Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|808
Gene name
LocationContig_118:4759..6468
Strand-
Gene length (bp)1709
Transcript length (bp)1431
Coding sequence length (bp)1431
Protein length (aa) 477

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.1E-17 85 154
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.3E-19 175 245
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 3.3E-12 302 365
PF13893 RRM_5 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.6E-06 76 166

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LQI9|UBP1B_ARATH Oligouridylate-binding protein 1B OS=Arabidopsis thaliana GN=UBP1B PE=1 SV=1 83 380 5.0E-68
sp|Q9M427|UBP1_NICPL Oligouridylate-binding protein 1 OS=Nicotiana plumbaginifolia GN=UBP1 PE=2 SV=1 83 380 6.0E-68
sp|Q9LJH8|UBP1C_ARATH Oligouridylate-binding protein 1C OS=Arabidopsis thaliana GN=UBP1C PE=1 SV=1 83 380 6.0E-67
sp|Q9SYG4|UBP1A_ARATH Oligouridylate-binding protein 1A OS=Arabidopsis thaliana GN=UBP1A PE=1 SV=1 83 375 1.0E-63
sp|P52912|TIA1_MOUSE Nucleolysin TIA-1 OS=Mus musculus GN=Tia1 PE=1 SV=1 83 381 3.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LQI9|UBP1B_ARATH Oligouridylate-binding protein 1B OS=Arabidopsis thaliana GN=UBP1B PE=1 SV=1 83 380 5.0E-68
sp|Q9M427|UBP1_NICPL Oligouridylate-binding protein 1 OS=Nicotiana plumbaginifolia GN=UBP1 PE=2 SV=1 83 380 6.0E-68
sp|Q9LJH8|UBP1C_ARATH Oligouridylate-binding protein 1C OS=Arabidopsis thaliana GN=UBP1C PE=1 SV=1 83 380 6.0E-67
sp|Q9SYG4|UBP1A_ARATH Oligouridylate-binding protein 1A OS=Arabidopsis thaliana GN=UBP1A PE=1 SV=1 83 375 1.0E-63
sp|P52912|TIA1_MOUSE Nucleolysin TIA-1 OS=Mus musculus GN=Tia1 PE=1 SV=1 83 381 3.0E-58
sp|P31483|TIA1_HUMAN Nucleolysin TIA-1 isoform p40 OS=Homo sapiens GN=TIA1 PE=1 SV=3 83 442 4.0E-58
sp|Q01085|TIAR_HUMAN Nucleolysin TIAR OS=Homo sapiens GN=TIAL1 PE=1 SV=1 83 433 7.0E-57
sp|P70318|TIAR_MOUSE Nucleolysin TIAR OS=Mus musculus GN=Tial1 PE=1 SV=1 83 433 5.0E-55
sp|P32588|PUB1_YEAST Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUB1 PE=1 SV=4 79 252 5.0E-47
sp|Q9LEB3|RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia GN=RBP47 PE=1 SV=1 75 442 7.0E-42
sp|Q0WW84|RB47B_ARATH Polyadenylate-binding protein RBP47B OS=Arabidopsis thaliana GN=RBP47B PE=2 SV=1 83 377 9.0E-38
sp|Q9LEB4|RBP45_NICPL Polyadenylate-binding protein RBP45 OS=Nicotiana plumbaginifolia GN=RBP45 PE=1 SV=1 80 380 9.0E-37
sp|F4I3B3|RB47A_ARATH Polyadenylate-binding protein RBP47A OS=Arabidopsis thaliana GN=RBP47A PE=2 SV=1 83 377 1.0E-36
sp|Q8VXZ9|R47BP_ARATH Polyadenylate-binding protein RBP47B' OS=Arabidopsis thaliana GN=RBP47B' PE=2 SV=1 83 385 2.0E-35
sp|Q9FPJ8|RB45A_ARATH Polyadenylate-binding protein RBP45A OS=Arabidopsis thaliana GN=RBP45A PE=2 SV=1 83 377 3.0E-35
sp|Q93W34|RP45C_ARATH Polyadenylate-binding protein RBP45C OS=Arabidopsis thaliana GN=RBP45C PE=2 SV=1 83 378 9.0E-35
sp|Q9SAB3|RB45B_ARATH Polyadenylate-binding protein RBP45B OS=Arabidopsis thaliana GN=RBP45B PE=1 SV=1 83 385 4.0E-34
sp|O60176|YG41_SCHPO Uncharacterized RNA-binding protein C23E6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.01c PE=1 SV=2 82 374 5.0E-34
sp|Q9SX79|RB47C_ARATH Polyadenylate-binding protein RBP47C OS=Arabidopsis thaliana GN=RBP47C PE=2 SV=1 83 412 5.0E-33
sp|Q91584|ELAV3_XENLA ELAV-like protein 3 OS=Xenopus laevis GN=elavl3 PE=2 SV=1 79 372 1.0E-32
sp|Q28GD4|ELAV2_XENTR ELAV-like protein 2 OS=Xenopus tropicalis GN=elavl2 PE=2 SV=2 70 373 2.0E-32
sp|Q28FX0|ELAV3_XENTR ELAV-like protein 3 OS=Xenopus tropicalis GN=elavl3 PE=2 SV=1 77 372 7.0E-32
sp|Q9SX80|R47CP_ARATH Polyadenylate-binding protein RBP47C' OS=Arabidopsis thaliana GN=RBP47C' PE=2 SV=1 83 412 7.0E-32
sp|Q5R9Z6|ELAV2_PONAB ELAV-like protein 2 OS=Pongo abelii GN=ELAVL2 PE=2 SV=1 79 373 1.0E-31
sp|Q12926|ELAV2_HUMAN ELAV-like protein 2 OS=Homo sapiens GN=ELAVL2 PE=1 SV=2 79 373 1.0E-31
sp|O09032|ELAV4_RAT ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1 76 373 3.0E-31
sp|Q61701|ELAV4_MOUSE ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1 SV=1 76 373 5.0E-31
sp|P26378|ELAV4_HUMAN ELAV-like protein 4 OS=Homo sapiens GN=ELAVL4 PE=1 SV=2 76 373 1.0E-30
sp|Q8CH84|ELAV2_RAT ELAV-like protein 2 OS=Rattus norvegicus GN=Elavl2 PE=1 SV=1 79 373 1.0E-30
sp|Q91903|ELAV2_XENLA ELAV-like protein 2 OS=Xenopus laevis GN=elavl2 PE=1 SV=2 79 373 1.0E-30
sp|Q60900|ELAV3_MOUSE ELAV-like protein 3 OS=Mus musculus GN=Elavl3 PE=1 SV=1 77 372 2.0E-30
sp|Q15717|ELAV1_HUMAN ELAV-like protein 1 OS=Homo sapiens GN=ELAVL1 PE=1 SV=2 85 373 2.0E-30
sp|Q60899|ELAV2_MOUSE ELAV-like protein 2 OS=Mus musculus GN=Elavl2 PE=2 SV=1 79 373 3.0E-30
sp|Q14576|ELAV3_HUMAN ELAV-like protein 3 OS=Homo sapiens GN=ELAVL3 PE=2 SV=3 77 372 4.0E-30
sp|Q1JQ73|ELV1A_XENLA ELAV-like protein 1-A OS=Xenopus laevis GN=elavl1-a PE=1 SV=1 85 373 7.0E-30
sp|P70372|ELAV1_MOUSE ELAV-like protein 1 OS=Mus musculus GN=Elavl1 PE=1 SV=2 85 373 8.0E-30
sp|Q5U259|ELV1B_XENLA ELAV-like protein 1-B OS=Xenopus laevis GN=elavl1-b PE=1 SV=1 85 373 6.0E-29
sp|Q7SZT7|ELAV4_XENLA ELAV-like protein 4 OS=Xenopus laevis GN=elavl4 PE=2 SV=1 76 373 1.0E-28
sp|A4QNI8|ELAV4_XENTR ELAV-like protein 4 OS=Xenopus tropicalis GN=elavl4 PE=2 SV=1 76 373 1.0E-28
sp|Q6GLB5|ELAV1_XENTR ELAV-like protein 1 OS=Xenopus tropicalis GN=elavl1 PE=2 SV=1 85 373 1.0E-28
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 80 404 1.0E-26
sp|Q5B630|PABP_EMENI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pab1 PE=2 SV=2 79 404 2.0E-26
sp|A1D4K4|PABP_NEOFI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1 44 404 3.0E-26
sp|A1CRM1|PABP_ASPCL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pab1 PE=3 SV=1 79 404 7.0E-26
sp|P16914|ELAV_DROME Protein elav OS=Drosophila melanogaster GN=elav PE=2 SV=1 85 373 8.0E-26
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 76 378 1.0E-25
sp|A2Q848|PABP_ASPNC Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pab1 PE=3 SV=1 76 404 1.0E-25
sp|Q2UK72|PABP_ASPOR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pab1 PE=3 SV=1 77 404 1.0E-25
sp|Q4WK03|PABP_ASPFU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pab1 PE=3 SV=1 76 404 1.0E-25
sp|P23241|ELAV_DROVI Protein elav OS=Drosophila virilis GN=elav PE=3 SV=1 85 373 2.0E-25
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 79 372 2.0E-25
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 84 439 2.0E-25
sp|Q0CR95|PABP_ASPTN Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pab1 PE=3 SV=1 79 404 3.0E-25
sp|O13759|CSX1_SCHPO RNA-binding post-transcriptional regulator csx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csx1 PE=1 SV=1 85 374 8.0E-25
sp|Q7S6N6|PABP_NEUCR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pabp-1 PE=3 SV=1 84 378 3.0E-24
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 84 373 5.0E-24
sp|Q2GSX8|PABP_CHAGB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAB1 PE=3 SV=1 76 378 8.0E-24
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 84 378 9.0E-24
sp|P0CP46|PABP_CRYNJ Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAB1 PE=3 SV=1 84 378 2.0E-23
sp|P0CP47|PABP_CRYNB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAB1 PE=3 SV=1 84 378 2.0E-23
sp|O04319|PABP6_ARATH Polyadenylate-binding protein 6 OS=Arabidopsis thaliana GN=PAB6 PE=2 SV=1 85 396 2.0E-23
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 84 378 2.0E-23
sp|Q0U1G2|PABP_PHANO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAB1 PE=3 SV=3 57 404 3.0E-23
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 85 376 4.0E-23
sp|Q15427|SF3B4_HUMAN Splicing factor 3B subunit 4 OS=Homo sapiens GN=SF3B4 PE=1 SV=1 85 252 4.0E-23
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 85 376 4.0E-23
sp|Q6AYL5|SF3B4_RAT Splicing factor 3B subunit 4 OS=Rattus norvegicus GN=Sf3b4 PE=2 SV=1 85 252 6.0E-23
sp|Q8QZY9|SF3B4_MOUSE Splicing factor 3B subunit 4 OS=Mus musculus GN=Sf3b4 PE=1 SV=1 85 252 6.0E-23
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 84 378 8.0E-23
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 85 376 9.0E-23
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 85 376 9.0E-23
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 85 376 9.0E-23
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 84 378 1.0E-22
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 84 378 1.0E-22
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 84 378 1.0E-22
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 84 378 1.0E-22
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 84 376 1.0E-22
sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 84 378 1.0E-22
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 66 402 1.0E-22
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 84 362 1.0E-22
sp|Q09442|SF3B4_CAEEL Splicing factor 3B subunit 4 OS=Caenorhabditis elegans GN=sap-49 PE=1 SV=2 85 252 1.0E-22
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 84 378 1.0E-22
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 85 372 2.0E-22
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 84 404 2.0E-22
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 85 376 4.0E-22
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 84 378 6.0E-22
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 85 376 1.0E-21
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 76 378 1.0E-21
sp|Q6FKG4|PABP_CANGA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAB1 PE=3 SV=1 84 378 1.0E-21
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 85 413 1.0E-21
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 84 378 3.0E-21
sp|O14102|SAP49_SCHPO Spliceosome-associated protein 49 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sap49 PE=3 SV=2 85 252 6.0E-21
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 69 252 8.0E-21
sp|Q4P8R9|PABP_USTMA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAB1 PE=3 SV=1 81 378 1.0E-20
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 84 378 2.0E-20
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 81 372 2.0E-20
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 85 436 3.0E-20
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 80 378 3.0E-20
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 85 252 3.0E-20
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 80 252 3.0E-20
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 84 387 4.0E-20
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 85 254 9.0E-20
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 85 372 1.0E-19
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 84 387 1.0E-19
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 85 409 2.0E-19
sp|P32831|NGR1_YEAST Negative growth regulatory protein NGR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NGR1 PE=1 SV=2 125 397 2.0E-19
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 85 405 2.0E-19
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 85 378 3.0E-19
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 85 373 3.0E-19
sp|Q5JQF8|PAP1M_HUMAN Polyadenylate-binding protein 1-like 2 OS=Homo sapiens GN=PABPC1L2A PE=2 SV=1 84 244 5.0E-19
sp|Q66KL9|RBM42_XENTR RNA-binding protein 42 OS=Xenopus tropicalis GN=rbm42 PE=2 SV=1 156 268 9.0E-19
sp|Q7S6N6|PABP_NEUCR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pabp-1 PE=3 SV=1 85 405 1.0E-18
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 85 265 1.0E-18
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 78 263 2.0E-18
sp|Q6DRG1|RBM42_DANRE RNA-binding protein 42 OS=Danio rerio GN=rbm42 PE=2 SV=2 164 268 2.0E-18
sp|Q4KM14|TSP1L_DANRE tRNA selenocysteine 1-associated protein 1-like OS=Danio rerio GN=trnau1apl PE=2 SV=1 84 253 2.0E-18
sp|Q54BM2|PAP1A_DICDI Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 80 372 2.0E-18
sp|P27476|NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 167 368 2.0E-18
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 85 265 2.0E-18
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 85 378 3.0E-18
sp|Q0P5L0|RBM42_BOVIN RNA-binding protein 42 OS=Bos taurus GN=RBM42 PE=2 SV=1 170 251 3.0E-18
sp|A2VDB3|RBM42_XENLA RNA-binding protein 42 OS=Xenopus laevis GN=rbm42 PE=2 SV=1 173 268 3.0E-18
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 75 254 4.0E-18
sp|Q9BTD8|RBM42_HUMAN RNA-binding protein 42 OS=Homo sapiens GN=RBM42 PE=1 SV=1 170 251 4.0E-18
sp|Q9FGS0|CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana GN=CP31B PE=1 SV=1 78 254 4.0E-18
sp|Q91V81|RBM42_MOUSE RNA-binding protein 42 OS=Mus musculus GN=Rbm42 PE=1 SV=1 170 251 4.0E-18
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 85 372 4.0E-18
sp|Q6AXT7|RBM42_RAT RNA-binding protein 42 OS=Rattus norvegicus GN=Rbm42 PE=1 SV=1 170 251 4.0E-18
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 85 252 5.0E-18
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 85 296 7.0E-18
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 85 296 8.0E-18
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 84 378 1.0E-17
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 85 265 1.0E-17
sp|P60050|PABP5_PONPY Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 73 370 1.0E-17
sp|P60049|PABP5_PANTR Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 73 370 1.0E-17
sp|P60048|PABP5_HYLLA Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 73 370 1.0E-17
sp|Q96DU9|PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 73 370 1.0E-17
sp|P60047|PABP5_GORGO Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 73 370 1.0E-17
sp|Q7JGR2|PABP5_MACMU Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 73 370 1.0E-17
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 85 254 2.0E-17
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 85 296 2.0E-17
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 85 296 2.0E-17
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 85 296 2.0E-17
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 75 260 2.0E-17
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 85 254 3.0E-17
sp|Q9P3U1|YKX5_SCHPO Uncharacterized RNA-binding protein C328.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.05 PE=3 SV=3 82 396 3.0E-17
sp|Q39061|CP33_ARATH RNA-binding protein CP33, chloroplastic OS=Arabidopsis thaliana GN=CP33 PE=2 SV=1 85 258 4.0E-17
sp|Q6CDH3|PABP_YARLI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAB1 PE=3 SV=1 84 372 4.0E-17
sp|P19683|ROC4_NICSY 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 85 254 5.0E-17
sp|P0CP46|PABP_CRYNJ Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAB1 PE=3 SV=1 85 443 9.0E-17
sp|P0CP47|PABP_CRYNB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAB1 PE=3 SV=1 85 443 9.0E-17
sp|Q9LEB3|RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia GN=RBP47 PE=1 SV=1 69 248 1.0E-16
sp|A1D4K4|PABP_NEOFI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1 85 378 1.0E-16
sp|O04319|PABP6_ARATH Polyadenylate-binding protein 6 OS=Arabidopsis thaliana GN=PAB6 PE=2 SV=1 52 265 1.0E-16
sp|Q54BM2|PAP1A_DICDI Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 58 264 1.0E-16
sp|P19682|ROC3_NICSY 28 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 79 252 1.0E-16
sp|Q4WK03|PABP_ASPFU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pab1 PE=3 SV=1 85 378 2.0E-16
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 84 404 2.0E-16
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 85 378 2.0E-16
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 81 372 2.0E-16
sp|Q1ZXC2|PAP1B_DICDI Polyadenylate-binding protein 1-B OS=Dictyostelium discoideum GN=pabpc1B PE=3 SV=1 84 246 2.0E-16
sp|F4HT49|PABP1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PAB1 PE=2 SV=2 85 260 2.0E-16
sp|Q00539|NAM8_YEAST Protein NAM8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM8 PE=1 SV=2 85 370 2.0E-16
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 85 260 3.0E-16
sp|Q2GSX8|PABP_CHAGB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAB1 PE=3 SV=1 85 405 3.0E-16
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 85 282 3.0E-16
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 85 378 4.0E-16
sp|F4HT49|PABP1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PAB1 PE=2 SV=2 71 373 4.0E-16
sp|Q1RMJ7|TSAP1_BOVIN tRNA selenocysteine 1-associated protein 1 OS=Bos taurus GN=TRNAU1AP PE=2 SV=1 84 253 4.0E-16
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 85 251 5.0E-16
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 85 407 5.0E-16
sp|O01671|SXL_MEGSC Sex-lethal homolog OS=Megaselia scalaris GN=SXL PE=2 SV=3 85 235 5.0E-16
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 85 252 5.0E-16
sp|Q9NX07|TSAP1_HUMAN tRNA selenocysteine 1-associated protein 1 OS=Homo sapiens GN=TRNAU1AP PE=1 SV=1 84 253 6.0E-16
sp|Q920Q6|MSI2H_MOUSE RNA-binding protein Musashi homolog 2 OS=Mus musculus GN=Msi2 PE=1 SV=1 66 252 1.0E-15
sp|Q9JII5|DAZP1_MOUSE DAZ-associated protein 1 OS=Mus musculus GN=Dazap1 PE=1 SV=2 85 243 1.0E-15
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 85 252 1.0E-15
sp|Q9QZI7|TSAP1_RAT tRNA selenocysteine 1-associated protein 1 OS=Rattus norvegicus GN=Trnau1ap PE=1 SV=1 84 253 1.0E-15
sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 85 282 2.0E-15
sp|Q5R462|TSAP1_PONAB tRNA selenocysteine 1-associated protein 1 OS=Pongo abelii GN=TRNAU1AP PE=2 SV=1 84 253 2.0E-15
sp|Q96EP5|DAZP1_HUMAN DAZ-associated protein 1 OS=Homo sapiens GN=DAZAP1 PE=1 SV=1 85 243 2.0E-15
sp|Q80VC6|TSAP1_MOUSE tRNA selenocysteine 1-associated protein 1 OS=Mus musculus GN=Trnau1ap PE=1 SV=2 84 253 2.0E-15
sp|Q98SJ2|DAZP1_XENLA DAZ-associated protein 1 OS=Xenopus laevis GN=dazap1 PE=1 SV=1 85 243 2.0E-15
sp|P60050|PABP5_PONPY Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 87 364 3.0E-15
sp|P60049|PABP5_PANTR Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 87 364 3.0E-15
sp|P60048|PABP5_HYLLA Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 87 364 3.0E-15
sp|Q96DU9|PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 87 364 3.0E-15
sp|P60047|PABP5_GORGO Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 87 364 3.0E-15
sp|Q7JGR2|PABP5_MACMU Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 87 364 3.0E-15
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 85 252 3.0E-15
sp|Q5RC80|RBM39_PONAB RNA-binding protein 39 OS=Pongo abelii GN=RBM39 PE=2 SV=1 79 258 3.0E-15
sp|Q14498|RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens GN=RBM39 PE=1 SV=2 79 258 4.0E-15
sp|Q8VH51|RBM39_MOUSE RNA-binding protein 39 OS=Mus musculus GN=Rbm39 PE=1 SV=2 79 258 4.0E-15
sp|P32588|PUB1_YEAST Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUB1 PE=1 SV=4 286 373 5.0E-15
sp|Q0CR95|PABP_ASPTN Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pab1 PE=3 SV=1 85 252 5.0E-15
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 174 372 5.0E-15
sp|O97018|SXL_CHRRU Sex-lethal homolog OS=Chrysomya rufifacies GN=SXL PE=2 SV=2 85 235 5.0E-15
sp|O17310|SXL_MUSDO Sex-lethal homolog OS=Musca domestica GN=SXL PE=2 SV=1 85 235 5.0E-15
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 85 252 5.0E-15
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 58 271 6.0E-15
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 85 282 6.0E-15
sp|Q8R3C6|RBM19_MOUSE Probable RNA-binding protein 19 OS=Mus musculus GN=Rbm19 PE=1 SV=1 85 250 6.0E-15
sp|Q10355|YDB2_SCHPO Uncharacterized RNA-binding protein C22E12.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22E12.02 PE=3 SV=1 172 265 7.0E-15
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 84 372 1.0E-14
sp|Q4R4J7|NUCL_MACFA Nucleolin OS=Macaca fascicularis GN=NCL PE=2 SV=3 83 254 1.0E-14
sp|P19338|NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 83 254 1.0E-14
sp|Q5RF26|NUCL_PONAB Nucleolin OS=Pongo abelii GN=NCL PE=2 SV=3 83 254 1.0E-14
sp|P19339|SXL_DROME Protein sex-lethal OS=Drosophila melanogaster GN=Sxl PE=1 SV=1 78 259 1.0E-14
sp|Q96DH6|MSI2H_HUMAN RNA-binding protein Musashi homolog 2 OS=Homo sapiens GN=MSI2 PE=1 SV=1 85 252 1.0E-14
sp|O43347|MSI1H_HUMAN RNA-binding protein Musashi homolog 1 OS=Homo sapiens GN=MSI1 PE=1 SV=1 85 310 1.0E-14
sp|Q4P8R9|PABP_USTMA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAB1 PE=3 SV=1 85 252 2.0E-14
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 85 441 2.0E-14
sp|O61374|SXL_CERCA Sex-lethal homolog OS=Ceratitis capitata GN=SXL PE=2 SV=2 85 235 2.0E-14
sp|Q24668|SXL_DROSU Protein sex-lethal OS=Drosophila subobscura GN=Sxl PE=2 SV=2 85 259 2.0E-14
sp|Q9Y4C8|RBM19_HUMAN Probable RNA-binding protein 19 OS=Homo sapiens GN=RBM19 PE=1 SV=3 85 250 2.0E-14
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 85 458 3.0E-14
sp|Q503H1|TSAP1_DANRE tRNA selenocysteine 1-associated protein 1 OS=Danio rerio GN=trnau1ap PE=2 SV=1 84 252 3.0E-14
sp|Q9WV25|PUF60_RAT Poly(U)-binding-splicing factor PUF60 OS=Rattus norvegicus GN=Puf60 PE=2 SV=2 45 275 3.0E-14
sp|Q3UEB3|PUF60_MOUSE Poly(U)-binding-splicing factor PUF60 OS=Mus musculus GN=Puf60 PE=1 SV=2 45 275 3.0E-14
sp|P82277|RRP2_SPIOL 30S ribosomal protein 2, chloroplastic OS=Spinacia oleracea GN=PSRP2 PE=1 SV=1 83 249 3.0E-14
sp|O04319|PABP6_ARATH Polyadenylate-binding protein 6 OS=Arabidopsis thaliana GN=PAB6 PE=2 SV=1 84 364 4.0E-14
sp|Q8W034|RNP1_ARATH Heterogeneous nuclear ribonucleoprotein 1 OS=Arabidopsis thaliana GN=RNP1 PE=1 SV=1 85 234 4.0E-14
sp|Q9UHX1|PUF60_HUMAN Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens GN=PUF60 PE=1 SV=1 45 275 4.0E-14
sp|Q5R469|PUF60_PONAB Poly(U)-binding-splicing factor PUF60 OS=Pongo abelii GN=PUF60 PE=2 SV=1 45 275 4.0E-14
sp|Q61474|MSI1H_MOUSE RNA-binding protein Musashi homolog 1 OS=Mus musculus GN=Msi1 PE=1 SV=1 85 310 5.0E-14
sp|Q8K3P4|MSI1H_RAT RNA-binding protein Musashi homolog 1 OS=Rattus norvegicus GN=Msi1 PE=2 SV=1 85 310 5.0E-14
sp|Q2UK72|PABP_ASPOR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pab1 PE=3 SV=1 85 214 6.0E-14
sp|Q9ZUU4|CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 170 377 7.0E-14
sp|Q2HJG2|PUF60_BOVIN Poly(U)-binding-splicing factor PUF60 OS=Bos taurus GN=PUF60 PE=2 SV=1 45 275 7.0E-14
sp|P27476|NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 85 249 8.0E-14
sp|Q6CDH3|PABP_YARLI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAB1 PE=3 SV=1 85 437 2.0E-13
sp|Q99383|HRP1_YEAST Nuclear polyadenylated RNA-binding protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRP1 PE=1 SV=1 85 227 2.0E-13
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 170 377 3.0E-13
sp|Q9LIS2|RBG4_ARATH Glycine-rich RNA-binding protein 4, mitochondrial OS=Arabidopsis thaliana GN=RBG4 PE=2 SV=1 175 252 3.0E-13
sp|O94432|YHKF_SCHPO Uncharacterized RNA-binding protein C660.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC660.15 PE=3 SV=1 85 232 3.0E-13
sp|P08199|NUCL_MESAU Nucleolin OS=Mesocricetus auratus GN=NCL PE=1 SV=2 83 254 4.0E-13
sp|P19684|ROC5_NICSY 33 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 85 253 4.0E-13
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 85 465 5.0E-13
sp|Q9SVM8|RBG2_ARATH Glycine-rich RNA-binding protein 2, mitochondrial OS=Arabidopsis thaliana GN=RBG2 PE=1 SV=1 175 252 5.0E-13
sp|P13383|NUCL_RAT Nucleolin OS=Rattus norvegicus GN=Ncl PE=1 SV=3 83 254 7.0E-13
sp|P20397|NUCL_XENLA Nucleolin OS=Xenopus laevis GN=ncl PE=2 SV=3 75 253 7.0E-13
sp|Q8VXZ9|R47BP_ARATH Polyadenylate-binding protein RBP47B' OS=Arabidopsis thaliana GN=RBP47B' PE=2 SV=1 84 289 8.0E-13
sp|P17130|ROA1_XENLA Heterogeneous nuclear ribonucleoproteins A1 homolog OS=Xenopus laevis GN=hnrnpa1 PE=2 SV=1 76 231 8.0E-13
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 170 376 9.0E-13
sp|Q8SR30|PABP_ENCCU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Encephalitozoon cuniculi (strain GB-M1) GN=PAB1 PE=1 SV=1 85 356 9.0E-13
sp|A2Q848|PABP_ASPNC Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pab1 PE=3 SV=1 85 212 1.0E-12
sp|Q1LZD9|PSPC1_BOVIN Paraspeckle component 1 OS=Bos taurus GN=PSPC1 PE=2 SV=1 85 239 1.0E-12
sp|Q6IQE0|PU60B_DANRE Poly(U)-binding-splicing factor PUF60-B OS=Danio rerio GN=puf60b PE=2 SV=2 45 275 1.0E-12
sp|P48809|RB27C_DROME Heterogeneous nuclear ribonucleoprotein 27C OS=Drosophila melanogaster GN=Hrb27C PE=1 SV=2 79 228 1.0E-12
sp|Q6FKG4|PABP_CANGA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAB1 PE=3 SV=1 85 378 2.0E-12
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 170 377 2.0E-12
sp|Q03878|GRP1_DAUCA Glycine-rich RNA-binding protein OS=Daucus carota PE=2 SV=1 173 249 2.0E-12
sp|Q8RWN5|RZ1C_ARATH Glycine-rich RNA-binding protein RZ1C OS=Arabidopsis thaliana GN=RZ1C PE=1 SV=1 174 252 2.0E-12
sp|Q86U06|RBM23_HUMAN Probable RNA-binding protein 23 OS=Homo sapiens GN=RBM23 PE=1 SV=1 79 252 2.0E-12
sp|Q5ZK88|PSPC1_CHICK Paraspeckle component 1 OS=Gallus gallus GN=PSPC1 PE=2 SV=1 85 239 3.0E-12
sp|Q9FNR1|RBG3_ARATH Glycine-rich RNA-binding protein 3, mitochondrial OS=Arabidopsis thaliana GN=RBG3 PE=2 SV=1 174 252 3.0E-12
sp|Q9VVE5|MSIR6_DROME RNA-binding protein Musashi homolog Rbp6 OS=Drosophila melanogaster GN=Rbp6 PE=2 SV=3 85 252 3.0E-12
sp|A1CRM1|PABP_ASPCL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pab1 PE=3 SV=1 85 207 4.0E-12
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 170 377 4.0E-12
sp|Q4KLH4|PSPC1_RAT Paraspeckle component 1 OS=Rattus norvegicus GN=Pspc1 PE=1 SV=1 85 239 4.0E-12
sp|O93235|CIRBA_XENLA Cold-inducible RNA-binding protein A OS=Xenopus laevis GN=cirbp-a PE=1 SV=2 175 251 4.0E-12
sp|Q8R326|PSPC1_MOUSE Paraspeckle component 1 OS=Mus musculus GN=Pspc1 PE=1 SV=1 85 239 4.0E-12
sp|O01671|SXL_MEGSC Sex-lethal homolog OS=Megaselia scalaris GN=SXL PE=2 SV=3 156 355 5.0E-12
sp|P60825|CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus GN=Cirbp PE=2 SV=1 175 251 5.0E-12
sp|P60824|CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus GN=Cirbp PE=1 SV=1 175 251 5.0E-12
sp|P60826|CIRBP_CRIGR Cold-inducible RNA-binding protein OS=Cricetulus griseus GN=CIRBP PE=2 SV=1 175 251 5.0E-12
sp|Q13151|ROA0_HUMAN Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens GN=HNRNPA0 PE=1 SV=1 85 230 5.0E-12
sp|Q94901|LARK_DROME RNA-binding protein lark OS=Drosophila melanogaster GN=lark PE=1 SV=1 85 256 5.0E-12
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 85 252 6.0E-12
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 80 377 7.0E-12
sp|Q3MHX3|RBM4_BOVIN RNA-binding protein 4 OS=Bos taurus GN=RBM4 PE=2 SV=1 85 267 7.0E-12
sp|Q8WXF1|PSPC1_HUMAN Paraspeckle component 1 OS=Homo sapiens GN=PSPC1 PE=1 SV=1 85 239 7.0E-12
sp|Q5RF83|CIRBP_PONAB Cold-inducible RNA-binding protein OS=Pongo abelii GN=CIRBP PE=2 SV=1 175 251 7.0E-12
sp|Q14011|CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens GN=CIRBP PE=1 SV=1 175 251 7.0E-12
sp|Q02926|RB97D_DROME Ribonucleoprotein RB97D OS=Drosophila melanogaster GN=Rb97D PE=2 SV=1 83 231 8.0E-12
sp|P32588|PUB1_YEAST Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUB1 PE=1 SV=4 161 372 1.0E-11
sp|P70372|ELAV1_MOUSE ELAV-like protein 1 OS=Mus musculus GN=Elavl1 PE=1 SV=2 174 393 1.0E-11
sp|Q5B630|PABP_EMENI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pab1 PE=2 SV=2 85 252 1.0E-11
sp|O60506|HNRPQ_HUMAN Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens GN=SYNCRIP PE=1 SV=2 85 264 1.0E-11
sp|Q4R979|RBM4_MACFA RNA-binding protein 4 OS=Macaca fascicularis GN=RBM4 PE=2 SV=1 85 267 1.0E-11
sp|Q9BWF3|RBM4_HUMAN RNA-binding protein 4 OS=Homo sapiens GN=RBM4 PE=1 SV=1 85 267 1.0E-11
sp|Q9DED4|CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis GN=cirbp-b PE=1 SV=1 175 251 1.0E-11
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 85 265 2.0E-11
sp|Q0U1G2|PABP_PHANO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAB1 PE=3 SV=3 85 252 2.0E-11
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 175 381 2.0E-11
sp|P09405|NUCL_MOUSE Nucleolin OS=Mus musculus GN=Ncl PE=1 SV=2 83 254 2.0E-11
sp|Q7TP47|HNRPQ_RAT Heterogeneous nuclear ribonucleoprotein Q OS=Rattus norvegicus GN=Syncrip PE=2 SV=1 85 264 2.0E-11
sp|Q32P51|RA1L2_HUMAN Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens GN=HNRNPA1L2 PE=2 SV=2 74 231 2.0E-11
sp|Q7TMK9|HNRPQ_MOUSE Heterogeneous nuclear ribonucleoprotein Q OS=Mus musculus GN=Syncrip PE=1 SV=2 85 264 2.0E-11
sp|P21522|ROA1_SCHAM Heterogeneous nuclear ribonucleoprotein A1, A2/B1 homolog OS=Schistocerca americana GN=HNRNP PE=2 SV=1 83 241 2.0E-11
sp|Q99K48|NONO_MOUSE Non-POU domain-containing octamer-binding protein OS=Mus musculus GN=Nono PE=1 SV=3 85 239 2.0E-11
sp|Q5FVM4|NONO_RAT Non-POU domain-containing octamer-binding protein OS=Rattus norvegicus GN=Nono PE=1 SV=3 85 239 3.0E-11
sp|Q9CX86|ROA0_MOUSE Heterogeneous nuclear ribonucleoprotein A0 OS=Mus musculus GN=Hnrnpa0 PE=1 SV=1 85 230 3.0E-11
sp|P51992|RO32_XENLA Heterogeneous nuclear ribonucleoprotein A3 homolog 2 OS=Xenopus laevis PE=2 SV=1 79 231 3.0E-11
sp|Q5RFL9|NONO_PONAB Non-POU domain-containing octamer-binding protein OS=Pongo abelii GN=NONO PE=2 SV=3 85 239 3.0E-11
sp|Q15233|NONO_HUMAN Non-POU domain-containing octamer-binding protein OS=Homo sapiens GN=NONO PE=1 SV=4 85 239 3.0E-11
sp|Q9U1N0|HRP65_CHITE Hrp65 protein OS=Chironomus tentans GN=HRP65 PE=1 SV=1 85 232 3.0E-11
sp|Q9BX46|RBM24_HUMAN RNA-binding protein 24 OS=Homo sapiens GN=RBM24 PE=1 SV=1 165 309 3.0E-11
sp|Q28521|ROA1_MACMU Heterogeneous nuclear ribonucleoprotein A1 OS=Macaca mulatta GN=HNRNPA1 PE=2 SV=3 79 231 3.0E-11
sp|Q3ZC34|RBMS2_BOVIN RNA-binding motif, single-stranded-interacting protein 2 OS=Bos taurus GN=RBMS2 PE=2 SV=1 81 261 3.0E-11
sp|P51991|ROA3_HUMAN Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens GN=HNRNPA3 PE=1 SV=2 79 231 4.0E-11
sp|Q6URK4|ROA3_RAT Heterogeneous nuclear ribonucleoprotein A3 OS=Rattus norvegicus GN=Hnrnpa3 PE=1 SV=1 79 231 4.0E-11
sp|Q8BG05|ROA3_MOUSE Heterogeneous nuclear ribonucleoprotein A3 OS=Mus musculus GN=Hnrnpa3 PE=1 SV=1 79 231 4.0E-11
sp|P04256|ROA1_RAT Heterogeneous nuclear ribonucleoprotein A1 OS=Rattus norvegicus GN=Hnrnpa1 PE=1 SV=3 79 231 4.0E-11
sp|D3Z4I3|RBM24_MOUSE RNA-binding protein 24 OS=Mus musculus GN=Rbm24 PE=3 SV=1 165 309 4.0E-11
sp|A5A6H4|ROA1_PANTR Heterogeneous nuclear ribonucleoprotein A1 OS=Pan troglodytes GN=HNRNPA1 PE=2 SV=1 79 231 4.0E-11
sp|P49312|ROA1_MOUSE Heterogeneous nuclear ribonucleoprotein A1 OS=Mus musculus GN=Hnrnpa1 PE=1 SV=2 79 231 4.0E-11
sp|P09867|ROA1_BOVIN Heterogeneous nuclear ribonucleoprotein A1 OS=Bos taurus GN=HNRNPA1 PE=1 SV=2 79 231 4.0E-11
sp|Q8C7Q4|RBM4_MOUSE RNA-binding protein 4 OS=Mus musculus GN=Rbm4 PE=1 SV=1 85 267 4.0E-11
sp|P48810|RB87F_DROME Heterogeneous nuclear ribonucleoprotein 87F OS=Drosophila melanogaster GN=Hrb87F PE=2 SV=2 79 231 4.0E-11
sp|Q6CDH3|PABP_YARLI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAB1 PE=3 SV=1 165 364 5.0E-11
sp|Q55GD6|SF3B4_DICDI Splicing factor 3B subunit 4 OS=Dictyostelium discoideum GN=sf3b4 PE=3 SV=1 84 252 5.0E-11
sp|Q5RBD3|RBMS3_PONAB RNA-binding motif, single-stranded-interacting protein 3 OS=Pongo abelii GN=RBMS3 PE=2 SV=1 81 250 5.0E-11
sp|Q06AT9|RBM4B_PIG RNA-binding protein 4B OS=Sus scrofa GN=RBM4B PE=2 SV=1 85 267 5.0E-11
sp|Q6XE24|RBMS3_HUMAN RNA-binding motif, single-stranded-interacting protein 3 OS=Homo sapiens GN=RBMS3 PE=1 SV=1 81 250 6.0E-11
sp|Q9BQ04|RBM4B_HUMAN RNA-binding protein 4B OS=Homo sapiens GN=RBM4B PE=1 SV=1 85 267 6.0E-11
sp|P07909|ROA1_DROME Heterogeneous nuclear ribonucleoprotein A1 OS=Drosophila melanogaster GN=Hrb98DE PE=2 SV=1 83 231 6.0E-11
sp|Q8BWL5|RBMS3_MOUSE RNA-binding motif, single-stranded-interacting protein 3 OS=Mus musculus GN=Rbms3 PE=2 SV=2 81 250 6.0E-11
sp|Q28IQ9|CIRBP_XENTR Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 175 251 6.0E-11
sp|Q4R4J7|NUCL_MACFA Nucleolin OS=Macaca fascicularis GN=NCL PE=2 SV=3 63 372 7.0E-11
sp|Q9BDY9|RBM4_RABIT RNA-binding protein 4 OS=Oryctolagus cuniculus GN=RBM4 PE=2 SV=1 85 267 7.0E-11
sp|Q28HE9|CELF1_XENTR CUGBP Elav-like family member 1 OS=Xenopus tropicalis GN=celf1 PE=2 SV=1 78 234 7.0E-11
sp|Q64LC9|RBM4B_RAT RNA-binding protein 4B OS=Rattus norvegicus GN=Rbm4b PE=1 SV=2 85 260 7.0E-11
sp|Q8VE92|RBM4B_MOUSE RNA-binding protein 4B OS=Mus musculus GN=Rbm4b PE=1 SV=1 85 260 7.0E-11
sp|P19338|NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 63 372 8.0E-11
sp|Q5RF26|NUCL_PONAB Nucleolin OS=Pongo abelii GN=NCL PE=2 SV=3 63 372 8.0E-11
sp|O57406|CEL1A_XENLA CUGBP Elav-like family member 1-A OS=Xenopus laevis GN=cugbp1-a PE=1 SV=1 78 234 8.0E-11
sp|Q8W034|RNP1_ARATH Heterogeneous nuclear ribonucleoprotein 1 OS=Arabidopsis thaliana GN=RNP1 PE=1 SV=1 175 374 9.0E-11
sp|P09651|ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens GN=HNRNPA1 PE=1 SV=5 79 231 9.0E-11
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 175 382 1.0E-10
sp|Q9I8B3|RB24B_XENLA RNA-binding protein 24-B OS=Xenopus laevis GN=rbm24-b PE=2 SV=1 165 303 1.0E-10
sp|Q6GQD3|RB24A_XENLA RNA-binding protein 24-A OS=Xenopus laevis GN=rbm24-a PE=2 SV=1 165 259 1.0E-10
sp|B3M3R5|SHEP_DROAN Protein alan shepard OS=Drosophila ananassae GN=shep PE=3 SV=2 81 239 1.0E-10
sp|Q5PQP1|RBMS1_RAT RNA-binding motif, single-stranded-interacting protein 1 OS=Rattus norvegicus GN=Rbms1 PE=2 SV=1 81 250 1.0E-10
sp|P29558|RBMS1_HUMAN RNA-binding motif, single-stranded-interacting protein 1 OS=Homo sapiens GN=RBMS1 PE=1 SV=3 81 250 1.0E-10
sp|Q3ZBP3|RBMS1_BOVIN RNA-binding motif, single-stranded-interacting protein 1 OS=Bos taurus GN=RBMS1 PE=2 SV=1 81 250 1.0E-10
sp|Q91W59|RBMS1_MOUSE RNA-binding motif, single-stranded-interacting protein 1 OS=Mus musculus GN=Rbms1 PE=1 SV=1 81 250 1.0E-10
sp|Q5ZJX4|RBM38_CHICK RNA-binding protein 38 OS=Gallus gallus GN=RBM38 PE=2 SV=1 162 280 1.0E-10
sp|B4KX02|SHEP_DROMO Protein alan shepard OS=Drosophila mojavensis GN=shep PE=3 SV=1 81 239 1.0E-10
sp|Q6P8A7|RBM24_XENTR RNA-binding protein 24 OS=Xenopus tropicalis GN=rbm24 PE=2 SV=1 165 259 1.0E-10
sp|Q5R9Z6|ELAV2_PONAB ELAV-like protein 2 OS=Pongo abelii GN=ELAVL2 PE=2 SV=1 165 395 2.0E-10
sp|Q12926|ELAV2_HUMAN ELAV-like protein 2 OS=Homo sapiens GN=ELAVL2 PE=1 SV=2 165 395 2.0E-10
sp|Q60899|ELAV2_MOUSE ELAV-like protein 2 OS=Mus musculus GN=Elavl2 PE=2 SV=1 165 395 2.0E-10
sp|O04425|FCA_ARATH Flowering time control protein FCA OS=Arabidopsis thaliana GN=FCA PE=1 SV=2 85 238 2.0E-10
sp|O43390|HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens GN=HNRNPR PE=1 SV=1 85 277 2.0E-10
sp|Q5ZMA3|RBM24_CHICK RNA-binding protein 24 OS=Gallus gallus GN=RBM24 PE=2 SV=2 167 259 2.0E-10
sp|Q15434|RBMS2_HUMAN RNA-binding motif, single-stranded-interacting protein 2 OS=Homo sapiens GN=RBMS2 PE=1 SV=1 81 281 2.0E-10
sp|P41891|GAR2_SCHPO Protein gar2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gar2 PE=1 SV=2 167 368 2.0E-10
sp|P51968|RO31_XENLA Heterogeneous nuclear ribonucleoprotein A3 homolog 1 OS=Xenopus laevis PE=2 SV=1 79 231 2.0E-10
sp|Q76LC6|RBM24_DANRE RNA-binding protein 24 OS=Danio rerio GN=rbm24 PE=2 SV=1 165 259 2.0E-10
sp|Q9FPJ8|RB45A_ARATH Polyadenylate-binding protein RBP45A OS=Arabidopsis thaliana GN=RBP45A PE=2 SV=1 79 162 3.0E-10
sp|Q6DIV4|RBM38_XENTR RNA-binding protein 38 OS=Xenopus tropicalis GN=rbm38 PE=2 SV=1 162 299 3.0E-10
sp|O22703|RZ1B_ARATH Glycine-rich RNA-binding protein RZ1B OS=Arabidopsis thaliana GN=RZ1B PE=2 SV=1 174 252 3.0E-10
sp|Q99070|GRP2_SORBI Glycine-rich RNA-binding protein 2 OS=Sorghum bicolor GN=GRP2 PE=2 SV=1 172 249 3.0E-10
sp|Q03251|RBG8_ARATH Glycine-rich RNA-binding protein 8 OS=Arabidopsis thaliana GN=RBG8 PE=1 SV=1 172 249 3.0E-10
sp|P23246|SFPQ_HUMAN Splicing factor, proline- and glutamine-rich OS=Homo sapiens GN=SFPQ PE=1 SV=2 85 232 3.0E-10
sp|Q5U259|ELV1B_XENLA ELAV-like protein 1-B OS=Xenopus laevis GN=elavl1-b PE=1 SV=1 174 391 4.0E-10
sp|Q5JQF8|PAP1M_HUMAN Polyadenylate-binding protein 1-like 2 OS=Homo sapiens GN=PABPC1L2A PE=2 SV=1 175 379 4.0E-10
sp|Q8VC70|RBMS2_MOUSE RNA-binding motif, single-stranded-interacting protein 2 OS=Mus musculus GN=Rbms2 PE=1 SV=1 81 261 4.0E-10
sp|Q9PTX2|CIRBP_LITCT Cold-inducible RNA-binding protein OS=Lithobates catesbeiana GN=cirbp PE=2 SV=1 174 251 4.0E-10
sp|Q5SZQ8|CELF3_HUMAN CUGBP Elav-like family member 3 OS=Homo sapiens GN=CELF3 PE=1 SV=1 79 234 4.0E-10
sp|Q08E07|CELF3_BOVIN CUGBP Elav-like family member 3 OS=Bos taurus GN=CELF3 PE=2 SV=1 79 234 5.0E-10
sp|P49310|GRP1_SINAL Glycine-rich RNA-binding protein GRP1A OS=Sinapis alba PE=2 SV=1 172 249 5.0E-10
sp|P15771|NUCL_CHICK Nucleolin OS=Gallus gallus GN=NCL PE=1 SV=1 79 254 5.0E-10
sp|Q9IBD0|CELF1_DANRE CUGBP Elav-like family member 1 OS=Danio rerio GN=celf1 PE=1 SV=1 78 234 5.0E-10
sp|Q9C909|RBG5_ARATH Glycine-rich RNA-binding protein 5, mitochondrial OS=Arabidopsis thaliana GN=RBG5 PE=2 SV=1 175 251 6.0E-10
sp|Q8VIJ6|SFPQ_MOUSE Splicing factor, proline- and glutamine-rich OS=Mus musculus GN=Sfpq PE=1 SV=1 85 232 6.0E-10
sp|Q22037|ROA1_CAEEL Heterogeneous nuclear ribonucleoprotein A1 OS=Caenorhabditis elegans GN=hrp-1 PE=1 SV=1 76 231 6.0E-10
sp|P51990|RO22_XENLA Heterogeneous nuclear ribonucleoprotein A2 homolog 2 OS=Xenopus laevis PE=2 SV=1 83 231 6.0E-10
sp|Q7T3I7|RBM38_XENLA RNA-binding protein 38 OS=Xenopus laevis GN=rbm38 PE=1 SV=2 162 299 6.0E-10
sp|Q9H0Z9|RBM38_HUMAN RNA-binding protein 38 OS=Homo sapiens GN=RBM38 PE=1 SV=2 165 280 8.0E-10
sp|O15042|SR140_HUMAN U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens GN=U2SURP PE=1 SV=2 174 248 9.0E-10
sp|Q5R7X2|SR140_PONAB U2 snRNP-associated SURP motif-containing protein OS=Pongo abelii GN=U2SURP PE=2 SV=1 174 248 9.0E-10
sp|Q6NV83|SR140_MOUSE U2 snRNP-associated SURP motif-containing protein OS=Mus musculus GN=U2surp PE=1 SV=3 174 248 9.0E-10
sp|Q0WW84|RB47B_ARATH Polyadenylate-binding protein RBP47B OS=Arabidopsis thaliana GN=RBP47B PE=2 SV=1 175 378 1.0E-09
sp|Q5R9H4|A1CF_PONAB APOBEC1 complementation factor OS=Pongo abelii GN=A1CF PE=2 SV=1 85 250 1.0E-09
sp|Q9LES2|UBA2A_ARATH UBP1-associated protein 2A OS=Arabidopsis thaliana GN=UBA2A PE=1 SV=1 132 383 1.0E-09
sp|Q4G338|PPIE_HAECO Peptidyl-prolyl cis-trans isomerase E OS=Haemonchus contortus PE=1 SV=1 175 249 1.0E-09
sp|Q62504|MINT_MOUSE Msx2-interacting protein OS=Mus musculus GN=Spen PE=1 SV=2 83 254 1.0E-09
sp|Q9UNP9|PPIE_HUMAN Peptidyl-prolyl cis-trans isomerase E OS=Homo sapiens GN=PPIE PE=1 SV=1 175 250 1.0E-09
sp|Q5R723|PPIE_PONAB Peptidyl-prolyl cis-trans isomerase E OS=Pongo abelii GN=PPIE PE=2 SV=1 175 250 1.0E-09
sp|A4FV72|PPIE_BOVIN Peptidyl-prolyl cis-trans isomerase E OS=Bos taurus GN=PPIE PE=2 SV=1 175 250 1.0E-09
sp|W8E7I1|RBM3_CAPHI RNA-binding protein 3 OS=Capra hircus GN=RBM3 PE=2 SV=2 169 256 1.0E-09
sp|Q99181|HSH49_YEAST Protein HSH49 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSH49 PE=1 SV=1 85 249 1.0E-09
sp|O89086|RBM3_MOUSE RNA-binding protein 3 OS=Mus musculus GN=Rbm3 PE=1 SV=1 175 249 1.0E-09
sp|Q792H5|CELF2_RAT CUGBP Elav-like family member 2 OS=Rattus norvegicus GN=Celf2 PE=2 SV=1 78 234 1.0E-09
sp|Q5R8Y8|CELF2_PONAB CUGBP Elav-like family member 2 OS=Pongo abelii GN=CELF2 PE=2 SV=2 78 234 1.0E-09
sp|Q9Z0H4|CELF2_MOUSE CUGBP Elav-like family member 2 OS=Mus musculus GN=Celf2 PE=1 SV=1 78 234 1.0E-09
sp|O95319|CELF2_HUMAN CUGBP Elav-like family member 2 OS=Homo sapiens GN=CELF2 PE=1 SV=1 78 234 1.0E-09
sp|Q9NQ94|A1CF_HUMAN APOBEC1 complementation factor OS=Homo sapiens GN=A1CF PE=1 SV=1 85 250 1.0E-09
sp|Q7ZWM3|CEL3B_XENLA CUGBP Elav-like family member 3-B OS=Xenopus laevis GN=tnrc4-b PE=2 SV=1 79 236 1.0E-09
sp|Q28IQ9|CIRBP_XENTR Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 85 162 2.0E-09
sp|P15771|NUCL_CHICK Nucleolin OS=Gallus gallus GN=NCL PE=1 SV=1 63 372 2.0E-09
sp|Q9QZH3|PPIE_MOUSE Peptidyl-prolyl cis-trans isomerase E OS=Mus musculus GN=Ppie PE=1 SV=2 175 250 2.0E-09
sp|O80678|UBA2B_ARATH UBP1-associated protein 2B OS=Arabidopsis thaliana GN=UBA2B PE=2 SV=1 83 250 2.0E-09
sp|Q7ZWA3|RBMX_DANRE RNA-binding motif protein, X chromosome OS=Danio rerio GN=rbmx PE=2 SV=1 175 251 2.0E-09
sp|Q8T6B9|PUF68_DROME Poly(U)-binding-splicing factor half pint OS=Drosophila melanogaster GN=pUf68 PE=1 SV=2 85 246 2.0E-09
sp|Q6P0B1|CELF2_DANRE CUGBP Elav-like family member 2 OS=Danio rerio GN=celf2 PE=2 SV=1 78 234 2.0E-09
sp|Q91WT8|RBM47_MOUSE RNA-binding protein 47 OS=Mus musculus GN=Rbm47 PE=1 SV=1 85 312 2.0E-09
sp|Q5R995|CELF1_PONAB CUGBP Elav-like family member 1 OS=Pongo abelii GN=CELF1 PE=2 SV=1 78 234 2.0E-09
sp|Q6PF35|CEL1B_XENLA CUGBP Elav-like family member 1-B OS=Xenopus laevis GN=cugbp1-b PE=2 SV=1 78 234 2.0E-09
sp|Q05966|GRP10_BRANA Glycine-rich RNA-binding protein 10 OS=Brassica napus GN=GRP10 PE=2 SV=1 172 249 2.0E-09
sp|Q66H68|RBM47_RAT RNA-binding protein 47 OS=Rattus norvegicus GN=Rbm47 PE=2 SV=1 85 312 2.0E-09
sp|P98179|RBM3_HUMAN RNA-binding protein 3 OS=Homo sapiens GN=RBM3 PE=1 SV=1 175 254 2.0E-09
sp|P49311|GRP2_SINAL Glycine-rich RNA-binding protein GRP2A OS=Sinapis alba PE=2 SV=1 172 249 2.0E-09
sp|Q03250|RBG7_ARATH Glycine-rich RNA-binding protein 7 OS=Arabidopsis thaliana GN=RBG7 PE=1 SV=1 172 247 2.0E-09
sp|Q91579|CEL3A_XENLA CUGBP Elav-like family member 3-A OS=Xenopus laevis GN=tnrc4-a PE=2 SV=2 79 236 2.0E-09
sp|Q5B630|PABP_EMENI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pab1 PE=2 SV=2 158 382 3.0E-09
sp|Q4P8R9|PABP_USTMA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAB1 PE=3 SV=1 165 251 3.0E-09
sp|O61374|SXL_CERCA Sex-lethal homolog OS=Ceratitis capitata GN=SXL PE=2 SV=2 174 355 3.0E-09
sp|Q1JPY8|PSPC1_DANRE Paraspeckle component 1 OS=Danio rerio GN=pspc1 PE=2 SV=1 85 239 3.0E-09
sp|Q9LEB4|RBP45_NICPL Polyadenylate-binding protein RBP45 OS=Nicotiana plumbaginifolia GN=RBP45 PE=1 SV=1 79 157 4.0E-09
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 175 382 4.0E-09
sp|P08199|NUCL_MESAU Nucleolin OS=Mesocricetus auratus GN=NCL PE=1 SV=2 63 372 4.0E-09
sp|Q9TTV2|ROA2_SAGOE Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Saguinus oedipus GN=HNRNPA2B1 PE=1 SV=1 83 231 4.0E-09
sp|Q9H0L4|CSTFT_HUMAN Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens GN=CSTF2T PE=1 SV=1 156 252 4.0E-09
sp|Q04047|NONA_DROME Protein no-on-transient A OS=Drosophila melanogaster GN=nonA PE=1 SV=2 85 231 4.0E-09
sp|Q7ZXE2|CELF2_XENLA CUGBP Elav-like family member 2 OS=Xenopus laevis GN=celf2 PE=1 SV=1 78 234 4.0E-09
sp|Q8CIN6|CELF3_MOUSE CUGBP Elav-like family member 3 OS=Mus musculus GN=Celf3 PE=2 SV=1 79 234 4.0E-09
sp|Q8C7E9|CSTFT_MOUSE Cleavage stimulation factor subunit 2 tau variant OS=Mus musculus GN=Cstf2t PE=1 SV=2 156 252 4.0E-09
sp|Q43349|CP29A_ARATH 29 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP29A PE=2 SV=2 174 252 4.0E-09
sp|A5A6M3|RBMX_PANTR RNA-binding motif protein, X chromosome OS=Pan troglodytes GN=RBMX PE=2 SV=1 175 251 5.0E-09
sp|P38159|RBMX_HUMAN RNA-binding motif protein, X chromosome OS=Homo sapiens GN=RBMX PE=1 SV=3 175 251 5.0E-09
sp|Q4R7F0|RBMX_MACFA RNA-binding motif protein, X chromosome OS=Macaca fascicularis GN=RBMX PE=2 SV=1 175 251 5.0E-09
sp|Q7T2T1|CELF2_CHICK CUGBP Elav-like family member 2 OS=Gallus gallus GN=CELF2 PE=1 SV=2 78 234 5.0E-09
sp|O88569|ROA2_MOUSE Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Mus musculus GN=Hnrnpa2b1 PE=1 SV=2 74 231 5.0E-09
sp|P22626|ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens GN=HNRNPA2B1 PE=1 SV=2 74 231 5.0E-09
sp|Q925G0|RBM3_RAT RNA-binding protein 3 OS=Rattus norvegicus GN=Rbm3 PE=1 SV=2 175 251 5.0E-09
sp|Q9WV02|RBMX_MOUSE RNA-binding motif protein, X chromosome OS=Mus musculus GN=Rbmx PE=1 SV=1 174 251 5.0E-09
sp|Q5RBU8|ROA2_PONAB Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Pongo abelii GN=HNRNPA2B1 PE=2 SV=1 74 231 5.0E-09
sp|A7VJC2|ROA2_RAT Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Rattus norvegicus GN=Hnrnpa2b1 PE=1 SV=1 74 231 5.0E-09
sp|Q4V898|RBMX_RAT RNA-binding motif protein, X chromosome OS=Rattus norvegicus GN=Rbmx PE=1 SV=1 174 251 5.0E-09
sp|Q91VM5|RMXL1_MOUSE RNA binding motif protein, X-linked-like-1 OS=Mus musculus GN=Rbmxl1 PE=2 SV=1 174 251 5.0E-09
sp|P39697|RT19_ARATH 40S ribosomal protein S19, mitochondrial OS=Arabidopsis thaliana GN=RPS19 PE=1 SV=2 175 257 5.0E-09
sp|A4IIM2|CELF2_XENTR CUGBP Elav-like family member 2 OS=Xenopus tropicalis GN=celf2 PE=2 SV=1 78 234 5.0E-09
sp|Q8BIQ5|CSTF2_MOUSE Cleavage stimulation factor subunit 2 OS=Mus musculus GN=Cstf2 PE=1 SV=2 171 298 6.0E-09
sp|Q8HXM1|CSTF2_BOVIN Cleavage stimulation factor subunit 2 OS=Bos taurus GN=CSTF2 PE=2 SV=1 171 252 6.0E-09
sp|Q9SVV9|AML3_ARATH Protein MEI2-like 3 OS=Arabidopsis thaliana GN=ML3 PE=2 SV=2 83 266 6.0E-09
sp|Q5RDA3|CSTF2_PONAB Cleavage stimulation factor subunit 2 OS=Pongo abelii GN=CSTF2 PE=2 SV=1 171 298 6.0E-09
sp|P33240|CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens GN=CSTF2 PE=1 SV=1 171 298 6.0E-09
sp|Q91584|ELAV3_XENLA ELAV-like protein 3 OS=Xenopus laevis GN=elavl3 PE=2 SV=1 162 356 7.0E-09
sp|Q8T6B9|PUF68_DROME Poly(U)-binding-splicing factor half pint OS=Drosophila melanogaster GN=pUf68 PE=1 SV=2 174 366 7.0E-09
sp|Q2HJ60|ROA2_BOVIN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Bos taurus GN=HNRNPA2B1 PE=2 SV=1 83 231 7.0E-09
sp|Q7S6N6|PABP_NEUCR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pabp-1 PE=3 SV=1 175 382 8.0E-09
sp|Q6CEW9|MRD1_YARLI Multiple RNA-binding domain-containing protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MRD1 PE=3 SV=1 42 265 8.0E-09
sp|Q99020|ROAA_MOUSE Heterogeneous nuclear ribonucleoprotein A/B OS=Mus musculus GN=Hnrnpab PE=1 SV=1 85 233 8.0E-09
sp|O97018|SXL_CHRRU Sex-lethal homolog OS=Chrysomya rufifacies GN=SXL PE=2 SV=2 174 355 9.0E-09
sp|Q24668|SXL_DROSU Protein sex-lethal OS=Drosophila subobscura GN=Sxl PE=2 SV=2 167 355 9.0E-09
sp|P51989|RO21_XENLA Heterogeneous nuclear ribonucleoprotein A2 homolog 1 OS=Xenopus laevis PE=2 SV=1 83 231 9.0E-09
sp|Q5F3T7|CELF1_CHICK CUGBP Elav-like family member 1 OS=Gallus gallus GN=CELF1 PE=1 SV=2 78 234 9.0E-09
sp|Q99020|ROAA_MOUSE Heterogeneous nuclear ribonucleoprotein A/B OS=Mus musculus GN=Hnrnpab PE=1 SV=1 165 378 1.0E-08
sp|B4PIS2|SHEP_DROYA Protein alan shepard OS=Drosophila yakuba GN=shep PE=3 SV=1 81 239 1.0E-08
sp|B3NGA1|SHEP_DROER Protein alan shepard OS=Drosophila erecta GN=shep PE=3 SV=1 81 239 1.0E-08
sp|P28659|CELF1_MOUSE CUGBP Elav-like family member 1 OS=Mus musculus GN=Celf1 PE=1 SV=2 78 234 1.0E-08
sp|Q4QQT3|CELF1_RAT CUGBP Elav-like family member 1 OS=Rattus norvegicus GN=Celf1 PE=2 SV=1 78 234 1.0E-08
sp|Q44554|RBPB_NOSS1 Putative RNA-binding protein RbpB OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpB PE=3 SV=3 175 252 1.0E-08
sp|B4HUE4|SHEP_DROSE Protein alan shepard OS=Drosophila sechellia GN=shep PE=3 SV=1 81 239 1.0E-08
sp|Q8LPQ9|FPA_ARATH Flowering time control protein FPA OS=Arabidopsis thaliana GN=FPA PE=2 SV=2 85 377 1.0E-08
sp|Q8MSV2|SHEP_DROME Protein alan shepard OS=Drosophila melanogaster GN=shep PE=1 SV=2 81 239 1.0E-08
sp|O09032|ELAV4_RAT ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1 169 256 2.0E-08
sp|Q61701|ELAV4_MOUSE ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1 SV=1 169 256 2.0E-08
sp|P26378|ELAV4_HUMAN ELAV-like protein 4 OS=Homo sapiens GN=ELAVL4 PE=1 SV=2 169 256 2.0E-08
sp|P60050|PABP5_PONPY Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 177 379 2.0E-08
sp|P60049|PABP5_PANTR Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 177 379 2.0E-08
sp|P60048|PABP5_HYLLA Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 177 379 2.0E-08
sp|Q96DU9|PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 177 379 2.0E-08
sp|P60047|PABP5_GORGO Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 177 379 2.0E-08
sp|Q7JGR2|PABP5_MACMU Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 177 379 2.0E-08
sp|Q1ZXC2|PAP1B_DICDI Polyadenylate-binding protein 1-B OS=Dictyostelium discoideum GN=pabpc1B PE=3 SV=1 91 251 2.0E-08
sp|P19339|SXL_DROME Protein sex-lethal OS=Drosophila melanogaster GN=Sxl PE=1 SV=1 161 355 2.0E-08
sp|P13383|NUCL_RAT Nucleolin OS=Rattus norvegicus GN=Ncl PE=1 SV=3 63 372 2.0E-08
sp|Q08473|SQD_DROME RNA-binding protein squid OS=Drosophila melanogaster GN=sqd PE=1 SV=3 66 234 2.0E-08
sp|P84586|RMXRL_RAT RNA-binding motif protein, X chromosome retrogene-like OS=Rattus norvegicus GN=Rbmxrtl PE=1 SV=1 174 251 2.0E-08
sp|D4AE41|RMXL1_RAT RNA binding motif protein, X-linked-like-1 OS=Rattus norvegicus GN=Rbmxl1 PE=3 SV=1 174 251 2.0E-08
sp|Q9XSR3|RBM47_CANLF RNA-binding protein 47 OS=Canis lupus familiaris GN=RBM47 PE=2 SV=1 85 250 2.0E-08
sp|P10979|GRPA_MAIZE Glycine-rich RNA-binding, abscisic acid-inducible protein OS=Zea mays GN=RAB15 PE=1 SV=1 173 249 2.0E-08
sp|Q29RT0|RBMX_BOVIN RNA-binding motif protein, X chromosome OS=Bos taurus GN=RBMX PE=2 SV=1 174 251 2.0E-08
sp|Q96E39|RMXL1_HUMAN RNA binding motif protein, X-linked-like-1 OS=Homo sapiens GN=RBMXL1 PE=1 SV=1 175 251 2.0E-08
sp|Q92879|CELF1_HUMAN CUGBP Elav-like family member 1 OS=Homo sapiens GN=CELF1 PE=1 SV=2 78 234 2.0E-08
sp|Q8SX83|SPEN_DROME Protein split ends OS=Drosophila melanogaster GN=spen PE=1 SV=2 83 254 2.0E-08
sp|Q923K9|A1CF_RAT APOBEC1 complementation factor OS=Rattus norvegicus GN=A1cf PE=1 SV=1 85 250 2.0E-08
sp|Q9FNR1|RBG3_ARATH Glycine-rich RNA-binding protein 3, mitochondrial OS=Arabidopsis thaliana GN=RBG3 PE=2 SV=1 85 158 3.0E-08
sp|P86049|RBM46_MOUSE Probable RNA-binding protein 46 OS=Mus musculus GN=Rbm46 PE=1 SV=1 85 249 3.0E-08
sp|Q9WX37|RBPE_NOSS1 Putative RNA-binding protein RbpE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpE PE=3 SV=3 173 249 3.0E-08
sp|Q6ZI17|OML2_ORYSJ Protein MEI2-like 2 OS=Oryza sativa subsp. japonica GN=ML2 PE=2 SV=1 83 267 3.0E-08
sp|Q9LKA4|UBA2C_ARATH UBP1-associated protein 2C OS=Arabidopsis thaliana GN=UBA2C PE=2 SV=1 81 261 3.0E-08
sp|Q9IBD1|CELF3_DANRE CUGBP Elav-like family member 3 OS=Danio rerio GN=celf3 PE=2 SV=2 79 236 3.0E-08
sp|Q5YD48|A1CF_MOUSE APOBEC1 complementation factor OS=Mus musculus GN=A1cf PE=1 SV=2 85 250 3.0E-08
sp|Q4P7G1|EIF3G_USTMA Eukaryotic translation initiation factor 3 subunit G OS=Ustilago maydis (strain 521 / FGSC 9021) GN=TIF35 PE=3 SV=1 175 254 3.0E-08
sp|B4MM23|SHEP_DROWI Protein alan shepard OS=Drosophila willistoni GN=shep PE=3 SV=2 81 239 3.0E-08
sp|Q6IRQ4|RBMX_XENLA RNA-binding motif protein, X chromosome OS=Xenopus laevis GN=rbmx PE=2 SV=1 174 251 3.0E-08
sp|Q5R5P4|RBM47_PONAB RNA-binding protein 47 OS=Pongo abelii GN=RBM47 PE=2 SV=2 85 250 3.0E-08
sp|A0AV96|RBM47_HUMAN RNA-binding protein 47 OS=Homo sapiens GN=RBM47 PE=1 SV=2 85 250 3.0E-08
sp|Q7SZT7|ELAV4_XENLA ELAV-like protein 4 OS=Xenopus laevis GN=elavl4 PE=2 SV=1 169 256 4.0E-08
sp|P04256|ROA1_RAT Heterogeneous nuclear ribonucleoprotein A1 OS=Rattus norvegicus GN=Hnrnpa1 PE=1 SV=3 175 367 4.0E-08
sp|Q43472|GRP_HORVU Glycine-rich RNA-binding protein blt801 OS=Hordeum vulgare GN=blt801 PE=1 SV=1 172 252 4.0E-08
sp|Q96T37|RBM15_HUMAN Putative RNA-binding protein 15 OS=Homo sapiens GN=RBM15 PE=1 SV=2 68 277 4.0E-08
sp|B4QRJ0|SHEP_DROSI Protein alan shepard OS=Drosophila simulans GN=shep PE=3 SV=1 81 239 4.0E-08
sp|Q80YT9|RBM11_MOUSE Splicing regulator RBM11 OS=Mus musculus GN=Rbm11 PE=1 SV=1 83 162 4.0E-08
sp|Q8IUH3|RBM45_HUMAN RNA-binding protein 45 OS=Homo sapiens GN=RBM45 PE=1 SV=1 80 270 4.0E-08
sp|A4QNI8|ELAV4_XENTR ELAV-like protein 4 OS=Xenopus tropicalis GN=elavl4 PE=2 SV=1 169 256 5.0E-08
sp|Q9CQT2|RBM7_MOUSE RNA-binding protein 7 OS=Mus musculus GN=Rbm7 PE=1 SV=1 76 181 5.0E-08
sp|Q8TBY0|RBM46_HUMAN Probable RNA-binding protein 46 OS=Homo sapiens GN=RBM46 PE=2 SV=1 85 249 5.0E-08
sp|P57052|RBM11_HUMAN Splicing regulator RBM11 OS=Homo sapiens GN=RBM11 PE=1 SV=1 77 189 5.0E-08
sp|Q8BHN5|RBM45_MOUSE RNA-binding protein 45 OS=Mus musculus GN=Rbm45 PE=1 SV=1 80 261 6.0E-08
sp|Q9DED4|CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis GN=cirbp-b PE=1 SV=1 85 161 7.0E-08
sp|Q3SWU3|HNRDL_RAT Heterogeneous nuclear ribonucleoprotein D-like OS=Rattus norvegicus GN=Hnrnpdl PE=1 SV=1 85 233 7.0E-08
sp|Q24562|U2AF2_DROME Splicing factor U2AF 50 kDa subunit OS=Drosophila melanogaster GN=U2af50 PE=1 SV=1 32 308 7.0E-08
sp|B4LFQ9|SHEP_DROVI Protein alan shepard OS=Drosophila virilis GN=shep PE=3 SV=2 81 239 8.0E-08
sp|O14979|HNRDL_HUMAN Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens GN=HNRNPDL PE=1 SV=3 85 233 9.0E-08
sp|Q8C5L7|RBM34_MOUSE RNA-binding protein 34 OS=Mus musculus GN=Rbm34 PE=1 SV=1 81 246 9.0E-08
sp|Q9C652|RBP1_ARATH RNA-binding protein 1 OS=Arabidopsis thaliana GN=RBP1 PE=2 SV=1 81 243 9.0E-08
sp|A0JM51|CELF5_XENTR CUGBP Elav-like family member 5 OS=Xenopus tropicalis GN=celf5 PE=2 SV=1 85 263 9.0E-08
sp|Q1ZXC2|PAP1B_DICDI Polyadenylate-binding protein 1-B OS=Dictyostelium discoideum GN=pabpc1B PE=3 SV=1 79 376 1.0E-07
sp|P21522|ROA1_SCHAM Heterogeneous nuclear ribonucleoprotein A1, A2/B1 homolog OS=Schistocerca americana GN=HNRNP PE=2 SV=1 175 367 1.0E-07
sp|Q9H0L4|CSTFT_HUMAN Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens GN=CSTF2T PE=1 SV=1 70 171 1.0E-07
sp|Q8C7E9|CSTFT_MOUSE Cleavage stimulation factor subunit 2 tau variant OS=Mus musculus GN=Cstf2t PE=1 SV=2 70 171 1.0E-07
sp|B4IX08|SHEP_DROGR Protein alan shepard OS=Drosophila grimshawi GN=shep PE=3 SV=1 81 239 1.0E-07
sp|Q9R0U0|SRS10_MOUSE Serine/arginine-rich splicing factor 10 OS=Mus musculus GN=Srsf10 PE=1 SV=2 175 249 1.0E-07
sp|O75494|SRS10_HUMAN Serine/arginine-rich splicing factor 10 OS=Homo sapiens GN=SRSF10 PE=1 SV=1 175 249 1.0E-07
sp|Q09702|NRD1_SCHPO Negative regulator of differentiation 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nrd1 PE=1 SV=1 78 374 1.0E-07
sp|Q99729|ROAA_HUMAN Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens GN=HNRNPAB PE=1 SV=2 85 233 1.0E-07
sp|Q6Q151|CYP59_ARATH Peptidyl-prolyl cis-trans isomerase CYP59 OS=Arabidopsis thaliana GN=CYP59 PE=1 SV=1 175 249 1.0E-07
sp|Q5ZI72|HNRDL_CHICK Heterogeneous nuclear ribonucleoprotein D-like OS=Gallus gallus GN=HNRNPDL PE=2 SV=1 56 233 1.0E-07
sp|Q9V3G3|PPIE_DROME Peptidyl-prolyl cis-trans isomerase E OS=Drosophila melanogaster GN=cyp33 PE=1 SV=1 175 249 1.0E-07
sp|F4I3B3|RB47A_ARATH Polyadenylate-binding protein RBP47A OS=Arabidopsis thaliana GN=RBP47A PE=2 SV=1 79 174 2.0E-07
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 168 382 2.0E-07
sp|Q22037|ROA1_CAEEL Heterogeneous nuclear ribonucleoprotein A1 OS=Caenorhabditis elegans GN=hrp-1 PE=1 SV=1 175 376 2.0E-07
sp|Q5R1W5|SRSF2_PANTR Serine/arginine-rich splicing factor 2 OS=Pan troglodytes GN=SRSF2 PE=2 SV=3 175 250 2.0E-07
sp|Q4R2Z0|RBM46_MACFA Probable RNA-binding protein 46 OS=Macaca fascicularis GN=RBM46 PE=2 SV=2 85 249 2.0E-07
sp|Q8WP23|BOLL_MACFA Protein boule-like OS=Macaca fascicularis GN=BOLL PE=2 SV=2 175 324 2.0E-07
sp|P26368|U2AF2_HUMAN Splicing factor U2AF 65 kDa subunit OS=Homo sapiens GN=U2AF2 PE=1 SV=4 32 250 2.0E-07
sp|Q9LIN3|RZ1A_ARATH Glycine-rich RNA-binding protein RZ1A OS=Arabidopsis thaliana GN=RZ1A PE=1 SV=1 172 249 2.0E-07
sp|P30352|SRSF2_CHICK Serine/arginine-rich splicing factor 2 OS=Gallus gallus GN=SRSF2 PE=2 SV=1 175 250 2.0E-07
sp|P26369|U2AF2_MOUSE Splicing factor U2AF 65 kDa subunit OS=Mus musculus GN=U2af2 PE=1 SV=3 32 250 2.0E-07
sp|Q6NU14|HNDLB_XENLA Heterogeneous nuclear ribonucleoprotein D-like-B OS=Xenopus laevis GN=hnrnpdl-b PE=2 SV=1 82 233 2.0E-07
sp|Q57014|RBPA_SYNY3 Putative RNA-binding protein RbpA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rbpA PE=3 SV=3 175 252 2.0E-07
sp|Q8N9W6|BOLL_HUMAN Protein boule-like OS=Homo sapiens GN=BOLL PE=1 SV=2 175 324 2.0E-07
sp|P0DJD3|RBY1A_HUMAN RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Homo sapiens GN=RBMY1A1 PE=1 SV=1 85 158 2.0E-07
sp|P0C7P1|RBY1D_HUMAN RNA-binding motif protein, Y chromosome, family 1 member D OS=Homo sapiens GN=RBMY1D PE=2 SV=1 85 158 2.0E-07
sp|A6NEQ0|RBY1E_HUMAN RNA-binding motif protein, Y chromosome, family 1 member E OS=Homo sapiens GN=RBMY1E PE=2 SV=1 85 158 2.0E-07
sp|A6NDE4|RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens GN=RBMY1B PE=2 SV=2 85 158 2.0E-07
sp|P0DJD4|RBY1C_HUMAN RNA-binding motif protein, Y chromosome, family 1 member C OS=Homo sapiens GN=RBMY1C PE=1 SV=1 85 158 2.0E-07
sp|O75526|RMXL2_HUMAN RNA-binding motif protein, X-linked-like-2 OS=Homo sapiens GN=RBMXL2 PE=1 SV=3 175 251 2.0E-07
sp|P42696|RBM34_HUMAN RNA-binding protein 34 OS=Homo sapiens GN=RBM34 PE=1 SV=2 81 276 2.0E-07
sp|O93235|CIRBA_XENLA Cold-inducible RNA-binding protein A OS=Xenopus laevis GN=cirbp-a PE=1 SV=2 85 161 3.0E-07
sp|Q8CFD1|RBM45_RAT RNA-binding protein 45 OS=Rattus norvegicus GN=Rbm45 PE=1 SV=1 80 254 3.0E-07
sp|Q06A98|SRSF2_PIG Serine/arginine-rich splicing factor 2 OS=Sus scrofa GN=SRSF2 PE=2 SV=1 175 255 3.0E-07
sp|Q9CAE4|U1131_ARATH U11/U12 small nuclear ribonucleoprotein 31 kDa protein OS=Arabidopsis thaliana GN=SNRNP31 PE=2 SV=1 175 256 3.0E-07
sp|Q6PDU1|SRSF2_RAT Serine/arginine-rich splicing factor 2 OS=Rattus norvegicus GN=Srsf2 PE=1 SV=3 175 255 3.0E-07
sp|Q62093|SRSF2_MOUSE Serine/arginine-rich splicing factor 2 OS=Mus musculus GN=Srsf2 PE=1 SV=4 175 255 3.0E-07
sp|Q01130|SRSF2_HUMAN Serine/arginine-rich splicing factor 2 OS=Homo sapiens GN=SRSF2 PE=1 SV=4 175 255 3.0E-07
sp|Q3MHR5|SRSF2_BOVIN Serine/arginine-rich splicing factor 2 OS=Bos taurus GN=SRSF2 PE=2 SV=3 175 255 3.0E-07
sp|Q9WX39|RBPF_NOSS1 Putative RNA-binding protein RbpF OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpF PE=3 SV=3 175 252 3.0E-07
sp|Q9FZ84|RBG6_ARATH Glycine-rich RNA-binding protein 6, mitochondrial OS=Arabidopsis thaliana GN=RBG6 PE=2 SV=1 175 244 3.0E-07
sp|Q9SHZ5|UBA1B_ARATH UBP1-associated proteins 1B OS=Arabidopsis thaliana GN=UBA1B PE=2 SV=2 170 268 3.0E-07
sp|Q9M1S3|ARP1_ARATH Probable RNA-binding protein ARP1 OS=Arabidopsis thaliana GN=ARP1 PE=2 SV=1 175 261 3.0E-07
sp|P09651|ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens GN=HNRNPA1 PE=1 SV=5 175 362 4.0E-07
sp|P0DJD3|RBY1A_HUMAN RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Homo sapiens GN=RBMY1A1 PE=1 SV=1 175 251 4.0E-07
sp|P0C7P1|RBY1D_HUMAN RNA-binding motif protein, Y chromosome, family 1 member D OS=Homo sapiens GN=RBMY1D PE=2 SV=1 175 251 4.0E-07
sp|A6NEQ0|RBY1E_HUMAN RNA-binding motif protein, Y chromosome, family 1 member E OS=Homo sapiens GN=RBMY1E PE=2 SV=1 175 251 4.0E-07
sp|A6NDE4|RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens GN=RBMY1B PE=2 SV=2 175 251 4.0E-07
sp|Q8NDT2|RB15B_HUMAN Putative RNA-binding protein 15B OS=Homo sapiens GN=RBM15B PE=1 SV=3 78 329 4.0E-07
sp|Q3SZM1|MK67I_BOVIN MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Bos taurus GN=NIFK PE=2 SV=1 175 248 4.0E-07
sp|Q6C747|EIF3G_YARLI Eukaryotic translation initiation factor 3 subunit G OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIF35 PE=3 SV=1 166 252 4.0E-07
sp|Q6Z1C0|NUCL1_ORYSJ Nucleolin 1 OS=Oryza sativa subsp. japonica GN=Os08g0192900 PE=2 SV=1 85 240 4.0E-07
sp|Q9GRX4|NONA_DROLR Protein no-on-transient A OS=Drosophila littoralis GN=nonA PE=2 SV=1 85 231 4.0E-07
sp|Q924M5|BOLL_MOUSE Protein boule-like OS=Mus musculus GN=Boll PE=1 SV=2 174 277 4.0E-07
sp|O35698|RBY1A_MOUSE RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Mus musculus GN=Rbmy1a1 PE=1 SV=2 175 251 4.0E-07
sp|Q8LFS6|BRN1L_ARATH RNA-binding protein BRN1 OS=Arabidopsis thaliana GN=BRN1 PE=2 SV=1 174 256 4.0E-07
sp|P0DJD4|RBY1C_HUMAN RNA-binding motif protein, Y chromosome, family 1 member C OS=Homo sapiens GN=RBMY1C PE=1 SV=1 175 251 5.0E-07
sp|Q6PHZ5|RB15B_MOUSE Putative RNA-binding protein 15B OS=Mus musculus GN=Rbm15b PE=1 SV=2 78 250 5.0E-07
sp|P25299|RNA15_YEAST mRNA 3'-end-processing protein RNA15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNA15 PE=1 SV=1 175 249 5.0E-07
sp|Q4R535|CELF4_MACFA CUGBP Elav-like family member 4 OS=Macaca fascicularis GN=CELF4 PE=2 SV=1 85 277 5.0E-07
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 175 382 6.0E-07
sp|Q8HXM1|CSTF2_BOVIN Cleavage stimulation factor subunit 2 OS=Bos taurus GN=CSTF2 PE=2 SV=1 83 171 6.0E-07
sp|P33240|CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens GN=CSTF2 PE=1 SV=1 83 171 6.0E-07
sp|P39684|PES4_YEAST Protein PES4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PES4 PE=3 SV=2 85 397 6.0E-07
sp|Q9Y580|RBM7_HUMAN RNA-binding protein 7 OS=Homo sapiens GN=RBM7 PE=1 SV=1 76 157 6.0E-07
sp|Q60990|RBY1B_MOUSE RNA-binding motif protein, Y chromosome, family 1 member B OS=Mus musculus GN=Rbmy1b PE=2 SV=3 175 251 6.0E-07
sp|Q60668|HNRPD_MOUSE Heterogeneous nuclear ribonucleoprotein D0 OS=Mus musculus GN=Hnrnpd PE=1 SV=2 76 231 6.0E-07
sp|Q15415|RBY1F_HUMAN RNA-binding motif protein, Y chromosome, family 1 member F/J OS=Homo sapiens GN=RBMY1F PE=1 SV=2 85 158 6.0E-07
sp|O13759|CSX1_SCHPO RNA-binding post-transcriptional regulator csx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csx1 PE=1 SV=1 79 165 7.0E-07
sp|Q8BIQ5|CSTF2_MOUSE Cleavage stimulation factor subunit 2 OS=Mus musculus GN=Cstf2 PE=1 SV=2 83 171 7.0E-07
sp|Q5RDA3|CSTF2_PONAB Cleavage stimulation factor subunit 2 OS=Pongo abelii GN=CSTF2 PE=2 SV=1 83 171 7.0E-07
sp|Q15415|RBY1F_HUMAN RNA-binding motif protein, Y chromosome, family 1 member F/J OS=Homo sapiens GN=RBMY1F PE=1 SV=2 175 251 7.0E-07
sp|Q3MHY8|RBM7_BOVIN RNA-binding protein 7 OS=Bos taurus GN=RBM7 PE=2 SV=1 76 179 7.0E-07
sp|Q640A2|HNRDL_XENTR Heterogeneous nuclear ribonucleoprotein D-like OS=Xenopus tropicalis GN=hnrnpdl PE=2 SV=1 85 233 8.0E-07
sp|Q9SIX3|RBG1_ARATH Probable glycine-rich RNA-binding protein 1 OS=Arabidopsis thaliana GN=RBG1 PE=2 SV=2 171 244 8.0E-07
sp|Q9SX80|R47CP_ARATH Polyadenylate-binding protein RBP47C' OS=Arabidopsis thaliana GN=RBP47C' PE=2 SV=1 70 167 1.0E-06
sp|P16914|ELAV_DROME Protein elav OS=Drosophila melanogaster GN=elav PE=2 SV=1 173 254 1.0E-06
sp|P60825|CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus GN=Cirbp PE=2 SV=1 85 162 1.0E-06
sp|P60824|CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus GN=Cirbp PE=1 SV=1 85 162 1.0E-06
sp|P60826|CIRBP_CRIGR Cold-inducible RNA-binding protein OS=Cricetulus griseus GN=CIRBP PE=2 SV=1 85 162 1.0E-06
sp|O64571|UBA1C_ARATH UBP1-associated proteins 1C OS=Arabidopsis thaliana GN=UBA1C PE=3 SV=2 175 252 1.0E-06
sp|O13845|RSD1_SCHPO RNA-binding protein rsd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsd1 PE=1 SV=2 79 252 1.0E-06
sp|Q14103|HNRPD_HUMAN Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens GN=HNRNPD PE=1 SV=1 85 231 1.0E-06
sp|Q0WW84|RB47B_ARATH Polyadenylate-binding protein RBP47B OS=Arabidopsis thaliana GN=RBP47B PE=2 SV=1 79 162 2.0E-06
sp|P23241|ELAV_DROVI Protein elav OS=Drosophila virilis GN=elav PE=3 SV=1 173 254 2.0E-06
sp|Q00539|NAM8_YEAST Protein NAM8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM8 PE=1 SV=2 79 157 2.0E-06
sp|Q5RF83|CIRBP_PONAB Cold-inducible RNA-binding protein OS=Pongo abelii GN=CIRBP PE=2 SV=1 85 162 2.0E-06
sp|Q14011|CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens GN=CIRBP PE=1 SV=1 85 162 2.0E-06
sp|P07909|ROA1_DROME Heterogeneous nuclear ribonucleoprotein A1 OS=Drosophila melanogaster GN=Hrb98DE PE=2 SV=1 175 377 2.0E-06
sp|Q9PTX2|CIRBP_LITCT Cold-inducible RNA-binding protein OS=Lithobates catesbeiana GN=cirbp PE=2 SV=1 85 162 2.0E-06
sp|Q99729|ROAA_HUMAN Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens GN=HNRNPAB PE=1 SV=2 160 378 2.0E-06
sp|Q9Z130|HNRDL_MOUSE Heterogeneous nuclear ribonucleoprotein D-like OS=Mus musculus GN=Hnrnpdl PE=1 SV=1 85 233 2.0E-06
sp|Q4R813|RMXL2_MACFA RNA-binding motif protein, X-linked-like-2 OS=Macaca fascicularis GN=RBMXL2 PE=2 SV=1 175 251 2.0E-06
sp|Q0U6E7|EIF3G_PHANO Eukaryotic translation initiation factor 3 subunit G OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=TIF35 PE=3 SV=2 166 251 2.0E-06
sp|Q7ZX83|HNDLA_XENLA Heterogeneous nuclear ribonucleoprotein D-like-A OS=Xenopus laevis GN=hnrnpdl-a PE=2 SV=1 85 233 2.0E-06
sp|Q8N7X1|RMXL3_HUMAN RNA-binding motif protein, X-linked-like-3 OS=Homo sapiens GN=RBMXL3 PE=2 SV=2 175 244 2.0E-06
sp|Q9JJ54|HNRPD_RAT Heterogeneous nuclear ribonucleoprotein D0 OS=Rattus norvegicus GN=Hnrnpd PE=1 SV=2 85 231 2.0E-06
sp|Q99069|GRP1_SORBI Glycine-rich RNA-binding protein 1 (Fragment) OS=Sorghum bicolor GN=GRP1 PE=2 SV=1 189 249 2.0E-06
sp|Q5NVC8|CELF4_PONAB CUGBP Elav-like family member 4 OS=Pongo abelii GN=CELF4 PE=2 SV=2 66 180 2.0E-06
sp|Q9BZC1|CELF4_HUMAN CUGBP Elav-like family member 4 OS=Homo sapiens GN=CELF4 PE=1 SV=1 66 180 2.0E-06
sp|Q9GRW7|NONA_DROVI Protein no-on-transient A OS=Drosophila virilis GN=nonA PE=2 SV=1 85 231 2.0E-06
sp|Q7TSY6|CELF4_MOUSE CUGBP Elav-like family member 4 OS=Mus musculus GN=Celf4 PE=1 SV=2 66 180 2.0E-06
sp|P20397|NUCL_XENLA Nucleolin OS=Xenopus laevis GN=ncl PE=2 SV=3 79 249 3.0E-06
sp|Q9NW13|RBM28_HUMAN RNA-binding protein 28 OS=Homo sapiens GN=RBM28 PE=1 SV=3 85 249 3.0E-06
sp|Q44556|RBPD_NOSS1 Putative RNA-binding protein RbpD OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpD PE=3 SV=3 175 252 3.0E-06
sp|O74400|YOCE_SCHPO Uncharacterized RNA-binding protein C4F6.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4F6.14 PE=1 SV=1 85 252 3.0E-06
sp|Q28F51|TADBP_XENTR TAR DNA-binding protein 43 OS=Xenopus tropicalis GN=tardbp PE=2 SV=1 41 280 3.0E-06
sp|Q5M9F1|RBM34_RAT RNA-binding protein 34 OS=Rattus norvegicus GN=Rbm34 PE=1 SV=1 81 246 3.0E-06
sp|Q1PEP5|NUCL2_ARATH Nucleolin 2 OS=Arabidopsis thaliana GN=NUCL2 PE=2 SV=1 83 221 3.0E-06
sp|Q44560|RBPA_NOSS1 Putative RNA-binding protein RbpA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpA PE=3 SV=3 173 250 3.0E-06
sp|Q7TN33|CELF6_MOUSE CUGBP Elav-like family member 6 OS=Mus musculus GN=Celf6 PE=2 SV=1 51 236 4.0E-06
sp|Q9SEE9|SR45_ARATH Serine/arginine-rich splicing factor SR45 OS=Arabidopsis thaliana GN=SR45 PE=1 SV=1 166 248 4.0E-06
sp|Q62176|RBM38_MOUSE RNA-binding protein 38 OS=Mus musculus GN=Rbm38 PE=1 SV=2 165 295 7.0E-06
sp|Q8CGC6|RBM28_MOUSE RNA-binding protein 28 OS=Mus musculus GN=Rbm28 PE=1 SV=4 85 259 8.0E-06
sp|Q5D018|RBM8A_DANRE RNA-binding protein 8A OS=Danio rerio GN=rbm8a PE=2 SV=1 175 255 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|808
MVVADTGVSSHTAQMTVQSQGAFDGGQNGQSGASHMPPPPLHIPQNTNPIPTAITSPMSAGDKLMSPGGSSAFRR
AAPEPNKRALYVGGLDQRVTEDVLRQIFETTGHVQNVKIIPDKNAKGYNYGFVEYDDPGAAERAMQTLNGRRVHQ
SEIRVNWAYQSNAVNKEDTSSHFHIFVGDLSNEVNDEILHQAFSVFGTVSEARVMWDMKTGRTRGYGFVAFRDRS
DAEKALSSMDGEWLGSRAIRCNWANQKGQPSMAQQQAMQAMGLTPTTPFGHHQFPAHGVGSYDIVVSQTPNWQTT
CYVGNLTPYTVASDVVPLFQNFGYVVESRFQADRGFAFIKMDSHENAAMAICQMNGYNVNGRPLKCSWGKDKSPN
QQQSNFDPSQQFSPPGAQTPSGYTGTPTYYPQYGAAQYNNQHGSFGGPQTGSPAGYGGSPMGYGGPQSAGSFGRG
QQAGNAQWNQHQSGQSFNNGFGGYQS*
Coding >OphauB2|808
ATGGTCGTAGCTGATACCGGCGTTTCTTCTCATACGGCCCAAATGACTGTCCAATCTCAAGGCGCCTTCGACGGT
GGCCAGAATGGCCAGTCGGGCGCATCACACATGCCACCGCCTCCACTGCACATACCCCAGAACACGAATCCTATT
CCGACTGCTATTACATCTCCAATGTCGGCTGGGGACAAGCTCATGTCTCCCGGAGGATCATCCGCCTTTCGACGA
GCGGCCCCGGAACCAAACAAGCGAGCTCTCTATGTTGGTGGACTAGACCAGCGAGTCACAGAAGATGTTCTTCGA
CAGATCTTTGAGACTACAGGGCATGTCCAGAACGTCAAAATCATTCCCGACAAGAATGCTAAGGGCTATAATTAT
GGGTTTGTGGAATATGACGACCCAGGCGCCGCTGAGCGGGCAATGCAGACACTCAACGGCCGCAGAGTCCATCAA
TCGGAAATCCGTGTCAATTGGGCCTACCAATCCAATGCTGTCAATAAGGAGGATACCTCGAGCCACTTCCACATC
TTTGTCGGCGATCTCTCCAATGAAGTAAATGATGAGATCCTCCATCAGGCCTTTTCTGTCTTTGGCACCGTCTCA
GAGGCACGCGTCATGTGGGATATGAAGACTGGACGGACTCGCGGCTATGGATTTGTTGCGTTTCGCGACCGATCA
GATGCTGAAAAGGCTCTGAGTTCAATGGATGGTGAATGGCTCGGATCGCGGGCCATTCGCTGCAATTGGGCAAAC
CAAAAGGGGCAGCCGTCCATGGCTCAACAGCAGGCTATGCAGGCCATGGGCCTTACTCCGACAACGCCTTTCGGA
CATCATCAATTCCCAGCGCATGGTGTCGGTAGCTACGACATTGTTGTCAGCCAGACGCCCAACTGGCAGACCACA
TGCTATGTGGGAAATCTCACACCTTATACTGTTGCCAGTGACGTAGTCCCCCTGTTCCAGAATTTTGGCTACGTC
GTCGAGTCTCGCTTCCAGGCAGACAGAGGATTTGCGTTTATCAAGATGGACTCGCACGAGAATGCAGCCATGGCT
ATTTGTCAGATGAATGGCTACAACGTTAATGGTCGTCCGCTCAAGTGCAGTTGGGGCAAGGACAAGTCGCCAAAC
CAGCAGCAAAGCAATTTTGATCCGTCGCAGCAGTTTAGTCCTCCTGGCGCCCAGACTCCGAGCGGGTATACTGGC
ACACCGACTTATTATCCCCAATACGGAGCCGCGCAGTACAACAACCAGCACGGCAGCTTTGGTGGTCCGCAAACT
GGATCGCCGGCAGGTTATGGAGGATCTCCCATGGGCTATGGTGGACCCCAGAGCGCGGGCAGCTTCGGGCGTGGG
CAACAGGCCGGCAACGCTCAATGGAACCAGCATCAGTCTGGACAATCTTTTAACAACGGATTTGGTGGCTACCAG
TCTTGA
Transcript >OphauB2|808
ATGGTCGTAGCTGATACCGGCGTTTCTTCTCATACGGCCCAAATGACTGTCCAATCTCAAGGCGCCTTCGACGGT
GGCCAGAATGGCCAGTCGGGCGCATCACACATGCCACCGCCTCCACTGCACATACCCCAGAACACGAATCCTATT
CCGACTGCTATTACATCTCCAATGTCGGCTGGGGACAAGCTCATGTCTCCCGGAGGATCATCCGCCTTTCGACGA
GCGGCCCCGGAACCAAACAAGCGAGCTCTCTATGTTGGTGGACTAGACCAGCGAGTCACAGAAGATGTTCTTCGA
CAGATCTTTGAGACTACAGGGCATGTCCAGAACGTCAAAATCATTCCCGACAAGAATGCTAAGGGCTATAATTAT
GGGTTTGTGGAATATGACGACCCAGGCGCCGCTGAGCGGGCAATGCAGACACTCAACGGCCGCAGAGTCCATCAA
TCGGAAATCCGTGTCAATTGGGCCTACCAATCCAATGCTGTCAATAAGGAGGATACCTCGAGCCACTTCCACATC
TTTGTCGGCGATCTCTCCAATGAAGTAAATGATGAGATCCTCCATCAGGCCTTTTCTGTCTTTGGCACCGTCTCA
GAGGCACGCGTCATGTGGGATATGAAGACTGGACGGACTCGCGGCTATGGATTTGTTGCGTTTCGCGACCGATCA
GATGCTGAAAAGGCTCTGAGTTCAATGGATGGTGAATGGCTCGGATCGCGGGCCATTCGCTGCAATTGGGCAAAC
CAAAAGGGGCAGCCGTCCATGGCTCAACAGCAGGCTATGCAGGCCATGGGCCTTACTCCGACAACGCCTTTCGGA
CATCATCAATTCCCAGCGCATGGTGTCGGTAGCTACGACATTGTTGTCAGCCAGACGCCCAACTGGCAGACCACA
TGCTATGTGGGAAATCTCACACCTTATACTGTTGCCAGTGACGTAGTCCCCCTGTTCCAGAATTTTGGCTACGTC
GTCGAGTCTCGCTTCCAGGCAGACAGAGGATTTGCGTTTATCAAGATGGACTCGCACGAGAATGCAGCCATGGCT
ATTTGTCAGATGAATGGCTACAACGTTAATGGTCGTCCGCTCAAGTGCAGTTGGGGCAAGGACAAGTCGCCAAAC
CAGCAGCAAAGCAATTTTGATCCGTCGCAGCAGTTTAGTCCTCCTGGCGCCCAGACTCCGAGCGGGTATACTGGC
ACACCGACTTATTATCCCCAATACGGAGCCGCGCAGTACAACAACCAGCACGGCAGCTTTGGTGGTCCGCAAACT
GGATCGCCGGCAGGTTATGGAGGATCTCCCATGGGCTATGGTGGACCCCAGAGCGCGGGCAGCTTCGGGCGTGGG
CAACAGGCCGGCAACGCTCAATGGAACCAGCATCAGTCTGGACAATCTTTTAACAACGGATTTGGTGGCTACCAG
TCTTGA
Gene >OphauB2|808
ATGGTCGTAGCTGATACCGGCGTTTCTTCTCATACGGCCCAAATGACTGTCCAATCTCAAGGCGCCTTCGACGGT
GGCCAGAATGGCCAGTCGGGCGCATCACACATGCCACCGCCTCCACTGCACATACCCCAGAACACGAATCCTATT
CCGACTGCTATTACATCTCCAATGTCGGCTGGGGACAAGCTCATGTCTCCCGGAGGATCATCCGCCTTTCGACGA
GCGGCCCCGGAACCAAACAAGCGAGCTCTCTATGTTGGTGGACTAGACCAGCGAGTCACAGAAGATGTTCTTCGA
CAGATCTTTGAGACTACAGGGCATGTCCAGAACGTCAAAATCATTCCCGACAAGAATGTAAGTCGCCCTTTACGC
ATATATACGCTCGCTCAATCTCTGGTGGATGGCTGATTATTTTTTAAATCCTCGTTATGGCAGGCTAAGGGCTAT
AATTATGGGTTTGTGGAATATGACGACCCAGGCGCCGCTGAGCGGGCAATGCAGACACTCAACGGCCGCAGAGTC
CATCAATCGGTACATATTGTCCTGGCACTGGCTGACGCAGAATACGCGTAGGCATGCTTACAAGTCTTAGGAAAT
CCGTGTCAATTGGGCCTACCAATCCAATGCTGTCAATAAGGAGGATACCTCGAGCCACTTCCACATCTTTGTCGG
CGATCTCTCCAATGAAGTAAATGATGAGATCCTCCATCAGGCCTTTTCTGTCTTTGGCACCGTCTCAGAGGCACG
CGTCATGTGGGATATGAAGACTGGACGGACTCGCGGCTATGGATTTGTTGCGTTTCGCGACCGATCAGATGCTGA
AAAGGCTCTGAGTTCAATGGATGGTGAATGGCTCGGATCGCGGGCCATTCGCTGCAATTGGGCAAACCAAAAGGG
GCAGCCGTCCATGGCTCAACAGCAGGCTATGCAGGCCATGGGCCTTACTCCGACAACGCCTTTCGGACATCATCA
ATTCCCAGCGCATGGTGTCGGTAGCTACGACATTGTTGTCAGCCAGACGCCCAACTGGCAGACCACATGCTATGT
GGGAAATCTCACACCTTATACTGTTGCCAGTGACGTAGTCCCCCTGTTCCAGAATTTTGGCTACGTCGTCGAGTC
TCGCTTCCAGGCAGACAGAGGATTTGCGTTTATCAAGATGGACTCGCACGAGAATGCAGCCATGGCTATTTGTCA
GATGAATGGCTACAACGTTAATGGTCGTCCGCTCAAGTGCAGTGTAAGTTGCTAGCTAGCCTTGGCTCTCTATCA
GTGTCTCTTTGGCTATCACCTACTAATGACAATTTGTTCGTTTAGTGGGGCAAGGACAAGTCGCCAAACCAGCAG
CAAAGCAATTTTGATCCGTCGCAGCAGTTTAGTCCTCCTGGCGCCCAGACTCCGAGCGGGTATACTGGCACACCG
ACTTATTATCCCCAATACGGAGGTACGTGGGCTGTATTACCTCGAAGTGATGCATCACTTGGTCTGACTAGCGTC
GTTTAGCCGCGCAGTACAACAACCAGCACGGCAGCTTTGGTGGTCCGCAAACTGGATCGCCGGCAGGTTATGGAG
GATCTCCCATGGGCTATGGTGGACCCCAGAGCGCGGGCAGCTTCGGGCGTGGGCAACAGGCCGGCAACGCTCAAT
GGAACCAGCATCAGTCTGGACAATCTTTTAACAACGGATTTGGTGGCTACCAGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail