Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8065
Gene name
LocationContig_96:11301..13137
Strand-
Gene length (bp)1836
Transcript length (bp)1659
Coding sequence length (bp)1659
Protein length (aa) 553

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10281 Ish1 Putative nuclear envelope organisation protein 6.4E-13 132 165
PF10281 Ish1 Putative nuclear envelope organisation protein 1.9E-11 188 221
PF10281 Ish1 Putative nuclear envelope organisation protein 1.0E-10 335 369
PF10281 Ish1 Putative nuclear envelope organisation protein 6.3E-12 454 488

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q03104|MSC1_YEAST Meiotic sister chromatid recombination protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSC1 PE=1 SV=1 128 497 6.0E-25
sp|Q9Y7X6|ISH1_SCHPO Stress response protein ish1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ish1 PE=1 SV=1 9 489 2.0E-23
sp|Q9Y7X6|ISH1_SCHPO Stress response protein ish1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ish1 PE=1 SV=1 29 511 2.0E-16
sp|O94559|YF65_SCHPO Uncharacterized protein C23C4.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23C4.05c PE=3 SV=1 132 495 2.0E-11
sp|O94559|YF65_SCHPO Uncharacterized protein C23C4.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23C4.05c PE=3 SV=1 73 279 9.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8065
MRHFTTLLAAGLAASGALASNWFPGTKAVYNKWHETELERWLDDHDIPHSTPAERHDLEALIEKNWNDAVVEPYS
KWDSDRLSKFLQTKGAEVSQDAEETKESLLAKVKANWLETGENASQAWANAKDWILDTWTDSQLKAFCDKHGIPV
PQPRQRDTLLQKARSGYESAAKKLGESAAYPGDWLYVTWSESDFKSWLDTNGIPAPQPTTRDKLVASVRRNSRLA
YLQAQQQAAKARANAQAAYATVSDKVIDAWGESELKDFCDKNSIPVPQGTRVNELRALVRKHRAEIMDDTAGAKA
SAAFGAATSNAQNEYAKATDSASLAAQDAFNRATDAWSDSRLKSYLDARGVPVPHSSTTDELRALVRKNVHKITT
GGSAWTYDDLSREKLQQYLAQQGDAAAKALAEKSDATREELVSAAQSAYSSASTAGGEAYASATSYLAEATAAAK
DSAFDTWTETDLKAYLDSYGVPVPQGSKLEELKALARRQSTYFQYGTSSPSETLFAKLGETARGGWNWIAHQLNL
GGEAAREKAAEAEAQAKAKAEKIREEL*
Coding >OphauB2|8065
ATGAGGCACTTCACAACATTACTGGCGGCCGGCCTGGCCGCTTCGGGTGCTCTTGCCAGTAACTGGTTCCCTGGT
ACAAAAGCTGTTTATAACAAGTGGCATGAGACGGAACTTGAGCGTTGGTTGGACGACCACGACATTCCGCACTCA
ACGCCGGCTGAGCGTCATGATCTCGAGGCCTTGATTGAGAAGAATTGGAACGATGCTGTCGTTGAGCCTTACTCA
AAATGGGATTCCGATCGTCTGAGCAAGTTTTTGCAGACCAAGGGCGCCGAGGTTAGCCAGGATGCCGAGGAGACC
AAGGAGAGTCTCCTCGCAAAGGTCAAGGCCAATTGGTTGGAGACTGGAGAGAACGCTTCTCAGGCCTGGGCAAAC
GCCAAGGACTGGATTCTTGACACGTGGACCGACAGCCAGCTCAAGGCGTTTTGTGATAAGCACGGTATCCCTGTC
CCTCAGCCGCGCCAACGCGATACGCTGCTCCAAAAGGCTCGCTCTGGCTACGAATCGGCTGCCAAGAAGCTGGGC
GAATCTGCCGCCTATCCTGGCGATTGGCTCTATGTCACATGGTCCGAGTCCGATTTTAAGTCGTGGCTCGATACC
AATGGCATTCCCGCTCCCCAGCCCACGACGCGTGACAAGCTTGTAGCTTCGGTGCGCCGAAATTCGCGTCTTGCC
TACCTCCAGGCCCAGCAGCAAGCCGCTAAAGCCAGGGCCAACGCCCAGGCCGCTTATGCTACCGTTTCTGACAAG
GTTATTGACGCCTGGGGCGAGTCGGAACTCAAGGACTTTTGCGACAAGAATTCTATTCCCGTTCCTCAAGGTACT
CGAGTCAATGAGCTTCGGGCTTTGGTGCGCAAGCATCGAGCGGAAATCATGGATGACACTGCTGGAGCCAAGGCT
TCTGCAGCGTTTGGTGCTGCGACTTCGAATGCTCAAAATGAGTACGCAAAGGCTACCGACAGTGCTTCTTTGGCT
GCCCAGGATGCTTTTAATCGTGCCACTGATGCCTGGTCTGACAGCCGGCTCAAGTCATACCTGGATGCTCGAGGC
GTTCCTGTCCCTCACTCGTCAACAACAGATGAGCTTCGGGCTCTTGTCCGAAAGAATGTGCACAAGATTACAACG
GGTGGCAGTGCATGGACCTATGATGACTTATCTCGCGAGAAGCTGCAGCAGTACCTTGCCCAGCAAGGCGACGCT
GCTGCCAAGGCGCTTGCTGAGAAGAGTGATGCCACTCGTGAGGAGCTTGTCAGTGCTGCTCAATCAGCGTATTCG
TCGGCATCAACGGCAGGCGGTGAGGCTTATGCCTCGGCGACCAGTTACCTGGCCGAGGCCACGGCGGCCGCCAAG
GATAGTGCTTTTGATACTTGGACCGAGACTGATCTCAAGGCTTACCTTGATAGCTATGGCGTGCCCGTTCCGCAA
GGCTCCAAGCTTGAGGAGCTCAAGGCCTTGGCTCGCAGGCAGTCGACATACTTCCAATACGGTACCTCGTCGCCC
AGCGAGACTCTGTTCGCTAAGCTCGGAGAGACTGCCAGGGGAGGATGGAACTGGATTGCTCACCAGCTCAACTTG
GGTGGTGAGGCTGCCCGTGAGAAGGCGGCCGAGGCTGAGGCTCAAGCAAAGGCCAAGGCGGAGAAGATCAGGGAG
GAGCTTTGA
Transcript >OphauB2|8065
ATGAGGCACTTCACAACATTACTGGCGGCCGGCCTGGCCGCTTCGGGTGCTCTTGCCAGTAACTGGTTCCCTGGT
ACAAAAGCTGTTTATAACAAGTGGCATGAGACGGAACTTGAGCGTTGGTTGGACGACCACGACATTCCGCACTCA
ACGCCGGCTGAGCGTCATGATCTCGAGGCCTTGATTGAGAAGAATTGGAACGATGCTGTCGTTGAGCCTTACTCA
AAATGGGATTCCGATCGTCTGAGCAAGTTTTTGCAGACCAAGGGCGCCGAGGTTAGCCAGGATGCCGAGGAGACC
AAGGAGAGTCTCCTCGCAAAGGTCAAGGCCAATTGGTTGGAGACTGGAGAGAACGCTTCTCAGGCCTGGGCAAAC
GCCAAGGACTGGATTCTTGACACGTGGACCGACAGCCAGCTCAAGGCGTTTTGTGATAAGCACGGTATCCCTGTC
CCTCAGCCGCGCCAACGCGATACGCTGCTCCAAAAGGCTCGCTCTGGCTACGAATCGGCTGCCAAGAAGCTGGGC
GAATCTGCCGCCTATCCTGGCGATTGGCTCTATGTCACATGGTCCGAGTCCGATTTTAAGTCGTGGCTCGATACC
AATGGCATTCCCGCTCCCCAGCCCACGACGCGTGACAAGCTTGTAGCTTCGGTGCGCCGAAATTCGCGTCTTGCC
TACCTCCAGGCCCAGCAGCAAGCCGCTAAAGCCAGGGCCAACGCCCAGGCCGCTTATGCTACCGTTTCTGACAAG
GTTATTGACGCCTGGGGCGAGTCGGAACTCAAGGACTTTTGCGACAAGAATTCTATTCCCGTTCCTCAAGGTACT
CGAGTCAATGAGCTTCGGGCTTTGGTGCGCAAGCATCGAGCGGAAATCATGGATGACACTGCTGGAGCCAAGGCT
TCTGCAGCGTTTGGTGCTGCGACTTCGAATGCTCAAAATGAGTACGCAAAGGCTACCGACAGTGCTTCTTTGGCT
GCCCAGGATGCTTTTAATCGTGCCACTGATGCCTGGTCTGACAGCCGGCTCAAGTCATACCTGGATGCTCGAGGC
GTTCCTGTCCCTCACTCGTCAACAACAGATGAGCTTCGGGCTCTTGTCCGAAAGAATGTGCACAAGATTACAACG
GGTGGCAGTGCATGGACCTATGATGACTTATCTCGCGAGAAGCTGCAGCAGTACCTTGCCCAGCAAGGCGACGCT
GCTGCCAAGGCGCTTGCTGAGAAGAGTGATGCCACTCGTGAGGAGCTTGTCAGTGCTGCTCAATCAGCGTATTCG
TCGGCATCAACGGCAGGCGGTGAGGCTTATGCCTCGGCGACCAGTTACCTGGCCGAGGCCACGGCGGCCGCCAAG
GATAGTGCTTTTGATACTTGGACCGAGACTGATCTCAAGGCTTACCTTGATAGCTATGGCGTGCCCGTTCCGCAA
GGCTCCAAGCTTGAGGAGCTCAAGGCCTTGGCTCGCAGGCAGTCGACATACTTCCAATACGGTACCTCGTCGCCC
AGCGAGACTCTGTTCGCTAAGCTCGGAGAGACTGCCAGGGGAGGATGGAACTGGATTGCTCACCAGCTCAACTTG
GGTGGTGAGGCTGCCCGTGAGAAGGCGGCCGAGGCTGAGGCTCAAGCAAAGGCCAAGGCGGAGAAGATCAGGGAG
GAGCTTTGA
Gene >OphauB2|8065
ATGAGGCACTTCACAACATTACTGGCGGCCGGCCTGGCCGCTTCGGGTGCTCTTGCCAGTAACTGGTTCCCTGGT
ACAAAAGCTGGTACGTGGCCCACGCGCCTCGTGTTTCAAAGCCCTGATCACACGTATGCGTACTGGATCGCTTTG
CTCACGCATTTGCAGTTTATAACAAGTGGCATGAGACGGAACTTGAGCGTTGGTTGGACGACCACGACATTCCGC
ACTCAACGCCGGCTGAGCGTCATGATCTCGAGGCCTTGATTGAGAAGAATTGGAACGATGCTGTCGTTGAGCCTT
ACTCAAAATGGGATTCCGATCGTCTGAGCAAGTTTTTGCAGACCAAGGGCGCCGAGGTTAGCCAGGATGCCGAGG
AGACCAAGGAGAGTCTCCTCGCAAAGGTCAAGGCCAATTGGTTGGAGACTGGAGAGAACGCTTCTCAGGCCTGGG
CAAACGCCAAGGACTGGATTCTTGACACGTGGACCGACAGCCAGCTCAAGGCGTTTTGTGATAAGCACGGTATCC
CTGGTGCGTACTTTGTGTTCTCCCCTCCACCTCCCACTTGGGAGCATTGTGCACTTGATGCTCCCCACGGGCCTT
CATTGGCTGACCAATCTCCCTGCAGTCCCTCAGCCGCGCCAACGCGATACGCTGCTCCAAAAGGCTCGCTCTGGC
TACGAATCGGCTGCCAAGAAGCTGGGCGAATCTGCCGCCTATCCTGGCGATTGGCTCTATGTCACATGGTCCGAG
TCCGATTTTAAGTCGTGGCTCGATACCAATGGCATTCCCGCTCCCCAGCCCACGACGCGTGACAAGCTTGTAGCT
TCGGTGCGCCGAAATTCGCGTCTTGCCTACCTCCAGGCCCAGCAGCAAGCCGCTAAAGCCAGGGCCAACGCCCAG
GCCGCTTATGCTACCGTTTCTGACAAGGTTATTGACGCCTGGGGCGAGTCGGAACTCAAGGACTTTTGCGACAAG
AATTCTATTCCCGTTCCTCAAGGTACTCGAGTCAATGAGCTTCGGGCTTTGGTGCGCAAGCATCGAGCGGAAATC
ATGGATGACACTGCTGGAGCCAAGGCTTCTGCAGCGTTTGGTGCTGCGACTTCGAATGCTCAAAATGAGTACGCA
AAGGCTACCGACAGTGCTTCTTTGGCTGCCCAGGATGCTTTTAATCGTGCCACTGATGCCTGGTCTGACAGCCGG
CTCAAGTCATACCTGGATGCTCGAGGCGTTCCTGTCCCTCACTCGTCAACAACAGATGAGCTTCGGGCTCTTGTC
CGAAAGAATGTGCACAAGATTACAACGGGTGGCAGTGCATGGACCTATGATGACTTATCTCGCGAGAAGCTGCAG
CAGTACCTTGCCCAGCAAGGCGACGCTGCTGCCAAGGCGCTTGCTGAGAAGAGTGATGCCACTCGTGAGGAGCTT
GTCAGTGCTGCTCAATCAGCGTATTCGTCGGCATCAACGGCAGGCGGTGAGGCTTATGCCTCGGCGACCAGTTAC
CTGGCCGAGGCCACGGCGGCCGCCAAGGATAGTGCTTTTGATACTTGGACCGAGACTGATCTCAAGGCTTACCTT
GATAGCTATGGCGTGCCCGTTCCGCAAGGCTCCAAGCTTGAGGAGCTCAAGGCCTTGGCTCGCAGGCAGTCGACA
TACTTCCAATACGGTACCTCGTCGCCCAGCGAGACTCTGTTCGCTAAGCTCGGAGAGACTGCCAGGGGAGGATGG
AACTGGATTGCTCACCAGCTCAACTTGGGTGGTGAGGCTGCCCGTGAGAAGGCGGCCGAGGCTGAGGCTCAAGCA
AAGGCCAAGGCGGAGAAGATCAGGGAGGAGCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail