Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8076
Gene name
LocationContig_96:31328..34394
Strand+
Gene length (bp)3066
Transcript length (bp)2880
Coding sequence length (bp)2880
Protein length (aa) 960

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01602 Adaptin_N Adaptin N terminal region 6.0E-94 24 492
PF07718 Coatamer_beta_C Coatomer beta C-terminal region 6.6E-61 681 817
PF14806 Coatomer_b_Cpla Coatomer beta subunit appendage platform 3.7E-55 822 948
PF12717 Cnd1 non-SMC mitotic condensation complex subunit 1 2.5E-10 116 205

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P45437|COPB_DROME Coatomer subunit beta OS=Drosophila melanogaster GN=betaCOP PE=2 SV=2 16 958 0.0E+00
sp|Q9UUF7|COPB_SCHPO Coatomer subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec26 PE=3 SV=1 7 949 0.0E+00
sp|Q23924|COPB_DICDI Coatomer subunit beta OS=Dictyostelium discoideum GN=copb PE=2 SV=2 2 951 0.0E+00
sp|Q0JNK5|COPB2_ORYSJ Coatomer subunit beta-2 OS=Oryza sativa subsp. japonica GN=Os01g0281400 PE=3 SV=1 11 958 0.0E+00
sp|Q53PC7|COPB1_ORYSJ Coatomer subunit beta-1 OS=Oryza sativa subsp. japonica GN=Os11g0174000 PE=2 SV=1 11 959 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P45437|COPB_DROME Coatomer subunit beta OS=Drosophila melanogaster GN=betaCOP PE=2 SV=2 16 958 0.0E+00
sp|Q9UUF7|COPB_SCHPO Coatomer subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec26 PE=3 SV=1 7 949 0.0E+00
sp|Q23924|COPB_DICDI Coatomer subunit beta OS=Dictyostelium discoideum GN=copb PE=2 SV=2 2 951 0.0E+00
sp|Q0JNK5|COPB2_ORYSJ Coatomer subunit beta-2 OS=Oryza sativa subsp. japonica GN=Os01g0281400 PE=3 SV=1 11 958 0.0E+00
sp|Q53PC7|COPB1_ORYSJ Coatomer subunit beta-1 OS=Oryza sativa subsp. japonica GN=Os11g0174000 PE=2 SV=1 11 959 0.0E+00
sp|Q9SV21|COPB1_ARATH Coatomer subunit beta-1 OS=Arabidopsis thaliana GN=At4g31480 PE=2 SV=2 11 958 0.0E+00
sp|Q9SV20|COPB2_ARATH Coatomer subunit beta-2 OS=Arabidopsis thaliana GN=At4g31490 PE=2 SV=2 11 958 0.0E+00
sp|Q29G21|COPB_DROPS Coatomer subunit beta OS=Drosophila pseudoobscura pseudoobscura GN=betaCOP PE=3 SV=2 19 958 0.0E+00
sp|Q5ZIA5|COPB_CHICK Coatomer subunit beta OS=Gallus gallus GN=COPB1 PE=2 SV=1 8 958 0.0E+00
sp|Q5R922|COPB_PONAB Coatomer subunit beta OS=Pongo abelii GN=COPB1 PE=2 SV=1 8 958 0.0E+00
sp|P53618|COPB_HUMAN Coatomer subunit beta OS=Homo sapiens GN=COPB1 PE=1 SV=3 8 958 0.0E+00
sp|D2SW95|COPB_PIG Coatomer subunit beta OS=Sus scrofa GN=COPB1 PE=2 SV=1 8 958 0.0E+00
sp|Q9JIF7|COPB_MOUSE Coatomer subunit beta OS=Mus musculus GN=Copb1 PE=1 SV=1 8 958 0.0E+00
sp|P23514|COPB_RAT Coatomer subunit beta OS=Rattus norvegicus GN=Copb1 PE=1 SV=1 8 958 0.0E+00
sp|A0JN39|COPB_BOVIN Coatomer subunit beta OS=Bos taurus GN=COPB1 PE=1 SV=1 8 947 0.0E+00
sp|Q66HV4|COPB_DANRE Coatomer subunit beta OS=Danio rerio GN=copb1 PE=2 SV=1 8 947 0.0E+00
sp|Q6FM46|COPB_CANGA Coatomer subunit beta OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC26 PE=3 SV=1 8 947 0.0E+00
sp|P41810|COPB_YEAST Coatomer subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC26 PE=1 SV=2 8 947 0.0E+00
sp|Q9U4N3|COPB_TOXGO Coatomer subunit beta OS=Toxoplasma gondii PE=2 SV=2 5 947 2.0E-163
sp|Q9NFU6|COPB_TRYBB Coatomer subunit beta OS=Trypanosoma brucei brucei PE=3 SV=1 25 947 3.0E-156
sp|Q54X82|AP1B_DICDI AP-1 complex subunit beta OS=Dictyostelium discoideum GN=ap1b1 PE=3 SV=1 23 463 1.0E-21
sp|P63009|AP2B1_BOVIN AP-2 complex subunit beta OS=Bos taurus GN=AP2B1 PE=1 SV=2 23 463 3.0E-16
sp|Q08DS7|AP1B1_BOVIN AP-1 complex subunit beta-1 OS=Bos taurus GN=AP2B1 PE=2 SV=1 23 463 3.0E-16
sp|Q9DBG3|AP2B1_MOUSE AP-2 complex subunit beta OS=Mus musculus GN=Ap2b1 PE=1 SV=1 23 463 7.0E-16
sp|P62944|AP2B1_RAT AP-2 complex subunit beta OS=Rattus norvegicus GN=Ap2b1 PE=1 SV=1 23 463 7.0E-16
sp|P63010|AP2B1_HUMAN AP-2 complex subunit beta OS=Homo sapiens GN=AP2B1 PE=1 SV=1 23 463 7.0E-16
sp|Q10567|AP1B1_HUMAN AP-1 complex subunit beta-1 OS=Homo sapiens GN=AP1B1 PE=1 SV=2 74 463 5.0E-13
sp|O35643|AP1B1_MOUSE AP-1 complex subunit beta-1 OS=Mus musculus GN=Ap1b1 PE=1 SV=2 74 463 7.0E-13
sp|P52303|AP1B1_RAT AP-1 complex subunit beta-1 OS=Rattus norvegicus GN=Ap1b1 PE=1 SV=1 74 463 1.0E-12
sp|Q9LDK9|APBLA_ARATH Beta-adaptin-like protein A OS=Arabidopsis thaliana GN=BETAA-AD PE=1 SV=1 23 468 6.0E-10
sp|Q32PG1|AP3B1_BOVIN AP-3 complex subunit beta-1 OS=Bos taurus GN=AP3B1 PE=2 SV=1 17 177 2.0E-08
sp|Q7YRF1|AP3B1_CANLF AP-3 complex subunit beta-1 OS=Canis lupus familiaris GN=AP3B1 PE=2 SV=1 17 177 3.0E-08
sp|O00203|AP3B1_HUMAN AP-3 complex subunit beta-1 OS=Homo sapiens GN=AP3B1 PE=1 SV=3 17 177 4.0E-08
sp|Q9Z1T1|AP3B1_MOUSE AP-3 complex subunit beta-1 OS=Mus musculus GN=Ap3b1 PE=1 SV=2 25 177 5.0E-08
sp|Q9SUS3|APBLB_ARATH Beta-adaptin-like protein B OS=Arabidopsis thaliana GN=BETAB-AD PE=1 SV=1 332 463 2.0E-07
sp|O81742|APBLC_ARATH Beta-adaptin-like protein C OS=Arabidopsis thaliana GN=BETAC-AD PE=1 SV=2 332 463 2.0E-07
sp|Q755A1|AP3D_ASHGO AP-3 complex subunit delta OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=APL5 PE=3 SV=1 98 468 3.0E-07
sp|Q99128|AP1G1_USTMA AP-1 complex subunit gamma-1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=APL4 PE=3 SV=3 98 463 4.0E-07
sp|O14617|AP3D1_HUMAN AP-3 complex subunit delta-1 OS=Homo sapiens GN=AP3D1 PE=1 SV=1 98 463 2.0E-06
sp|Q865S1|AP3D1_BOVIN AP-3 complex subunit delta-1 OS=Bos taurus GN=AP3D1 PE=1 SV=2 98 463 2.0E-06
sp|O54774|AP3D1_MOUSE AP-3 complex subunit delta-1 OS=Mus musculus GN=Ap3d1 PE=1 SV=1 98 463 3.0E-06
sp|Q13367|AP3B2_HUMAN AP-3 complex subunit beta-2 OS=Homo sapiens GN=AP3B2 PE=1 SV=2 25 163 4.0E-06
sp|Q9JME5|AP3B2_MOUSE AP-3 complex subunit beta-2 OS=Mus musculus GN=Ap3b2 PE=1 SV=2 25 163 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0030126 COPI vesicle coat Yes
GO:0030117 membrane coat Yes
GO:0005198 structural molecule activity Yes
GO:0016192 vesicle-mediated transport Yes
GO:0051641 cellular localization No
GO:0046907 intracellular transport No
GO:0070727 cellular macromolecule localization No
GO:0005575 cellular_component No
GO:0045184 establishment of protein localization No
GO:0051649 establishment of localization in cell No
GO:0008150 biological_process No
GO:0071702 organic substance transport No
GO:0003674 molecular_function No
GO:0015031 protein transport No
GO:0033036 macromolecule localization No
GO:0030120 vesicle coat No
GO:0051179 localization No
GO:0006810 transport No
GO:0071705 nitrogen compound transport No
GO:0009987 cellular process No
GO:0032991 protein-containing complex No
GO:0098796 membrane protein complex No
GO:0051234 establishment of localization No
GO:0008104 protein localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8076
MSGFLENAYSLVHQDNAADVPSVSDLRMQLEKGTDETKIETMKRILTIMLNGDPMPSLLMHIIRFVMPSKHKPLK
KLLYFYYEICPKLDSTGKLKQEMILVCNGIRNDLQHANEYIRGNTLRFLCKLREPELIEPLLSSARNCLQHRHAY
VRKNAVFAVSSIYLHSPSLIPDASELISAFLSGETDATCKRNAFAALASINHEAALVYLSSVFDGIPNAEELLQL
VELEFIRKDAIQNSPNKARYLRLIFDLLDAGASTVVYEAASSLTALTNNPVAVKAAAAKFIELSIKESDNNVKLI
VLDRVDQLRKKNEGVLDDLVMEILRVLSSTDIDVRSKALKIALEMVSSKNVEEVVLVLKKELSKTLDQEYEKNAE
YRSLLIHSIHQCAIKFSEVAASVVELLMDFIADSNNASAVDVISFVKEVVEKFPALRKTIVERLVSSLAEVRAGK
VCRGIMWIIGEYSLDERDIRDAWKRIRASLGEIPILASEQRLLEEQNSGEPKQDEDKPNGNSKPSEPKGSRKVLA
DGTYATETALTSQSSAAAKLEAVKAAQKPPLRQLILDGDYYLATVLSSTLVKLVMRHSEISADKERTNALRAEAM
LIMISILRVGQSQFTKAAIDEDSVDRIMSCVRSLADLKRNKELEKVWLDDTRKAFRAMVLVEERKRAAKEASEKA
KTAVQVDDVVQIRQLSKKNATEGLDEMEMDLERATGGESTTEDLSSKLSRVVQLTGFSDPVYAEAYVKVHQFDIV
LDVLLVNQTTETLQNLSVEFATLGDLKVVERPTTQNLGPHDFHNVQCTIKVSSTDTGVIFGNVVYDGAHSTDTNV
VILNDLHVDIMDYIQPATCTETQFRTMWTEFEWENKVNLESKAKSLRDFLDQLMACTNMNCLTPEASLKGDCQFL
SANLYARSVFGEDALANLSIEKKGEDGPITGFVRIRSRSQGLALSLGSLKGLNKIGSSA*
Coding >OphauB2|8076
ATGTCTGGCTTCCTTGAGAATGCCTACAGCCTGGTCCACCAGGACAATGCGGCCGATGTGCCCAGCGTCTCGGAC
TTGCGCATGCAGCTTGAAAAGGGCACTGACGAGACCAAGATTGAGACGATGAAGCGCATCTTGACTATTATGCTC
AATGGCGACCCAATGCCTTCCTTGCTCATGCATATAATTCGATTTGTCATGCCCTCGAAGCATAAGCCACTCAAA
AAACTGCTCTACTTTTACTACGAAATATGCCCAAAGCTTGATTCAACAGGCAAGCTTAAACAGGAGATGATTTTG
GTTTGCAATGGCATCCGCAACGATCTCCAACACGCCAACGAATATATCCGCGGCAACACACTGCGATTTCTCTGC
AAATTGCGCGAGCCAGAGCTCATAGAACCCCTTCTTTCCTCAGCCCGGAATTGCCTCCAACATCGTCATGCATAC
GTCCGCAAAAATGCCGTCTTTGCTGTTTCTTCCATTTACCTTCATTCTCCTTCACTCATTCCCGATGCTTCAGAG
CTCATCTCTGCCTTTCTCTCTGGGGAGACGGATGCGACGTGCAAGAGAAATGCTTTCGCAGCACTGGCAAGCATC
AATCATGAGGCTGCCCTTGTGTATCTCAGCTCCGTCTTTGATGGTATCCCAAACGCAGAGGAGTTGCTTCAGCTG
GTCGAGCTCGAGTTTATTCGCAAAGATGCCATCCAAAATTCACCCAACAAGGCCCGCTACTTGCGGTTGATTTTT
GACCTGCTCGATGCTGGTGCCTCGACGGTGGTATACGAGGCTGCTTCATCCCTCACAGCTCTGACCAACAACCCT
GTTGCCGTCAAGGCAGCCGCCGCCAAATTCATCGAGCTTAGCATCAAGGAATCGGACAATAACGTCAAACTCATC
GTTCTTGATCGCGTCGACCAGCTGCGCAAGAAGAATGAAGGGGTTCTCGACGATTTAGTCATGGAGATTCTGCGC
GTTCTATCAAGCACTGACATTGATGTGCGCAGCAAGGCCCTCAAGATTGCCCTGGAAATGGTCTCGAGCAAAAAT
GTTGAAGAAGTCGTCCTAGTCCTCAAGAAGGAACTTTCCAAAACACTGGACCAAGAGTACGAAAAGAATGCGGAG
TATCGTTCGCTCCTAATCCACTCTATCCACCAATGCGCCATCAAGTTCTCCGAGGTTGCTGCAAGCGTTGTCGAG
CTGCTCATGGACTTCATCGCCGACTCGAACAATGCATCTGCCGTCGATGTCATCAGCTTCGTCAAAGAAGTTGTA
GAAAAGTTTCCCGCTCTTCGCAAGACTATTGTTGAGCGCCTAGTGTCTTCACTAGCCGAGGTTCGCGCAGGTAAG
GTCTGCCGAGGCATCATGTGGATTATTGGCGAGTATTCCTTGGATGAGAGAGATATTCGTGATGCCTGGAAGAGG
ATACGGGCCAGTCTGGGGGAAATCCCCATACTCGCCTCGGAACAGCGTTTGCTGGAGGAGCAAAACTCGGGCGAG
CCCAAACAGGATGAAGACAAGCCCAATGGCAACTCGAAGCCGTCAGAACCAAAGGGCTCTCGCAAAGTACTTGCA
GACGGCACATATGCGACAGAGACGGCTCTCACCAGTCAGTCGTCGGCCGCTGCTAAGCTCGAGGCAGTCAAGGCT
GCACAGAAACCGCCACTGCGCCAGTTGATACTTGACGGAGATTACTACTTGGCCACGGTTCTTTCATCGACACTT
GTCAAGTTGGTAATGCGGCACTCGGAAATCTCGGCCGATAAGGAACGCACCAACGCGCTGAGGGCAGAGGCCATG
TTAATAATGATTTCTATCCTCCGTGTCGGCCAATCGCAGTTCACCAAGGCAGCCATTGACGAAGACTCTGTTGAC
CGCATCATGTCGTGCGTGCGATCACTGGCCGATTTGAAGCGAAACAAGGAGCTGGAAAAGGTGTGGCTGGACGAT
ACGAGGAAGGCGTTCCGTGCGATGGTGCTGGTGGAGGAGCGAAAGCGGGCTGCCAAGGAAGCGTCTGAAAAGGCC
AAGACGGCGGTCCAGGTGGACGACGTGGTCCAGATTCGGCAGCTTTCCAAGAAGAATGCAACCGAGGGACTCGAT
GAGATGGAGATGGATCTCGAGAGGGCAACGGGCGGCGAGTCGACGACGGAGGACCTGTCGTCCAAGCTCAGCCGC
GTGGTACAGCTGACGGGCTTCTCGGATCCAGTATACGCCGAGGCCTATGTCAAGGTGCATCAGTTTGACATTGTG
CTTGATGTGCTGCTAGTCAACCAAACAACAGAGACGCTGCAGAACTTGTCGGTCGAATTCGCAACGCTCGGAGAT
CTCAAGGTGGTGGAGCGGCCGACGACGCAAAATCTGGGCCCCCACGACTTTCACAACGTGCAGTGCACCATCAAA
GTGTCGTCGACAGACACGGGGGTCATCTTTGGCAACGTTGTGTACGACGGCGCACACTCAACCGACACCAATGTG
GTGATTCTCAACGACTTGCACGTGGACATTATGGACTATATCCAGCCGGCAACATGCACAGAGACGCAGTTTCGC
ACCATGTGGACCGAGTTTGAATGGGAGAATAAAGTCAACTTGGAGTCAAAGGCAAAGTCGCTGCGAGACTTTTTG
GATCAACTCATGGCGTGCACCAACATGAATTGTCTGACGCCAGAGGCTAGCCTCAAGGGCGACTGCCAATTCCTA
AGTGCCAATCTTTATGCCCGCAGCGTGTTTGGCGAGGATGCGCTGGCCAACCTGAGCATCGAAAAGAAGGGGGAG
GACGGGCCAATTACAGGTTTTGTACGCATCAGGAGCAGATCACAGGGCCTAGCCCTCAGCTTGGGATCGCTCAAG
GGGCTCAACAAGATTGGCTCTTCTGCCTAG
Transcript >OphauB2|8076
ATGTCTGGCTTCCTTGAGAATGCCTACAGCCTGGTCCACCAGGACAATGCGGCCGATGTGCCCAGCGTCTCGGAC
TTGCGCATGCAGCTTGAAAAGGGCACTGACGAGACCAAGATTGAGACGATGAAGCGCATCTTGACTATTATGCTC
AATGGCGACCCAATGCCTTCCTTGCTCATGCATATAATTCGATTTGTCATGCCCTCGAAGCATAAGCCACTCAAA
AAACTGCTCTACTTTTACTACGAAATATGCCCAAAGCTTGATTCAACAGGCAAGCTTAAACAGGAGATGATTTTG
GTTTGCAATGGCATCCGCAACGATCTCCAACACGCCAACGAATATATCCGCGGCAACACACTGCGATTTCTCTGC
AAATTGCGCGAGCCAGAGCTCATAGAACCCCTTCTTTCCTCAGCCCGGAATTGCCTCCAACATCGTCATGCATAC
GTCCGCAAAAATGCCGTCTTTGCTGTTTCTTCCATTTACCTTCATTCTCCTTCACTCATTCCCGATGCTTCAGAG
CTCATCTCTGCCTTTCTCTCTGGGGAGACGGATGCGACGTGCAAGAGAAATGCTTTCGCAGCACTGGCAAGCATC
AATCATGAGGCTGCCCTTGTGTATCTCAGCTCCGTCTTTGATGGTATCCCAAACGCAGAGGAGTTGCTTCAGCTG
GTCGAGCTCGAGTTTATTCGCAAAGATGCCATCCAAAATTCACCCAACAAGGCCCGCTACTTGCGGTTGATTTTT
GACCTGCTCGATGCTGGTGCCTCGACGGTGGTATACGAGGCTGCTTCATCCCTCACAGCTCTGACCAACAACCCT
GTTGCCGTCAAGGCAGCCGCCGCCAAATTCATCGAGCTTAGCATCAAGGAATCGGACAATAACGTCAAACTCATC
GTTCTTGATCGCGTCGACCAGCTGCGCAAGAAGAATGAAGGGGTTCTCGACGATTTAGTCATGGAGATTCTGCGC
GTTCTATCAAGCACTGACATTGATGTGCGCAGCAAGGCCCTCAAGATTGCCCTGGAAATGGTCTCGAGCAAAAAT
GTTGAAGAAGTCGTCCTAGTCCTCAAGAAGGAACTTTCCAAAACACTGGACCAAGAGTACGAAAAGAATGCGGAG
TATCGTTCGCTCCTAATCCACTCTATCCACCAATGCGCCATCAAGTTCTCCGAGGTTGCTGCAAGCGTTGTCGAG
CTGCTCATGGACTTCATCGCCGACTCGAACAATGCATCTGCCGTCGATGTCATCAGCTTCGTCAAAGAAGTTGTA
GAAAAGTTTCCCGCTCTTCGCAAGACTATTGTTGAGCGCCTAGTGTCTTCACTAGCCGAGGTTCGCGCAGGTAAG
GTCTGCCGAGGCATCATGTGGATTATTGGCGAGTATTCCTTGGATGAGAGAGATATTCGTGATGCCTGGAAGAGG
ATACGGGCCAGTCTGGGGGAAATCCCCATACTCGCCTCGGAACAGCGTTTGCTGGAGGAGCAAAACTCGGGCGAG
CCCAAACAGGATGAAGACAAGCCCAATGGCAACTCGAAGCCGTCAGAACCAAAGGGCTCTCGCAAAGTACTTGCA
GACGGCACATATGCGACAGAGACGGCTCTCACCAGTCAGTCGTCGGCCGCTGCTAAGCTCGAGGCAGTCAAGGCT
GCACAGAAACCGCCACTGCGCCAGTTGATACTTGACGGAGATTACTACTTGGCCACGGTTCTTTCATCGACACTT
GTCAAGTTGGTAATGCGGCACTCGGAAATCTCGGCCGATAAGGAACGCACCAACGCGCTGAGGGCAGAGGCCATG
TTAATAATGATTTCTATCCTCCGTGTCGGCCAATCGCAGTTCACCAAGGCAGCCATTGACGAAGACTCTGTTGAC
CGCATCATGTCGTGCGTGCGATCACTGGCCGATTTGAAGCGAAACAAGGAGCTGGAAAAGGTGTGGCTGGACGAT
ACGAGGAAGGCGTTCCGTGCGATGGTGCTGGTGGAGGAGCGAAAGCGGGCTGCCAAGGAAGCGTCTGAAAAGGCC
AAGACGGCGGTCCAGGTGGACGACGTGGTCCAGATTCGGCAGCTTTCCAAGAAGAATGCAACCGAGGGACTCGAT
GAGATGGAGATGGATCTCGAGAGGGCAACGGGCGGCGAGTCGACGACGGAGGACCTGTCGTCCAAGCTCAGCCGC
GTGGTACAGCTGACGGGCTTCTCGGATCCAGTATACGCCGAGGCCTATGTCAAGGTGCATCAGTTTGACATTGTG
CTTGATGTGCTGCTAGTCAACCAAACAACAGAGACGCTGCAGAACTTGTCGGTCGAATTCGCAACGCTCGGAGAT
CTCAAGGTGGTGGAGCGGCCGACGACGCAAAATCTGGGCCCCCACGACTTTCACAACGTGCAGTGCACCATCAAA
GTGTCGTCGACAGACACGGGGGTCATCTTTGGCAACGTTGTGTACGACGGCGCACACTCAACCGACACCAATGTG
GTGATTCTCAACGACTTGCACGTGGACATTATGGACTATATCCAGCCGGCAACATGCACAGAGACGCAGTTTCGC
ACCATGTGGACCGAGTTTGAATGGGAGAATAAAGTCAACTTGGAGTCAAAGGCAAAGTCGCTGCGAGACTTTTTG
GATCAACTCATGGCGTGCACCAACATGAATTGTCTGACGCCAGAGGCTAGCCTCAAGGGCGACTGCCAATTCCTA
AGTGCCAATCTTTATGCCCGCAGCGTGTTTGGCGAGGATGCGCTGGCCAACCTGAGCATCGAAAAGAAGGGGGAG
GACGGGCCAATTACAGGTTTTGTACGCATCAGGAGCAGATCACAGGGCCTAGCCCTCAGCTTGGGATCGCTCAAG
GGGCTCAACAAGATTGGCTCTTCTGCCTAG
Gene >OphauB2|8076
ATGTCTGGCTTCCTTGAGAATGCCTACAGCCTGGTCCACCAGGACAATGCGGCCGATGTGCCCAGCGTCTCGGAC
TTGCGCATGCAGCTTGAAAAGGGCACTGACGAGACCAAGATTGAGACGATGAAGCGCATCTTGACTATTATGCTC
AATGGCGACCCAATGCCTTCCTTGCTCATGCATATAATTCGATTTGTCATGCCCTCGAAGCATAAGCCACTCAAA
AAACTGCTCTACTTTTACTACGAAATATGCCCAAAGCTTGATTCAACAGGCAAGCTTAAACAGGAGATGATTTTG
GTTTGGTACGCTCTTGTCTTGTACAGTTTTGTATAATTTTGGCGGCGTCGCTGACCACCACTCCTCCTCTAGCAA
TGGCATCCGCAACGATCTCCAACACGCCAACGAATATATCCGCGGCAACACACTGCGATTTCTCTGCAAATTGCG
CGAGCCAGAGCTCATAGAACCCCTTCTTTCCTCAGCCCGGAATTGCCTCCAACATCGTCATGCATACGTCCGCAA
AAATGCCGTCTTTGCTGTTTCTTCCATTTACCTTCATTCTCCTTCACTCATTCCCGATGCTTCAGAGCTCATCTC
TGCCTTTCTCTCTGGGGAGACGGATGCGACGTGCAAGAGAAATGCTTTCGCAGCACTGGCAAGCATCAATCATGA
GGCTGCCCTTGTGTATCTCAGCTCCGTCTTTGATGGTATCCCAAACGCAGAGGAGTTGCTTCAGCTGGTCGAGCT
CGAGTTTATTCGCAAAGATGCCATCCAAAATTCACCCAACAAGGTGCCTAACATTCTGGTACATTCAATGACATG
GACTCATGACTGACTATTATAGGCCCGCTACTTGCGGTTGATTTTTGACCTGCTCGATGCTGGTGCCTCGACGGT
GGTATACGAGGCTGCTTCATCCCTCACAGCTCTGACCAACAACCCTGTTGCCGTCAAGGCAGCCGCCGCCAAATT
CATCGAGCTTAGCATCAAGGAATCGGACAATAACGTCAAACTCATCGTTCTTGATCGCGTCGACCAGCTGCGCAA
GAAGAATGAAGGGGTTCTCGACGATTTAGTCATGGAGATTCTGCGCGTTCTATCAAGCACTGACATTGATGTGCG
CAGCAAGGCCCTCAAGATTGCCCTGGAAATGGTCTCGAGCAAAAATGTTGAAGAAGTCGTCCTAGTCCTCAAGAA
GGAACTTTCCAAAACACTGGACCAAGAGTACGAAAAGAATGCGGAGTATCGTTCGCTCCTAATCCACTCTATCCA
CCAATGCGCCATCAAGTTCTCCGAGGTTGCTGCAAGCGTTGTCGAGCTGCTCATGGACTTCATCGCCGACTCGAA
CAATGCATCTGCCGTCGATGTCATCAGCTTCGTCAAAGAAGTTGTAGAAAAGTTTCCCGCTCTTCGCAAGACTAT
TGTTGAGCGCCTAGTGTCTTCACTAGCCGAGGTTCGCGCAGGTAAGGTCTGCCGAGGCATCATGTGGATTATTGG
CGAGTATTCCTTGGATGAGAGAGATATTCGTGATGCCTGGAAGAGGATACGGGCCAGTCTGGGGGAAATCCCCAT
ACTCGCCTCGGAACAGCGTTTGCTGGAGGAGCAAAACTCGGGCGAGCCCAAACAGGATGAAGACAAGCCCAATGG
CAACTCGAAGCCGTCAGAACCAAAGGGCTCTCGCAAAGTACTTGCAGACGGCACATATGCGACAGAGACGGCTCT
CACCAGTCAGTCGTCGGCCGCTGCTAAGCTCGAGGCAGTCAAGGCTGCACAGAAACCGCCACTGCGCCAGTTGAT
ACTTGACGGAGATTACTACTTGGCCACGGTTCTTTCATCGACACTTGTCAAGTTGGTAATGCGGCACTCGGAAAT
CTCGGCCGATAAGGAACGCACCAACGCGCTGAGGGCAGAGGCCATGTTAATAATGATTTCTATCCTCCGTGTCGG
CCAATCGCAGTTCACCAAGGCAGCCATTGACGAAGACTCTGTTGACCGCATCATGTCGTGCGTGCGATCACTGGC
CGATTTGAAGCGAAACAAGGAGCTGGAAAAGGTGTGGCTGGACGATACGAGGAAGGCGTTCCGTGCGATGGTGCT
GGTGGAGGAGCGAAAGCGGGCTGCCAAGGAAGCGTCTGAAAAGGCCAAGACGGCGGTCCAGGTGGACGACGTGGT
CCAGATTCGGCAGCTTTCCAAGAAGAATGCAACCGAGGGACTCGATGAGATGGAGATGGATCTCGAGAGGGCAAC
GGGCGGCGAGTCGACGACGGAGGACCTGTCGTCCAAGCTCAGCCGCGTGGTACAGCTGACGGGCTTCTCGGATCC
AGTATACGCCGAGGCCTATGTCAAGGTGCATCAGTTTGACATTGTGCTTGATGTGCTGCTAGTCAACCAAACAAC
AGAGACGCTGCAGAACTTGTCGGTCGAATTCGCAACGCTCGGAGATCTCAAGGTGGTGGAGCGGCCGACGACGCA
AAATCTGGGCCCCCACGACTTTCACAACGTGCAGTGCACCATCAAAGTGTCGTCGACAGACACGGGGGTCATCTT
TGGCAACGTTGTGTACGACGGCGCACACTCAACCGACACCAATGTGGTGATTCTCAACGACTTGCACGTGGACAT
TATGGACTATATCCAGCCGGCAACATGCACAGAGACGCAGTTTCGCACCATGTGGACCGAGTTTGAATGGGAGAA
TAAAGTCAACTTGGAGTCAAAGGCAAAGTCGCTGCGAGACTTTTTGGATCAACTCATGGCGTGCACCAACATGAA
TTGTCTGACGCCAGAGGCTAGCCTCAAGGGCGACTGCCAATTCCTAAGTGCCAATCTTTATGCCCGCAGCGTGTT
TGGTAAGTGGATGCTTCTGCTTTTGGCTTTGACGGTACTGGTAGGGCTAACTTGTGTGTGCTCACAGGCGAGGAT
GCGCTGGCCAACCTGAGCATCGAAAAGAAGGGGGAGGACGGGCCAATTACAGGTTTTGTACGCATCAGGAGCAGA
TCACAGGGCCTAGCCCTCAGCTTGGGATCGCTCAAGGGGCTCAACAAGATTGGCTCTTCTGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail