Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8068
Gene name
LocationContig_96:17986..18796
Strand+
Gene length (bp)810
Transcript length (bp)627
Coding sequence length (bp)627
Protein length (aa) 209

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q58838|Y1443_METJA UPF0132 membrane protein MJ1443 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1443 PE=3 SV=1 100 203 2.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

Domain # Start End Length
1 107 129 22
2 138 157 19
3 161 183 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8068
MDFAPYQSSPPEHSRVSSPENASSSLSPRTSAAWARSPPPLQHPQPQRAWPAAGGLDGHDSGAGWTDGSGAAAAA
SGHGSSPFASLAPAGAAETHMSGFDTSLGLRLDYEACLAYLALPPLGAIILLILERNSDYVRFHAWQSALLFTAL
MILHLIFSWSSFFNWCFFIGDIVLMAFLTMRAYKDAEVLDRFEVPFFGRVASHILDDE*
Coding >OphauB2|8068
ATGGACTTTGCTCCATATCAATCCTCCCCGCCCGAGCACTCGCGCGTCTCGTCGCCCGAAAACGCCTCGTCGTCG
CTCTCCCCTCGTACCTCGGCTGCCTGGGCACGCAGCCCCCCTCCGCTCCAGCACCCCCAGCCCCAGCGCGCCTGG
CCCGCAGCCGGCGGTCTTGACGGCCACGACTCGGGCGCTGGCTGGACAGATGGCTCGGGAGCCGCCGCCGCTGCG
TCGGGCCATGGCTCGTCGCCCTTTGCATCATTGGCGCCCGCCGGGGCTGCTGAGACGCACATGAGCGGGTTTGAC
ACGAGCCTCGGGCTGCGTCTCGACTATGAGGCTTGTCTCGCCTATCTCGCCCTGCCGCCCCTGGGTGCCATTATT
CTCCTGATTCTAGAACGCAATAGCGACTATGTTAGATTCCATGCCTGGCAGTCCGCACTGCTCTTTACCGCTCTC
ATGATTCTCCATTTAATCTTTTCCTGGTCTTCCTTTTTCAACTGGTGCTTCTTCATTGGCGACATAGTTCTCATG
GCTTTTCTTACCATGCGTGCATACAAAGATGCCGAGGTTCTCGATAGATTCGAAGTTCCCTTCTTTGGCAGGGTG
GCCAGCCACATATTGGACGACGAATAA
Transcript >OphauB2|8068
ATGGACTTTGCTCCATATCAATCCTCCCCGCCCGAGCACTCGCGCGTCTCGTCGCCCGAAAACGCCTCGTCGTCG
CTCTCCCCTCGTACCTCGGCTGCCTGGGCACGCAGCCCCCCTCCGCTCCAGCACCCCCAGCCCCAGCGCGCCTGG
CCCGCAGCCGGCGGTCTTGACGGCCACGACTCGGGCGCTGGCTGGACAGATGGCTCGGGAGCCGCCGCCGCTGCG
TCGGGCCATGGCTCGTCGCCCTTTGCATCATTGGCGCCCGCCGGGGCTGCTGAGACGCACATGAGCGGGTTTGAC
ACGAGCCTCGGGCTGCGTCTCGACTATGAGGCTTGTCTCGCCTATCTCGCCCTGCCGCCCCTGGGTGCCATTATT
CTCCTGATTCTAGAACGCAATAGCGACTATGTTAGATTCCATGCCTGGCAGTCCGCACTGCTCTTTACCGCTCTC
ATGATTCTCCATTTAATCTTTTCCTGGTCTTCCTTTTTCAACTGGTGCTTCTTCATTGGCGACATAGTTCTCATG
GCTTTTCTTACCATGCGTGCATACAAAGATGCCGAGGTTCTCGATAGATTCGAAGTTCCCTTCTTTGGCAGGGTG
GCCAGCCACATATTGGACGACGAATAA
Gene >OphauB2|8068
ATGGACTTTGCTCCATATCAATCCTCCCCGCCCGAGCACTCGCGCGTCTCGTCGCCCGAAAACGCCTCGTCGTCG
CTCTCCCCTCGTACCTCGGCTGCCTGGGCACGCAGCCCCCCTCCGCTCCAGCACCCCCAGCCCCAGCGCGCCTGG
CCCGCAGCCGGCGGTCTTGACGGCCACGACTCGGGCGCTGGCTGGACAGATGGCTCGGGAGCCGCCGCCGCTGCG
TCGGGCCATGGCTCGTCGCCCTTTGCATCATTGGCGCCCGCCGGGGCTGCTGAGACGCACATGAGCGGGTTTGAC
ACGAGCCTCGGGCTGCGTCTCGACTATGAGGCTTGTCTCGCCTATCTCGCCCTGCCGCCCCTGGGTGCCATTATT
CTCCTGATTCTAGAACGCAATAGCGACTATGTTAGGTGAGAGGAACCTTCGTTACTGCTTTGGGCGACCTATAAT
GCATTCAACACGGACGTGGACAAGTGCGTACTGACTGTATGCAATCGTCGATTGTAGATTCCATGCCTGGCAGTC
CGCACTGCTCTTTACCGCTCTCATGATTCTCCATTTAATCTTTTCCTGGTCTTCCTTTTTCAACTGGTGCTTCTT
CATTGGCGACATAGTTCTCATGGCTTTTCTTACCATGCGTGCATACAAAGATGCCGAGGTTCTCGATAGGTACGC
ACCTCGTCTCATGCAGCAAGAATGAATGCAGGTTTCATTTATGCGAGCAAATACGCGCTAATGCTAGGCTCATCA
CCCAGATTCGAAGTTCCCTTCTTTGGCAGGGTGGCCAGCCACATATTGGACGACGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail