Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8095
Gene name
LocationContig_96:73531..75046
Strand+
Gene length (bp)1515
Transcript length (bp)1185
Coding sequence length (bp)1185
Protein length (aa) 395

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06071 YchF-GTPase_C Protein of unknown function (DUF933) 9.8E-35 307 389
PF01926 MMR_HSR1 50S ribosome-binding GTPase 3.1E-15 24 135

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38219|OLA1_YEAST Obg-like ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OLA1 PE=1 SV=1 1 393 0.0E+00
sp|O13998|OLA1_SCHPO Obg-like ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC27E2.03c PE=1 SV=1 1 390 0.0E+00
sp|Q9SA73|OLA1_ARATH Obg-like ATPase 1 OS=Arabidopsis thaliana GN=YchF1 PE=1 SV=1 1 394 9.0E-140
sp|Q6Z1J6|OLA1_ORYSJ Obg-like ATPase 1 OS=Oryza sativa subsp. japonica GN=YchF1 PE=1 SV=1 1 394 2.0E-136
sp|B8BBN7|OLA1_ORYSI Obg-like ATPase 1 OS=Oryza sativa subsp. indica GN=OsI_28170 PE=3 SV=1 1 394 1.0E-135
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38219|OLA1_YEAST Obg-like ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OLA1 PE=1 SV=1 1 393 0.0E+00
sp|O13998|OLA1_SCHPO Obg-like ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC27E2.03c PE=1 SV=1 1 390 0.0E+00
sp|Q9SA73|OLA1_ARATH Obg-like ATPase 1 OS=Arabidopsis thaliana GN=YchF1 PE=1 SV=1 1 394 9.0E-140
sp|Q6Z1J6|OLA1_ORYSJ Obg-like ATPase 1 OS=Oryza sativa subsp. japonica GN=YchF1 PE=1 SV=1 1 394 2.0E-136
sp|B8BBN7|OLA1_ORYSI Obg-like ATPase 1 OS=Oryza sativa subsp. indica GN=OsI_28170 PE=3 SV=1 1 394 1.0E-135
sp|Q5ZM25|OLA1_CHICK Obg-like ATPase 1 OS=Gallus gallus GN=OLA1 PE=2 SV=1 1 388 6.0E-128
sp|Q2HJ33|OLA1_BOVIN Obg-like ATPase 1 OS=Bos taurus GN=OLA1 PE=2 SV=1 1 388 2.0E-127
sp|A0JPJ7|OLA1_RAT Obg-like ATPase 1 OS=Rattus norvegicus GN=Ola1 PE=2 SV=1 1 388 7.0E-127
sp|P91917|OLA1_CAEEL Obg-like ATPase 1 OS=Caenorhabditis elegans GN=ola-1 PE=3 SV=1 1 394 7.0E-127
sp|Q9NTK5|OLA1_HUMAN Obg-like ATPase 1 OS=Homo sapiens GN=OLA1 PE=1 SV=2 1 388 1.0E-126
sp|Q9CZ30|OLA1_MOUSE Obg-like ATPase 1 OS=Mus musculus GN=Ola1 PE=1 SV=1 1 388 2.0E-126
sp|Q8SWU7|OLA1_DROME Obg-like ATPase 1 OS=Drosophila melanogaster GN=CG1354 PE=1 SV=1 1 394 2.0E-126
sp|Q7ZWM6|OLA1_XENLA Obg-like ATPase 1 OS=Xenopus laevis GN=ola1 PE=2 SV=1 1 388 4.0E-126
sp|Q5R821|OLA1_PONAB Obg-like ATPase 1 OS=Pongo abelii GN=OLA1 PE=2 SV=1 1 388 3.0E-125
sp|Q66JG0|OLA1_XENTR Obg-like ATPase 1 OS=Xenopus tropicalis GN=ola1 PE=2 SV=1 1 388 1.0E-124
sp|Q7ZU42|OLA1_DANRE Obg-like ATPase 1 OS=Danio rerio GN=ola1 PE=2 SV=1 1 388 2.0E-124
sp|O14078|YEAD_SCHPO Obg-like ATPase homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E11.13c PE=3 SV=1 14 388 8.0E-117
sp|P38746|YLF2_YEAST Obg-like ATPase homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLF2 PE=1 SV=1 11 393 6.0E-111
sp|Q9CP90|YCHF_PASMU Ribosome-binding ATPase YchF OS=Pasteurella multocida (strain Pm70) GN=ychF PE=3 SV=3 21 385 9.0E-88
sp|P0ABU4|YCHF_SHIFL Ribosome-binding ATPase YchF OS=Shigella flexneri GN=ychF PE=3 SV=2 21 385 7.0E-87
sp|P0ABU2|YCHF_ECOLI Ribosome-binding ATPase YchF OS=Escherichia coli (strain K12) GN=ychF PE=1 SV=2 21 385 7.0E-87
sp|P0ABU3|YCHF_ECO57 Ribosome-binding ATPase YchF OS=Escherichia coli O157:H7 GN=ychF PE=3 SV=2 21 385 7.0E-87
sp|P44681|YCHF_HAEIN Ribosome-binding ATPase YchF OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ychF PE=1 SV=2 21 385 9.0E-85
sp|Q7VMI2|YCHF_HAEDU Ribosome-binding ATPase YchF OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=ychF PE=3 SV=3 21 385 3.0E-84
sp|P37518|YCHF_BACSU Ribosome-binding ATPase YchF OS=Bacillus subtilis (strain 168) GN=ychF PE=3 SV=1 21 385 6.0E-75
sp|P47270|YCHF_MYCGE Ribosome-binding ATPase YchF OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=ychF PE=3 SV=1 21 384 2.0E-70
sp|Q8K9V2|YCHF_BUCAP Ribosome-binding ATPase YchF OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=ychF PE=3 SV=3 21 385 4.0E-66
sp|P57288|YCHF_BUCAI Ribosome-binding ATPase YchF OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ychF PE=3 SV=3 21 385 3.0E-64
sp|P75088|YCHF_MYCPN Ribosome-binding ATPase YchF OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ychF PE=3 SV=1 21 375 6.0E-60
sp|Q89AR6|YCHF_BUCBP Ribosome-binding ATPase YchF OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ychF PE=3 SV=3 21 385 2.0E-59
sp|P42942|YG4I_YEAST Uncharacterized GTP-binding protein YGR210C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR210C PE=1 SV=1 24 153 2.0E-10
sp|Q9WXV3|OBG_THEMA GTPase Obg OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=obg PE=3 SV=1 24 152 2.0E-10
sp|Q6AK07|OBG_DESPS GTPase Obg OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=obg PE=3 SV=1 24 162 2.0E-10
sp|B1LA53|OBG_THESQ GTPase Obg OS=Thermotoga sp. (strain RQ2) GN=obg PE=3 SV=1 24 152 3.0E-10
sp|A5IKX2|OBG_THEP1 GTPase Obg OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=obg PE=3 SV=1 24 152 3.0E-10
sp|B9K736|OBG_THENN GTPase Obg OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=obg PE=3 SV=1 24 152 4.0E-10
sp|A1SMB4|OBG_NOCSJ GTPase Obg OS=Nocardioides sp. (strain BAA-499 / JS614) GN=obg PE=3 SV=1 14 151 7.0E-10
sp|Q8RBA5|OBG_CALS4 GTPase Obg OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=obg PE=3 SV=1 24 159 1.0E-09
sp|A6LJZ0|OBG_THEM4 GTPase Obg OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=obg PE=3 SV=1 24 155 2.0E-09
sp|Q1IVS5|OBG_KORVE GTPase Obg OS=Koribacter versatilis (strain Ellin345) GN=obg PE=3 SV=1 24 151 3.0E-09
sp|B1XT35|OBG_POLNS GTPase Obg OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=obg PE=3 SV=1 24 161 3.0E-09
sp|O94362|YHOF_SCHPO Uncharacterized GTP-binding protein C428.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC428.15 PE=3 SV=1 18 151 3.0E-09
sp|B7IGK8|OBG_THEAB GTPase Obg OS=Thermosipho africanus (strain TCF52B) GN=obg PE=3 SV=1 24 170 3.0E-09
sp|Q7NZS1|OBG_CHRVO GTPase Obg OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=obg PE=3 SV=1 24 158 4.0E-09
sp|Q58728|Y1332_METJA Uncharacterized GTP-binding protein MJ1332 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1332 PE=3 SV=1 24 149 4.0E-09
sp|Q24SP0|OBG_DESHY GTPase Obg OS=Desulfitobacterium hafniense (strain Y51) GN=obg PE=3 SV=1 24 152 7.0E-09
sp|A4SVA3|OBG_POLSQ GTPase Obg OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=obg PE=3 SV=1 24 161 9.0E-09
sp|C0QUB5|OBG_PERMH GTPase Obg OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=obg PE=3 SV=1 24 161 1.0E-08
sp|Q1MQQ1|OBG_LAWIP GTPase Obg OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=obg PE=3 SV=1 23 162 1.0E-08
sp|B0S3Z4|OBG_FINM2 GTPase Obg OS=Finegoldia magna (strain ATCC 29328) GN=obg PE=3 SV=1 24 175 1.0E-08
sp|C1F9K2|OBG_ACIC5 GTPase Obg OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=obg PE=3 SV=1 24 151 2.0E-08
sp|B0RDG3|OBG_CLAMS GTPase Obg OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=obg PE=3 SV=1 25 151 2.0E-08
sp|B8H9P2|OBG_ARTCA GTPase Obg OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=obg PE=3 SV=1 25 151 2.0E-08
sp|A0JXJ8|OBG_ARTS2 GTPase Obg OS=Arthrobacter sp. (strain FB24) GN=obg PE=3 SV=1 25 151 3.0E-08
sp|Q6A9H8|OBG_PROAC GTPase Obg OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=obg PE=3 SV=1 24 151 3.0E-08
sp|A5CR32|OBG_CLAM3 GTPase Obg OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=obg PE=3 SV=1 25 151 3.0E-08
sp|Q2L062|OBG_BORA1 GTPase Obg OS=Bordetella avium (strain 197N) GN=obg PE=3 SV=1 24 161 3.0E-08
sp|Q9JXE5|OBG_NEIMB GTPase Obg OS=Neisseria meningitidis serogroup B (strain MC58) GN=obg PE=3 SV=1 24 161 3.0E-08
sp|A1KWG2|OBG_NEIMF GTPase Obg OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=obg PE=3 SV=1 24 161 3.0E-08
sp|A7HJZ8|OBG_FERNB GTPase Obg OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=obg PE=3 SV=1 24 176 3.0E-08
sp|A1R787|OBG_ARTAT GTPase Obg OS=Arthrobacter aurescens (strain TC1) GN=obg PE=3 SV=1 25 151 4.0E-08
sp|B4RQP4|OBG_NEIG2 GTPase Obg OS=Neisseria gonorrhoeae (strain NCCP11945) GN=obg PE=3 SV=1 24 161 4.0E-08
sp|Q5F5D9|OBG_NEIG1 GTPase Obg OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=obg PE=1 SV=1 24 161 4.0E-08
sp|B8FUR9|OBG_DESHD GTPase Obg OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=obg PE=3 SV=1 24 152 4.0E-08
sp|A1IPH6|OBG_NEIMA GTPase Obg OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=obg PE=3 SV=1 24 161 4.0E-08
sp|B0K414|OBG_THEPX GTPase Obg OS=Thermoanaerobacter sp. (strain X514) GN=obg PE=3 SV=1 24 153 4.0E-08
sp|B0KAB8|OBG_THEP3 GTPase Obg OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=obg PE=3 SV=1 24 153 4.0E-08
sp|A9M061|OBG_NEIM0 GTPase Obg OS=Neisseria meningitidis serogroup C (strain 053442) GN=obg PE=3 SV=1 24 161 4.0E-08
sp|Q47AD0|OBG_DECAR GTPase Obg OS=Dechloromonas aromatica (strain RCB) GN=obg PE=3 SV=1 24 161 4.0E-08
sp|Q6AFY1|OBG_LEIXX GTPase Obg OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=obg PE=3 SV=1 25 151 5.0E-08
sp|B0TBW1|OBG_HELMI GTPase Obg OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=obg PE=3 SV=1 24 183 5.0E-08
sp|A1KAD0|OBG_AZOSB GTPase Obg OS=Azoarcus sp. (strain BH72) GN=obg PE=3 SV=1 24 161 5.0E-08
sp|A0LSX1|OBG_ACIC1 GTPase Obg OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=obg PE=3 SV=1 25 151 5.0E-08
sp|Q04B11|OBG_LACDB GTPase Obg OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=obg PE=3 SV=1 24 149 6.0E-08
sp|B2GGD9|OBG_KOCRD GTPase Obg OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=obg PE=3 SV=1 3 151 6.0E-08
sp|A9IFF9|OBG_BORPD GTPase Obg OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=obg PE=3 SV=1 24 161 6.0E-08
sp|Q1GAM3|OBG_LACDA GTPase Obg OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=obg PE=3 SV=1 24 149 6.0E-08
sp|A1TTD3|OBG_ACIAC GTPase Obg OS=Acidovorax citrulli (strain AAC00-1) GN=obg PE=3 SV=1 6 161 6.0E-08
sp|Q5HB45|OBG_EHRRW GTPase Obg OS=Ehrlichia ruminantium (strain Welgevonden) GN=obg PE=3 SV=1 24 125 1.0E-07
sp|Q5FH94|OBG_EHRRG GTPase Obg OS=Ehrlichia ruminantium (strain Gardel) GN=obg PE=3 SV=1 24 125 1.0E-07
sp|Q0BZ39|OBG_HYPNA GTPase Obg OS=Hyphomonas neptunium (strain ATCC 15444) GN=obg PE=3 SV=1 23 161 1.0E-07
sp|Q39QR4|OBG_GEOMG GTPase Obg OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=obg PE=3 SV=1 24 161 1.0E-07
sp|A5UZ80|OBG_ROSS1 GTPase Obg OS=Roseiflexus sp. (strain RS-1) GN=obg PE=3 SV=1 24 161 1.0E-07
sp|Q7VZX6|OBG_BORPE GTPase Obg OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=obg PE=3 SV=1 24 161 1.0E-07
sp|Q7W1P2|OBG_BORPA GTPase Obg OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=obg PE=3 SV=1 24 161 1.0E-07
sp|Q7WQL8|OBG_BORBR GTPase Obg OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=obg PE=3 SV=1 24 161 1.0E-07
sp|Q2Y807|OBG_NITMU GTPase Obg OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=obg PE=3 SV=1 24 155 1.0E-07
sp|Q8G4U0|OBG_BIFLO GTPase Obg OS=Bifidobacterium longum (strain NCC 2705) GN=obg PE=3 SV=1 25 153 2.0E-07
sp|B7GNK1|OBG_BIFLS GTPase Obg OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=obg PE=3 SV=1 25 153 2.0E-07
sp|Q851Q6|OBGC2_ORYSJ Probable GTP-binding protein OBGC2 OS=Oryza sativa subsp. japonica GN=Os03g0799700 PE=2 SV=1 24 161 2.0E-07
sp|Q5P7Z4|OBG_AROAE GTPase Obg OS=Aromatoleum aromaticum (strain EbN1) GN=obg PE=3 SV=1 24 161 2.0E-07
sp|Q1GZ53|OBG_METFK GTPase Obg OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=obg PE=3 SV=1 24 197 2.0E-07
sp|Q9KDK0|OBG_BACHD GTPase Obg OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=obg PE=3 SV=1 23 199 2.0E-07
sp|Q043W1|OBG_LACGA GTPase Obg OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=obg PE=3 SV=1 24 135 2.0E-07
sp|B3DPS4|OBG_BIFLD GTPase Obg OS=Bifidobacterium longum (strain DJO10A) GN=obg PE=3 SV=1 25 153 2.0E-07
sp|Q67SC6|OBG_SYMTH GTPase Obg OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=obg PE=3 SV=1 24 161 2.0E-07
sp|A8MHK8|OBG_ALKOO GTPase Obg OS=Alkaliphilus oremlandii (strain OhILAs) GN=obg PE=3 SV=1 24 183 2.0E-07
sp|B1Y280|OBG_LEPCP GTPase Obg OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=obg PE=3 SV=1 6 161 2.0E-07
sp|Q18B27|OBG_PEPD6 GTPase Obg OS=Peptoclostridium difficile (strain 630) GN=obg PE=3 SV=1 24 153 2.0E-07
sp|Q74JN7|OBG_LACJO GTPase Obg OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=obg PE=3 SV=1 24 135 2.0E-07
sp|Q3BW46|OBG_XANC5 GTPase Obg OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=obg PE=3 SV=1 24 161 2.0E-07
sp|B2UCV3|OBG_RALPJ GTPase Obg OS=Ralstonia pickettii (strain 12J) GN=obg PE=3 SV=1 24 161 2.0E-07
sp|P44915|OBG_HAEIN GTPase Obg OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=obg PE=3 SV=1 24 151 3.0E-07
sp|Q6MTG9|OBG_MYCMS GTPase Obg OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=obg PE=3 SV=1 24 162 3.0E-07
sp|Q2SRV9|OBG_MYCCT GTPase Obg OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=obg PE=3 SV=1 24 162 3.0E-07
sp|A1W4B0|OBG_ACISJ GTPase Obg OS=Acidovorax sp. (strain JS42) GN=obg PE=3 SV=2 24 161 3.0E-07
sp|Q8PN23|OBG_XANAC GTPase Obg OS=Xanthomonas axonopodis pv. citri (strain 306) GN=obg PE=3 SV=1 24 161 3.0E-07
sp|A8YV14|OBG_LACH4 GTPase Obg OS=Lactobacillus helveticus (strain DPC 4571) GN=obg PE=3 SV=1 24 123 3.0E-07
sp|Q5FKH5|OBG_LACAC GTPase Obg OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=obg PE=3 SV=1 24 123 3.0E-07
sp|B1KZR3|OBG_CLOBM GTPase Obg OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=obg PE=3 SV=1 24 158 3.0E-07
sp|B5YJ65|OBG_THEYD GTPase Obg OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=obg PE=3 SV=1 24 153 3.0E-07
sp|B5ZBV6|OBG_UREU1 GTPase Obg OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=obg PE=3 SV=1 24 251 3.0E-07
sp|C0QLE9|OBG_DESAH GTPase Obg OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=obg PE=3 SV=1 24 161 3.0E-07
sp|B7GIR2|OBG_ANOFW GTPase Obg OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=obg PE=3 SV=1 24 188 3.0E-07
sp|Q747Q2|OBG_GEOSL GTPase Obg OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=obg PE=3 SV=1 24 161 3.0E-07
sp|Q31CW3|OBG_PROM9 GTPase Obg OS=Prochlorococcus marinus (strain MIT 9312) GN=obg PE=3 SV=1 24 152 3.0E-07
sp|B2A6B7|OBG_NATTJ GTPase Obg OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=obg PE=3 SV=1 24 178 3.0E-07
sp|Q4QM31|OBG_HAEI8 GTPase Obg OS=Haemophilus influenzae (strain 86-028NP) GN=obg PE=3 SV=1 24 151 3.0E-07
sp|B9E021|OBG_CLOK1 GTPase Obg OS=Clostridium kluyveri (strain NBRC 12016) GN=obg PE=3 SV=2 24 158 4.0E-07
sp|Q022G3|OBG_SOLUE GTPase Obg OS=Solibacter usitatus (strain Ellin6076) GN=obg PE=3 SV=1 3 155 4.0E-07
sp|B8DRN9|OBG_DESVM GTPase Obg OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=obg PE=3 SV=1 23 151 4.0E-07
sp|A5I666|OBG_CLOBH GTPase Obg OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=obg PE=3 SV=1 24 161 4.0E-07
sp|A7FXU6|OBG_CLOB1 GTPase Obg OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=obg PE=3 SV=1 24 161 4.0E-07
sp|A6TQJ6|OBG_ALKMQ GTPase Obg OS=Alkaliphilus metalliredigens (strain QYMF) GN=obg PE=3 SV=1 24 181 4.0E-07
sp|A5CX17|OBG_VESOH GTPase Obg OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=obg PE=3 SV=1 24 161 4.0E-07
sp|Q3A1D8|OBG_PELCD GTPase Obg OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=obg PE=3 SV=1 24 161 4.0E-07
sp|B1ILY5|OBG_CLOBK GTPase Obg OS=Clostridium botulinum (strain Okra / Type B1) GN=obg PE=3 SV=1 24 161 4.0E-07
sp|Q7V368|OBG_PROMP GTPase Obg OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=obg PE=3 SV=1 24 152 4.0E-07
sp|Q31IT4|OBG_THICR GTPase Obg OS=Thiomicrospira crunogena (strain XCL-2) GN=obg PE=3 SV=1 24 151 4.0E-07
sp|B4UIU2|OBG_ANASK GTPase Obg OS=Anaeromyxobacter sp. (strain K) GN=obg PE=3 SV=1 24 161 4.0E-07
sp|B2SYV2|OBG_BURPP GTPase Obg OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=obg PE=3 SV=1 24 161 4.0E-07
sp|Q2IH84|OBG_ANADE GTPase Obg OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=obg PE=3 SV=1 24 161 5.0E-07
sp|B9L101|OBG_THERP GTPase Obg OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=obg PE=3 SV=1 24 151 5.0E-07
sp|Q92G19|OBG_RICCN GTPase Obg OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=obg PE=3 SV=2 24 154 5.0E-07
sp|A9BP68|OBG_DELAS GTPase Obg OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=obg PE=3 SV=1 6 161 5.0E-07
sp|B9MDZ7|OBG_ACIET GTPase Obg OS=Acidovorax ebreus (strain TPSY) GN=obg PE=3 SV=1 6 161 5.0E-07
sp|Q6KHM2|OBG_MYCMO GTPase Obg OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=obg PE=3 SV=1 24 162 5.0E-07
sp|A2BP15|OBG_PROMS GTPase Obg OS=Prochlorococcus marinus (strain AS9601) GN=obg PE=3 SV=1 24 152 5.0E-07
sp|Q8XVL0|OBG_RALSO GTPase Obg OS=Ralstonia solanacearum (strain GMI1000) GN=obg PE=3 SV=1 24 161 6.0E-07
sp|Q83ED8|OBG_COXBU GTPase Obg OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=obg PE=3 SV=1 24 123 6.0E-07
sp|A9KEJ7|OBG_COXBN GTPase Obg OS=Coxiella burnetii (strain Dugway 5J108-111) GN=obg PE=3 SV=1 24 123 6.0E-07
sp|B6J1S8|OBG_COXB2 GTPase Obg OS=Coxiella burnetii (strain CbuG_Q212) GN=obg PE=3 SV=1 24 123 6.0E-07
sp|A9NBL5|OBG_COXBR GTPase Obg OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=obg PE=3 SV=1 24 123 6.0E-07
sp|B6J9K2|OBG_COXB1 GTPase Obg OS=Coxiella burnetii (strain CbuK_Q154) GN=obg PE=3 SV=1 24 123 6.0E-07
sp|B8JBP2|OBG_ANAD2 GTPase Obg OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=obg PE=3 SV=1 24 161 6.0E-07
sp|A5IYU8|OBG_MYCAP GTPase Obg OS=Mycoplasma agalactiae (strain PG2) GN=obg PE=3 SV=1 24 151 6.0E-07
sp|Q3AF51|OBG_CARHZ GTPase Obg OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=obg PE=3 SV=1 24 163 6.0E-07
sp|Q3SVI2|OBG_NITWN GTPase Obg OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=obg PE=3 SV=1 23 123 6.0E-07
sp|B2IYX1|OBG_NOSP7 GTPase Obg OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=obg PE=3 SV=1 24 152 6.0E-07
sp|A9WUU2|OBG_RENSM GTPase Obg OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=obg PE=3 SV=1 25 151 7.0E-07
sp|A8G2M6|OBG_PROM2 GTPase Obg OS=Prochlorococcus marinus (strain MIT 9215) GN=obg PE=3 SV=1 24 152 7.0E-07
sp|Q0AKX2|OBG_MARMM GTPase Obg OS=Maricaulis maris (strain MCS10) GN=obg PE=3 SV=1 24 168 7.0E-07
sp|Q2RV04|OBG_RHORT GTPase Obg OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=obg PE=3 SV=1 23 128 7.0E-07
sp|A0Q1T4|OBG_CLONN GTPase Obg OS=Clostridium novyi (strain NT) GN=obg PE=3 SV=1 24 152 7.0E-07
sp|A5D410|OBG_PELTS GTPase Obg OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=obg PE=3 SV=1 24 153 7.0E-07
sp|Q9I7M2|GTPBA_DROME GTP-binding protein 10 homolog OS=Drosophila melanogaster GN=CG10628 PE=2 SV=2 14 126 7.0E-07
sp|B8DVU1|OBG_BIFA0 GTPase Obg OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=obg PE=3 SV=1 14 151 7.0E-07
sp|A1VF56|OBG_DESVV GTPase Obg OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=obg PE=3 SV=1 23 151 8.0E-07
sp|Q72DK0|OBG_DESVH GTPase Obg OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=obg PE=3 SV=1 23 151 8.0E-07
sp|Q04EZ8|OBG_OENOB GTPase Obg OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=obg PE=3 SV=1 15 123 8.0E-07
sp|A2BUJ6|OBG_PROM5 GTPase Obg OS=Prochlorococcus marinus (strain MIT 9515) GN=obg PE=3 SV=1 24 152 8.0E-07
sp|A0ZZZ0|OBG_BIFAA GTPase Obg OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=obg PE=3 SV=1 14 125 8.0E-07
sp|B1I5V8|OBG_DESAP GTPase Obg OS=Desulforudis audaxviator (strain MP104C) GN=obg PE=3 SV=1 24 155 9.0E-07
sp|A5UDJ7|OBG_HAEIE GTPase Obg OS=Haemophilus influenzae (strain PittEE) GN=obg PE=3 SV=1 24 151 9.0E-07
sp|A5UI23|OBG_HAEIG GTPase Obg OS=Haemophilus influenzae (strain PittGG) GN=obg PE=3 SV=1 24 151 9.0E-07
sp|A4F9L3|OBG_SACEN GTPase Obg OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=obg PE=3 SV=1 14 151 9.0E-07
sp|A3DBS5|OBG_CLOTH GTPase Obg OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=obg PE=3 SV=1 24 152 9.0E-07
sp|Q29K06|GTPBA_DROPS GTP-binding protein 10 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA10450 PE=3 SV=1 14 257 9.0E-07
sp|A7GHK2|OBG_CLOBL GTPase Obg OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=obg PE=3 SV=1 24 161 9.0E-07
sp|A3PAT7|OBG_PROM0 GTPase Obg OS=Prochlorococcus marinus (strain MIT 9301) GN=obg PE=3 SV=1 24 152 9.0E-07
sp|Q4L6Y9|OBG_STAHJ GTPase Obg OS=Staphylococcus haemolyticus (strain JCSC1435) GN=obg PE=3 SV=1 24 135 1.0E-06
sp|Q8CNZ7|OBG_STAES GTPase Obg OS=Staphylococcus epidermidis (strain ATCC 12228) GN=obg PE=3 SV=1 24 155 1.0E-06
sp|Q5HNQ7|OBG_STAEQ GTPase Obg OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=obg PE=3 SV=1 24 155 1.0E-06
sp|P95758|OBG_STRGR GTPase Obg OS=Streptomyces griseus GN=obg PE=1 SV=1 14 153 1.0E-06
sp|B1VXD8|OBG_STRGG GTPase Obg OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=obg PE=3 SV=1 14 153 1.0E-06
sp|Q8PBH0|OBG_XANCP GTPase Obg OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=obg PE=3 SV=1 24 161 1.0E-06
sp|B0RY32|OBG_XANCB GTPase Obg OS=Xanthomonas campestris pv. campestris (strain B100) GN=obg PE=3 SV=1 24 161 1.0E-06
sp|Q4US36|OBG_XANC8 GTPase Obg OS=Xanthomonas campestris pv. campestris (strain 8004) GN=obg PE=3 SV=1 24 161 1.0E-06
sp|A9BK05|OBG_PETMO GTPase Obg OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=obg PE=3 SV=1 24 170 1.0E-06
sp|Q5H2E5|OBG_XANOR GTPase Obg OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=obg PE=3 SV=1 24 161 1.0E-06
sp|B2STC0|OBG_XANOP GTPase Obg OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=obg PE=3 SV=1 24 161 1.0E-06
sp|Q2P5B4|OBG_XANOM GTPase Obg OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=obg PE=3 SV=1 24 161 1.0E-06
sp|O67849|OBG_AQUAE GTPase Obg OS=Aquifex aeolicus (strain VF5) GN=obg PE=3 SV=1 24 151 1.0E-06
sp|Q2JS78|OBG_SYNJA GTPase Obg OS=Synechococcus sp. (strain JA-3-3Ab) GN=obg PE=3 SV=1 24 152 1.0E-06
sp|Q21YZ9|OBG_RHOFT GTPase Obg OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=obg PE=3 SV=1 6 123 1.0E-06
sp|Q1RGV9|OBG_RICBR GTPase Obg OS=Rickettsia bellii (strain RML369-C) GN=obg PE=3 SV=1 24 123 1.0E-06
sp|A8GUG0|OBG_RICB8 GTPase Obg OS=Rickettsia bellii (strain OSU 85-389) GN=obg PE=3 SV=1 24 123 1.0E-06
sp|A1AT81|OBG_PELPD GTPase Obg OS=Pelobacter propionicus (strain DSM 2379) GN=obg PE=3 SV=1 3 123 1.0E-06
sp|Q4UJV1|OBG_RICFE GTPase Obg OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=obg PE=3 SV=1 24 154 1.0E-06
sp|Q0AHG5|OBG_NITEC GTPase Obg OS=Nitrosomonas eutropha (strain C91) GN=obg PE=3 SV=1 24 155 1.0E-06
sp|Q2G983|OBG_NOVAD GTPase Obg OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=obg PE=3 SV=2 23 151 1.0E-06
sp|Q8EPQ0|OBG_OCEIH GTPase Obg OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=obg PE=3 SV=1 24 199 1.0E-06
sp|Q9PQ29|OBG_UREPA GTPase Obg OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=obg PE=3 SV=1 24 254 1.0E-06
sp|B1AJA2|OBG_UREP2 GTPase Obg OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=obg PE=3 SV=1 24 254 1.0E-06
sp|Q0VSE6|OBG_ALCBS GTPase Obg OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=obg PE=3 SV=1 24 151 1.0E-06
sp|A7NRU6|OBG_ROSCS GTPase Obg OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=obg PE=3 SV=2 24 153 1.0E-06
sp|Q2JJ90|OBG_SYNJB GTPase Obg OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=obg PE=3 SV=1 24 161 1.0E-06
sp|B9M3W3|OBG_GEODF GTPase Obg OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=obg PE=3 SV=1 24 161 1.0E-06
sp|Q03QP2|OBG_LACBA GTPase Obg OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=obg PE=3 SV=1 24 189 1.0E-06
sp|A7HIF8|OBG_ANADF GTPase Obg OS=Anaeromyxobacter sp. (strain Fw109-5) GN=obg PE=3 SV=1 24 161 1.0E-06
sp|Q5WTF1|OBG_LEGPL GTPase Obg OS=Legionella pneumophila (strain Lens) GN=obg PE=3 SV=1 24 161 1.0E-06
sp|B2JHD7|OBG_BURP8 GTPase Obg OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=obg PE=3 SV=1 24 161 2.0E-06
sp|Q3YRX8|OBG_EHRCJ GTPase Obg OS=Ehrlichia canis (strain Jake) GN=obg PE=3 SV=1 24 166 2.0E-06
sp|Q7MYX6|OBG_PHOLL GTPase Obg OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=obg PE=3 SV=1 24 198 2.0E-06
sp|Q6DHF7|GTPBA_DANRE GTP-binding protein 10 OS=Danio rerio GN=gtpbp10 PE=2 SV=1 24 125 2.0E-06
sp|Q3AM97|OBG_SYNSC GTPase Obg OS=Synechococcus sp. (strain CC9605) GN=obg PE=3 SV=1 24 151 2.0E-06
sp|Q2VZU2|OBG_MAGSA GTPase Obg OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=obg PE=3 SV=1 23 123 2.0E-06
sp|Q7MW55|OBG_PORGI GTPase Obg OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=obg PE=3 SV=1 24 161 2.0E-06
sp|B2RIY7|OBG_PORG3 GTPase Obg OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=obg PE=3 SV=1 24 161 2.0E-06
sp|Q10XA1|OBG_TRIEI GTPase Obg OS=Trichodesmium erythraeum (strain IMS101) GN=obg PE=3 SV=1 24 168 2.0E-06
sp|Q5ZS70|OBG_LEGPH GTPase Obg OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=obg PE=3 SV=2 24 123 2.0E-06
sp|Q5X1P1|OBG_LEGPA GTPase Obg OS=Legionella pneumophila (strain Paris) GN=obg PE=3 SV=1 24 161 2.0E-06
sp|Q5KWP5|OBG_GEOKA GTPase Obg OS=Geobacillus kaustophilus (strain HTA426) GN=obg PE=3 SV=1 24 161 2.0E-06
sp|A8GTZ9|OBG_RICRS GTPase Obg OS=Rickettsia rickettsii (strain Sheila Smith) GN=obg PE=3 SV=2 24 154 2.0E-06
sp|B0BVJ1|OBG_RICRO GTPase Obg OS=Rickettsia rickettsii (strain Iowa) GN=obg PE=3 SV=2 24 154 2.0E-06
sp|B9DNE7|OBG_STACT GTPase Obg OS=Staphylococcus carnosus (strain TM300) GN=obg PE=3 SV=1 24 123 2.0E-06
sp|A5IAS7|OBG_LEGPC GTPase Obg OS=Legionella pneumophila (strain Corby) GN=obg PE=3 SV=1 24 123 2.0E-06
sp|A8ZRY1|OBG_DESOH GTPase Obg OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=obg PE=3 SV=1 24 161 2.0E-06
sp|A6GZB7|OBG_FLAPJ GTPase Obg OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=obg PE=3 SV=1 24 188 2.0E-06
sp|A8GQ55|OBG_RICAH GTPase Obg OS=Rickettsia akari (strain Hartford) GN=obg PE=3 SV=1 24 123 2.0E-06
sp|B9JUH9|OBG_AGRVS GTPase Obg OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=obg PE=3 SV=1 23 123 2.0E-06
sp|Q0AAD6|OBG_ALKEH GTPase Obg OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=obg PE=3 SV=1 24 123 2.0E-06
sp|B8GA36|OBG_CHLAD GTPase Obg OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=obg PE=3 SV=1 14 161 2.0E-06
sp|Q3SKG2|OBG_THIDA GTPase Obg OS=Thiobacillus denitrificans (strain ATCC 25259) GN=obg PE=3 SV=1 24 161 2.0E-06
sp|A4IRC7|OBG_GEOTN GTPase Obg OS=Geobacillus thermodenitrificans (strain NG80-2) GN=obg PE=3 SV=1 24 161 2.0E-06
sp|A4XAG1|OBG_SALTO GTPase Obg OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=obg PE=3 SV=1 14 151 2.0E-06
sp|Q28Q12|OBG_JANSC GTPase Obg OS=Jannaschia sp. (strain CCS1) GN=obg PE=3 SV=2 24 123 3.0E-06
sp|Q1WT46|OBG_LACS1 GTPase Obg OS=Lactobacillus salivarius (strain UCC118) GN=obg PE=3 SV=1 24 161 3.0E-06
sp|Q1LSJ9|OBG_BAUCH GTPase Obg OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=obg PE=3 SV=1 24 123 3.0E-06
sp|B5YEQ1|OBG_DICT6 GTPase Obg OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=obg PE=3 SV=1 24 161 3.0E-06
sp|B9MRB8|OBG_CALBD GTPase Obg OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=obg PE=3 SV=1 24 161 3.0E-06
sp|A4XJS8|OBG_CALS8 GTPase Obg OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=obg PE=3 SV=2 24 161 3.0E-06
sp|A2SD36|OBG_METPP GTPase Obg OS=Methylibium petroleiphilum (strain PM1) GN=obg PE=3 SV=1 24 132 3.0E-06
sp|Q0SR54|OBG_CLOPS GTPase Obg OS=Clostridium perfringens (strain SM101 / Type A) GN=obg PE=3 SV=1 24 152 3.0E-06
sp|Q8XIJ2|OBG_CLOPE GTPase Obg OS=Clostridium perfringens (strain 13 / Type A) GN=obg PE=3 SV=1 24 152 3.0E-06
sp|Q0TNI5|OBG_CLOP1 GTPase Obg OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=obg PE=3 SV=1 24 152 3.0E-06
sp|Q13U15|OBG_BURXL GTPase Obg OS=Burkholderia xenovorans (strain LB400) GN=obg PE=3 SV=1 24 161 3.0E-06
sp|A0LCZ3|OBG_MAGMM GTPase Obg OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=obg PE=3 SV=1 24 223 3.0E-06
sp|Q21D04|OBG_RHOPB GTPase Obg OS=Rhodopseudomonas palustris (strain BisB18) GN=obg PE=3 SV=1 23 123 3.0E-06
sp|Q12F99|OBG_POLSJ GTPase Obg OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=obg PE=3 SV=1 24 161 4.0E-06
sp|B9LC30|OBG_CHLSY GTPase Obg OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=obg PE=3 SV=1 14 161 4.0E-06
sp|A9WK62|OBG_CHLAA GTPase Obg OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=obg PE=3 SV=1 14 161 4.0E-06
sp|B3R898|OBG_CUPTR GTPase Obg OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=obg PE=3 SV=1 24 161 4.0E-06
sp|Q7VDW9|OBG_PROMA GTPase Obg OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=obg PE=3 SV=1 24 194 5.0E-06
sp|A8M0Y9|OBG_SALAI GTPase Obg OS=Salinispora arenicola (strain CNS-205) GN=obg PE=3 SV=1 14 151 6.0E-06
sp|A8L1V6|OBG_FRASN GTPase Obg OS=Frankia sp. (strain EAN1pec) GN=obg PE=3 SV=1 14 151 6.0E-06
sp|Q6GG60|OBG_STAAR GTPase Obg OS=Staphylococcus aureus (strain MRSA252) GN=obg PE=3 SV=1 24 155 6.0E-06
sp|Q5HFB9|OBG_STAAC GTPase Obg OS=Staphylococcus aureus (strain COL) GN=obg PE=3 SV=1 24 155 6.0E-06
sp|A1AW67|OBG_RUTMC GTPase Obg OS=Ruthia magnifica subsp. Calyptogena magnifica GN=obg PE=3 SV=1 24 161 6.0E-06
sp|Q9ZCB6|OBG_RICPR GTPase Obg OS=Rickettsia prowazekii (strain Madrid E) GN=obg PE=3 SV=1 24 154 6.0E-06
sp|B1YSU7|OBG_BURA4 GTPase Obg OS=Burkholderia ambifaria (strain MC40-6) GN=obg PE=3 SV=1 24 161 6.0E-06
sp|Q7A0Q3|OBG_STAAW GTPase Obg OS=Staphylococcus aureus (strain MW2) GN=obg PE=3 SV=1 24 155 6.0E-06
sp|A8Z2H2|OBG_STAAT GTPase Obg OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=obg PE=3 SV=1 24 155 6.0E-06
sp|Q6G8S5|OBG_STAAS GTPase Obg OS=Staphylococcus aureus (strain MSSA476) GN=obg PE=3 SV=1 24 155 6.0E-06
sp|Q7A584|OBG_STAAN GTPase Obg OS=Staphylococcus aureus (strain N315) GN=obg PE=1 SV=1 24 155 6.0E-06
sp|Q99TK9|OBG_STAAM GTPase Obg OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=obg PE=3 SV=1 24 155 6.0E-06
sp|A6QHI6|OBG_STAAE GTPase Obg OS=Staphylococcus aureus (strain Newman) GN=obg PE=3 SV=1 24 155 6.0E-06
sp|A5ITG8|OBG_STAA9 GTPase Obg OS=Staphylococcus aureus (strain JH9) GN=obg PE=3 SV=1 24 155 6.0E-06
sp|Q2FXT1|OBG_STAA8 GTPase Obg OS=Staphylococcus aureus (strain NCTC 8325) GN=obg PE=3 SV=1 24 155 6.0E-06
sp|Q2FG83|OBG_STAA3 GTPase Obg OS=Staphylococcus aureus (strain USA300) GN=obg PE=3 SV=1 24 155 6.0E-06
sp|A6U2B2|OBG_STAA2 GTPase Obg OS=Staphylococcus aureus (strain JH1) GN=obg PE=3 SV=1 24 155 6.0E-06
sp|A7X361|OBG_STAA1 GTPase Obg OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=obg PE=3 SV=1 24 155 6.0E-06
sp|Q2YT86|OBG_STAAB GTPase Obg OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=obg PE=3 SV=1 24 155 7.0E-06
sp|A8HS51|OBG_AZOC5 GTPase Obg OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=obg PE=3 SV=1 23 123 7.0E-06
sp|Q0BIH8|OBG_BURCM GTPase Obg OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=obg PE=3 SV=1 24 161 7.0E-06
sp|Q89ZI9|OBG_BACTN GTPase Obg OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=obg PE=3 SV=1 24 161 7.0E-06
sp|A8F063|OBG_RICCK GTPase Obg OS=Rickettsia canadensis (strain McKiel) GN=obg PE=3 SV=1 24 154 7.0E-06
sp|Q2S9T3|OBG_HAHCH GTPase Obg OS=Hahella chejuensis (strain KCTC 2396) GN=obg PE=3 SV=1 24 283 7.0E-06
sp|A9KMF5|OBG_CLOPH GTPase Obg OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=obg PE=3 SV=1 24 151 8.0E-06
sp|A8F2Y3|OBG_RICM5 GTPase Obg OS=Rickettsia massiliae (strain Mtu5) GN=obg PE=3 SV=2 24 154 8.0E-06
sp|Q7MP92|OBG_VIBVY GTPase Obg OS=Vibrio vulnificus (strain YJ016) GN=obg PE=3 SV=1 24 126 8.0E-06
sp|Q39JU7|OBG_BURL3 GTPase Obg OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=obg PE=3 SV=1 24 161 9.0E-06
sp|A5VD74|OBG_SPHWW GTPase Obg OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=obg PE=3 SV=1 24 209 9.0E-06
sp|A0K4B0|OBG_BURCH GTPase Obg OS=Burkholderia cenocepacia (strain HI2424) GN=obg PE=3 SV=1 24 161 9.0E-06
sp|B1JVA1|OBG_BURCC GTPase Obg OS=Burkholderia cenocepacia (strain MC0-3) GN=obg PE=3 SV=1 24 161 9.0E-06
sp|B4E5X0|OBG_BURCJ GTPase Obg OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=obg PE=3 SV=1 24 161 9.0E-06
sp|Q1BZE0|OBG_BURCA GTPase Obg OS=Burkholderia cenocepacia (strain AU 1054) GN=obg PE=3 SV=1 24 161 9.0E-06
sp|Q1LIQ0|OBG_CUPMC GTPase Obg OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=obg PE=3 SV=1 24 161 9.0E-06
sp|A9AI60|OBG_BURM1 GTPase Obg OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=obg PE=3 SV=1 24 161 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0019001 guanyl nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0043168 anion binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8095
MPPKKQAQEEKIPLGRPGNNLKSGIVGLANVGKSTLFQAITKCSLGNPANFPYATIEPEEARVIVPDARFDWLCE
KYKPKSQVPANLTVYDIAGLTRGSSTGAGLGNAFLSHIRAVDAIFQVVRCFDDAEIIHVEGDVNPSRDLDIISEE
LRLKDIEFVEKALENQKKKTRMGGQSLELKKAKLEQDIIEKILAWLQDGKEVRKGNWGPKEIEVINPLFLLTAKP
VVYLANLSEKDFIRKKNKHLPKVLEWIKEHAEGDPLIPLSVAYEERLTRFATEQEAKEEQKNVGAESALPKIILQ
MRKSLQLGSFFTTGADEVRQWTIRTGTKAPQAAGVIHTDFEKTFIQAIVCNYDALKEYGDEAEVKAHGKMMTKGK
DYVVEDGDILLIKAGAAKG*
Coding >OphauB2|8095
ATGCCGCCCAAGAAGCAGGCCCAAGAAGAAAAGATTCCCCTGGGAAGACCAGGCAACAATCTCAAAAGTGGCATC
GTTGGCCTTGCAAACGTGGGAAAATCCACTTTGTTCCAGGCCATTACAAAATGCTCCCTCGGCAACCCAGCTAAC
TTCCCCTATGCTACCATAGAGCCGGAAGAGGCTCGCGTCATTGTCCCTGATGCTCGGTTCGACTGGCTGTGCGAA
AAGTACAAGCCCAAGTCCCAAGTCCCAGCCAATCTCACTGTCTACGACATTGCAGGTCTGACGCGCGGCTCCTCA
ACCGGTGCTGGCCTTGGCAATGCCTTTTTGTCGCATATCCGCGCCGTCGACGCCATTTTCCAGGTTGTCAGATGC
TTTGACGATGCCGAGATTATTCACGTTGAAGGCGATGTGAATCCCAGCCGCGATCTCGACATTATCAGCGAAGAG
CTGAGACTCAAGGACATTGAGTTTGTTGAAAAGGCGCTAGAGAACCAAAAGAAGAAGACGCGCATGGGAGGCCAG
AGCCTGGAGCTTAAAAAAGCCAAGCTGGAGCAGGACATTATTGAAAAGATTCTTGCCTGGCTTCAGGACGGCAAA
GAGGTGCGCAAGGGCAATTGGGGGCCCAAGGAGATTGAAGTAATCAACCCGCTCTTTTTGCTGACAGCCAAGCCG
GTTGTGTATCTGGCAAACTTGTCTGAAAAGGACTTTATACGCAAGAAGAATAAGCATTTGCCAAAGGTGCTTGAG
TGGATCAAGGAGCACGCCGAAGGAGATCCCTTGATTCCTCTCTCGGTGGCGTATGAGGAGCGCCTGACGCGGTTT
GCCACGGAGCAGGAGGCCAAGGAGGAGCAAAAGAATGTGGGCGCCGAGTCTGCGCTGCCCAAGATTATTCTGCAG
ATGCGCAAGTCGCTGCAGCTGGGCAGCTTCTTTACAACGGGCGCCGACGAGGTGCGCCAATGGACGATTCGCACG
GGCACCAAGGCGCCGCAGGCAGCGGGGGTGATTCACACCGACTTTGAAAAGACGTTTATTCAGGCCATTGTGTGC
AACTATGATGCGCTCAAGGAGTATGGCGACGAGGCCGAGGTCAAGGCGCACGGCAAGATGATGACCAAGGGCAAG
GACTATGTTGTGGAGGATGGAGACATTTTGCTCATCAAGGCTGGTGCTGCCAAGGGCTAG
Transcript >OphauB2|8095
ATGCCGCCCAAGAAGCAGGCCCAAGAAGAAAAGATTCCCCTGGGAAGACCAGGCAACAATCTCAAAAGTGGCATC
GTTGGCCTTGCAAACGTGGGAAAATCCACTTTGTTCCAGGCCATTACAAAATGCTCCCTCGGCAACCCAGCTAAC
TTCCCCTATGCTACCATAGAGCCGGAAGAGGCTCGCGTCATTGTCCCTGATGCTCGGTTCGACTGGCTGTGCGAA
AAGTACAAGCCCAAGTCCCAAGTCCCAGCCAATCTCACTGTCTACGACATTGCAGGTCTGACGCGCGGCTCCTCA
ACCGGTGCTGGCCTTGGCAATGCCTTTTTGTCGCATATCCGCGCCGTCGACGCCATTTTCCAGGTTGTCAGATGC
TTTGACGATGCCGAGATTATTCACGTTGAAGGCGATGTGAATCCCAGCCGCGATCTCGACATTATCAGCGAAGAG
CTGAGACTCAAGGACATTGAGTTTGTTGAAAAGGCGCTAGAGAACCAAAAGAAGAAGACGCGCATGGGAGGCCAG
AGCCTGGAGCTTAAAAAAGCCAAGCTGGAGCAGGACATTATTGAAAAGATTCTTGCCTGGCTTCAGGACGGCAAA
GAGGTGCGCAAGGGCAATTGGGGGCCCAAGGAGATTGAAGTAATCAACCCGCTCTTTTTGCTGACAGCCAAGCCG
GTTGTGTATCTGGCAAACTTGTCTGAAAAGGACTTTATACGCAAGAAGAATAAGCATTTGCCAAAGGTGCTTGAG
TGGATCAAGGAGCACGCCGAAGGAGATCCCTTGATTCCTCTCTCGGTGGCGTATGAGGAGCGCCTGACGCGGTTT
GCCACGGAGCAGGAGGCCAAGGAGGAGCAAAAGAATGTGGGCGCCGAGTCTGCGCTGCCCAAGATTATTCTGCAG
ATGCGCAAGTCGCTGCAGCTGGGCAGCTTCTTTACAACGGGCGCCGACGAGGTGCGCCAATGGACGATTCGCACG
GGCACCAAGGCGCCGCAGGCAGCGGGGGTGATTCACACCGACTTTGAAAAGACGTTTATTCAGGCCATTGTGTGC
AACTATGATGCGCTCAAGGAGTATGGCGACGAGGCCGAGGTCAAGGCGCACGGCAAGATGATGACCAAGGGCAAG
GACTATGTTGTGGAGGATGGAGACATTTTGCTCATCAAGGCTGGTGCTGCCAAGGGCTAG
Gene >OphauB2|8095
ATGCCGCCCAAGAAGCAGGCCCAAGAAGAAAAGATTCCCCTGGGAAGACCAGGCAACAATCTCAAAAGTGGCATC
GTGAGCACCGCCAAAGCAGCCACCGTGCCCAACTCTTGCTAAGCTCAGCAGGTTGGCCTTGCAAACGTGGGAAAA
TCCACTTTGTTCCAGGCCATTACAAAATGCTCCCTCGGCAACCCAGCTGTATGACGCTCCCTCTAGCCGCCCGCT
CTAGGCCATCAGGGCGCTGACAGCTTGCAAAAGAACTTCCCCTATGCTACCATAGAGCCGGAAGAGGCTCGCGTC
ATTGTCCCTGATGCTCGGTTCGACTGGCTGTGCGAAAAGTACAAGCCCAAGTCCCAAGTCCCAGCCAATCTCACT
GTCTACGACATTGCAGGTCTGACGCGCGGCTCCTCAACCGGTGCTGGCCTTGGCAATGCCTTTTTGTCGCATATC
CGCGCCGTCGACGCCATTTTCCAGGTTGTCAGATGCTTTGACGATGCCGAGATTATTCACGTTGAAGGCGATGTG
AATCCCAGCCGCGATCTCGACATTATCAGCGAAGAGCTGAGACTCAAGGACATTGAGTTTGTTGAAAAGGCGCTA
GAGAACCAAAAGAAGAAGACGCGCATGGGAGGCCAGAGCCTGGAGCTTAAAAAAGCCAAGCTGGAGCAGGACATT
ATTGAAAAGATTCTTGCCTGGCTTCAGGACGGCAAAGAGGTGCGCAAGGGCAATTGGGGGCCCAAGGAGGTAGGA
CATGGCCCAATTTCCGTCTTGTCCGCCCCCCTTGTTGCATGATGACAAAAGGCCAGTTGGCCTGAATCTAATCCC
AGCTCTTTGAATGCCTCGTCCAAACAACGCTAGAGCGCATCGTGAGATGAACATTTACCTGACGGCAATGCTTTG
ACTATTGGCAGCAGATGCTTTTGCACAGACAGTTTATTGCAACATTTACTGACTGGGCCATAGATTGAAGTAATC
AACCCGCTCTTTTTGCTGACAGCCAAGCCGGTTGTGTATCTGGCAAACTTGTCTGAAAAGGACTTTATACGCAAG
AAGAATAAGCATTTGCCAAAGGTGCTTGAGTGGATCAAGGAGCACGCCGAAGGAGATCCCTTGATTCCTCTCTCG
GTGGCGTATGAGGAGCGCCTGACGCGGTTTGCCACGGAGCAGGAGGCCAAGGAGGAGCAAAAGAATGTGGGCGCC
GAGTCTGCGCTGCCCAAGATTATTCTGCAGATGCGCAAGTCGCTGCAGCTGGGCAGCTTCTTTACAACGGGCGCC
GACGAGGTGCGCCAATGGACGATTCGCACGGGCACCAAGGCGCCGCAGGCAGCGGGGGTGATTCACACCGACTTT
GAAAAGACGTTTATTCAGGCCATTGTGTGCAACTATGATGCGCTCAAGGAGTATGGCGACGAGGCCGAGGTCAAG
GCGCACGGCAAGATGATGACCAAGGGCAAGGACTATGTTGTGGAGGATGGAGACATTTTGCTCATCAAGGCTGGT
GCTGCCAAGGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail