTGCTCTTGAATATGGCATTAATCTGCCTACCCGTGCCATTCTGCAAAACCCAGAGCTC
GTGCGCATGGCAGCTGCAGCGCAAATTAGCGACGAGGATGCTCATGATGCCTTGCAAGAGCCTTTTGAAACGCTT
GCAATCAGCAAGCGAGACGAAATACTAGTTGAAATTGAGGGCCAGTGTGCGCTGGAATCAGGCGCAAAAGTGGTT
GACGCGTATCCCTGCTCCCCGCTTCAAGAGGGACTCATGGCGCTGGCGTTGAAGCAGCCAGGATCATACATCTCG
CGGTTTGTGTGGCGCCTCGACAATGGCGCCAATGTGCGACTTTTTCGGCAAGCGTGGCAAAAGACGGTTGAGTTG
TGTGCGATTTTGCGCACTCGCATCGTACGCGCCAGCAGCAGCCACTATCAGGCTGTGATTGAGGGCAGCCAGTCA
TGGGAAGAGCATGGCGAGCATGGCATCCGCGCCTTTATGGAAAATTTTGAGAATATCGAGATGGGCTATGGATCT
TGTCTCTGCCGCTATGCTCTGGTTACTGAAGGAAGCAAGACTTACTTTGCAATTATTGTCCATCACGCCGTATTT
GACGGCTTGAGCATGCGACTTATTCTCGACACCCTGCACCAGGCTTATCAGGGCCTTGTTCCTTCGACGCCCAAG
CCATACGTCGGCTTCATAAATTATGTCCAGTCGGTTGAGAGTGACGAGGCTGCGGCTAGTTACTGGGCCGGGCAG
CTTCAGGGAGCAAGGCAGGCCCTGTTTCCTAATCGAGGCTCAAGAAGTGGCCGCTTTGCTTCTCATGACGGCTCA
AGCCTTGTTAAACGCTCTTTTGCATTCCCCAAGAAGGAGGCAACGTCAATCACCAAAGCCACAGTTTTGCGCGCA
GCATGGGCTCTGCTGCTCGCACAGTACTGCGATACCCAAGACGTCTGCTTCGGCACAACAGTTTCGGGGAGACAT
GCCCCCGTGGCTGGCTTGCAAACAATGGCAGGGCCAGTAATAGCAACAGTGCCGGTCAGAATCAAGATTGATGCT
GACCAGACTGTTTCCGAGTTTTTGGTCTCGGTTCAGTCGCAAGCCAATGAAATGACTGCTTTTGAGCAATTTGGT
CTTCAGCGCATCGCAAAGGTGTGCAGCGACGCCAAGGAGGCATGCGAGTTCAACAGTCTTTTTGTTATTCAGCCC
GCGCAGCACCTCGAATCGACTGCAACTTCTTCTCGCCTCTTATTGCAAGATGGTCTCGAGCGTCATCTTTCTCAG
CAGTCCATGGAAAAATACTTCAACTACCCCTTTGTCGTGCAGCCATGGGTCACAGACGACTCTGTGGAGCTGGAA
ATGACATATGATCGACAAGTCTTGACTGAATTCCAGCTCGAGGCTTTTGCCCGCCAGTTTGAGACTGTGGCTCGG
TTCCTCCTACAGCATGATGAAGCAAGACTTTGCGACGTGGGTGTTGCAGGGCCTTGGGACAAGGCTCAGGCCCAG
GCGTGGAATGAGCTGGATGAGCCGCAATTAGTCAATGCTTGTGTTCATGAGCTTGTTGAACAAGAGGCCCGCAGG
AATCCCGAGGCGCTTGCGGTGCAGGCGTGGGATGGCGAACTCACTTATCGACAACTCAACGAGGCTGCCAACCGC
CTTGCTCACCATATTCTATCCATTGTGGACATTCAAAACGACGAACTCATACACGTCTGTTTCGAGAAATCGCTT
TGGCACTTTGTGTCTATACTGGCTATTAATAAAGTCGGGGCTGCTTGGGTGCCTTTGGACCCTTCACATCCTCTT
CACCGGCAGCAGCAAGTCATTGCACAGACAAAGGCTAGACTAGCGCTAGGCTCACCGTCGAATGCCTCTATATGC
GAGGGTCTTGTACCCAACATTATCGAGGTTTCTGCCCAGCTGGACCAAGAACTCAAAGAAGGACTGCCATTATCT
CTGACAGCCTCGGGACCTGCCATTACAGTTTCTCCGAGTAATGCTGCCTACGTCCTCTTCACCTCTGGAAGCACC
GGCATTCCAAAGGGCCTCGTCATGGAACATCGCGCAGTGTGCTCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail