Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8055
Gene name
LocationContig_95:67484..69230
Strand+
Gene length (bp)1746
Transcript length (bp)1746
Coding sequence length (bp)1746
Protein length (aa) 582

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13520 AA_permease_2 Amino acid permease 4.3E-47 22 514
PF00324 AA_permease Amino acid permease 1.0E-12 128 520

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P19807|HNM1_YEAST Choline transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNM1 PE=1 SV=1 1 533 2.0E-45
sp|Q09887|YC9D_SCHPO Uncharacterized amino-acid permease C584.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC584.13 PE=3 SV=1 5 561 4.0E-35
sp|B9EXZ6|BAT1_ORYSJ Amino-acid permease BAT1 homolog OS=Oryza sativa subsp. japonica GN=BAT1 PE=2 SV=1 7 504 1.0E-32
sp|O74537|YCQ4_SCHPO Uncharacterized amino-acid permease C74.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC74.04 PE=3 SV=1 5 541 2.0E-32
sp|Q9ZU50|BAT1_ARATH Amino-acid permease BAT1 OS=Arabidopsis thaliana GN=BAT1 PE=2 SV=2 3 531 2.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P19807|HNM1_YEAST Choline transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNM1 PE=1 SV=1 1 533 2.0E-45
sp|Q09887|YC9D_SCHPO Uncharacterized amino-acid permease C584.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC584.13 PE=3 SV=1 5 561 4.0E-35
sp|B9EXZ6|BAT1_ORYSJ Amino-acid permease BAT1 homolog OS=Oryza sativa subsp. japonica GN=BAT1 PE=2 SV=1 7 504 1.0E-32
sp|O74537|YCQ4_SCHPO Uncharacterized amino-acid permease C74.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC74.04 PE=3 SV=1 5 541 2.0E-32
sp|Q9ZU50|BAT1_ARATH Amino-acid permease BAT1 OS=Arabidopsis thaliana GN=BAT1 PE=2 SV=2 3 531 2.0E-31
sp|Q9US40|YFZ1_SCHPO Uncharacterized amino-acid permease C1039.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.01 PE=3 SV=1 3 513 3.0E-30
sp|O60113|YG64_SCHPO Uncharacterized amino-acid permease C15C4.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.04c PE=3 SV=1 1 523 3.0E-29
sp|P53744|BIO5_YEAST 7-keto 8-aminopelargonic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BIO5 PE=1 SV=1 17 518 6.0E-28
sp|O74248|GPT1_CANAX Putative polyamine transporter OS=Candida albicans GN=GPT1 PE=3 SV=1 3 560 2.0E-25
sp|P32837|UGA4_YEAST GABA-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UGA4 PE=1 SV=1 5 527 7.0E-25
sp|Q10087|YAO8_SCHPO Uncharacterized amino-acid permease C11D3.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.08c PE=3 SV=1 2 540 1.0E-24
sp|Q9C0Z0|YKM2_SCHPO Uncharacterized amino-acid permease PB24D3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.02c PE=3 SV=1 5 557 7.0E-23
sp|O59942|AAP2_NEUCR Amino-acid permease 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aap-2 PE=2 SV=2 251 531 1.0E-22
sp|P36029|TPO5_YEAST Polyamine transporter TPO5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO5 PE=1 SV=1 44 559 3.0E-20
sp|Q9UT18|THI9_SCHPO Thiamine transporter thi9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi9 PE=1 SV=1 2 520 4.0E-18
sp|O59813|YCT3_SCHPO Uncharacterized amino-acid permease C794.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.03 PE=2 SV=1 5 524 1.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.5

Transmembrane Domains

Domain # Start End Length
1 57 79 22
2 128 145 17
3 183 205 22
4 212 234 22
5 260 282 22
6 304 326 22
7 341 363 22
8 409 431 22
9 435 457 22
10 469 491 22
11 506 525 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8055
MSDLDAADLAALGHAQSLSRSFSPLSMLALSFSVLGTWSTCAQNLGLGLSTGGPVAILWGLVLVALCNTCVAASL
GELVSSMPTALGQAYWVARLLGDDKHKPARQGEAAAQGTLGNGEKKKGQAGRFAAYMCAWINTFGWWTLAASQNA
FMTDFILAMRLLISPDAPTAWPASSSSSSRSPPGWLRFVVYTAITCLATAFNHVASRNARVLPLFNSLIGAWFAV
EFFLYATALPTSVHLHPALAFQPAAWVFGGWINQTGWPDAVVFLMGLVQGAYGLTAFDTVIHMVEEIPSPRRNAP
RTMCLAVVLGAVSGFVFMLICLFCIQDVSDVIGGAEFSFPFITITSSIMGRSTAAVLIGLFIANGLGQAVSVQTS
ASRLTWSFARDGGIPHGQSYFAHVDEKWHAPVRALWLQAVIVSLVGLLYLFSDAVLQAILSVSTIALTLSYGMPI
FALMLVGRRQLPPRGQFGLGPRLGPVINTISILYCITTTIVFFFPHSPNPGIRDMNWAIAVFGVMLVISIGFWLI
QGCNTFMAGIGQADEGVVVEAVLSAQSSVLSSGSRSELLDPAPAQVESVITSNVKT*
Coding >OphauB2|8055
ATGTCCGACCTCGACGCCGCCGACCTTGCCGCCCTCGGCCACGCCCAATCCCTCTCCCGCTCCTTCTCCCCCCTC
TCCATGCTCGCCCTCTCCTTCTCCGTCCTCGGCACCTGGTCCACCTGCGCGCAAAACCTCGGCCTCGGCCTCTCC
ACCGGCGGGCCCGTCGCCATCCTCTGGGGGCTCGTGCTCGTTGCCCTGTGCAACACGTGTGTCGCGGCCTCGCTC
GGCGAGCTCGTCAGTAGCATGCCCACTGCCCTCGGACAGGCTTACTGGGTGGCTCGGCTGCTGGGAGACGACAAG
CACAAGCCAGCGAGGCAAGGGGAGGCGGCTGCACAGGGGACATTGGGCAACGGTGAAAAAAAAAAGGGGCAGGCT
GGCCGCTTCGCCGCATACATGTGTGCGTGGATAAACACATTTGGCTGGTGGACGCTCGCCGCGTCGCAAAACGCC
TTCATGACAGACTTTATCCTCGCCATGCGCCTCCTCATCTCCCCCGACGCCCCCACCGCCTGGCCGGCAAGCTCC
TCGTCCTCGTCGCGCTCCCCCCCCGGCTGGCTTCGCTTCGTCGTCTACACCGCAATCACCTGCCTGGCCACCGCA
TTCAACCACGTCGCCTCGCGCAACGCCCGCGTCCTGCCCCTCTTCAACTCCCTCATTGGCGCCTGGTTCGCCGTC
GAGTTCTTCCTCTATGCCACGGCGCTGCCCACGTCGGTCCATCTTCACCCCGCACTGGCCTTTCAGCCCGCCGCC
TGGGTCTTTGGCGGTTGGATCAACCAGACGGGCTGGCCCGATGCCGTCGTCTTTCTCATGGGGCTTGTCCAGGGC
GCCTATGGCCTGACGGCTTTTGACACCGTCATCCACATGGTGGAGGAGATTCCTTCGCCTCGCCGCAACGCCCCG
CGCACAATGTGTCTTGCCGTGGTGCTTGGCGCCGTCTCGGGCTTCGTCTTTATGCTCATTTGCCTCTTTTGCATC
CAAGACGTCTCAGACGTTATTGGCGGCGCCGAGTTTTCCTTTCCCTTCATCACCATTACCAGTTCCATCATGGGC
CGCTCCACCGCTGCCGTCTTGATTGGCTTGTTTATTGCAAACGGCTTGGGACAGGCCGTCAGCGTCCAGACCTCG
GCGTCGCGCCTGACGTGGAGCTTTGCCCGTGACGGCGGCATCCCCCATGGCCAGTCCTACTTTGCCCACGTTGAC
GAAAAATGGCACGCCCCTGTCCGCGCTCTCTGGCTGCAGGCCGTCATTGTCAGCCTCGTCGGCCTTCTCTATCTC
TTTTCAGACGCCGTGCTGCAAGCCATTCTCAGCGTCAGCACCATTGCCCTTACTCTCTCCTACGGCATGCCCATC
TTTGCTCTCATGCTGGTTGGCCGGCGACAGCTTCCTCCGCGCGGCCAGTTTGGCCTTGGTCCTCGCCTGGGCCCC
GTCATCAACACCATTTCCATCCTCTACTGCATCACCACCACCATTGTCTTTTTCTTTCCCCACTCGCCCAATCCC
GGCATCAGAGACATGAATTGGGCCATTGCCGTCTTTGGCGTCATGCTCGTGATTTCTATTGGCTTTTGGCTCATT
CAGGGCTGCAATACTTTTATGGCAGGCATTGGGCAAGCCGACGAGGGTGTCGTGGTGGAAGCCGTCTTGTCTGCG
CAGAGTTCTGTCTTGAGCAGCGGCAGTCGCAGTGAGTTGCTCGACCCGGCGCCGGCACAGGTTGAAAGCGTGATT
ACTAGCAATGTCAAGACGTGA
Transcript >OphauB2|8055
ATGTCCGACCTCGACGCCGCCGACCTTGCCGCCCTCGGCCACGCCCAATCCCTCTCCCGCTCCTTCTCCCCCCTC
TCCATGCTCGCCCTCTCCTTCTCCGTCCTCGGCACCTGGTCCACCTGCGCGCAAAACCTCGGCCTCGGCCTCTCC
ACCGGCGGGCCCGTCGCCATCCTCTGGGGGCTCGTGCTCGTTGCCCTGTGCAACACGTGTGTCGCGGCCTCGCTC
GGCGAGCTCGTCAGTAGCATGCCCACTGCCCTCGGACAGGCTTACTGGGTGGCTCGGCTGCTGGGAGACGACAAG
CACAAGCCAGCGAGGCAAGGGGAGGCGGCTGCACAGGGGACATTGGGCAACGGTGAAAAAAAAAAGGGGCAGGCT
GGCCGCTTCGCCGCATACATGTGTGCGTGGATAAACACATTTGGCTGGTGGACGCTCGCCGCGTCGCAAAACGCC
TTCATGACAGACTTTATCCTCGCCATGCGCCTCCTCATCTCCCCCGACGCCCCCACCGCCTGGCCGGCAAGCTCC
TCGTCCTCGTCGCGCTCCCCCCCCGGCTGGCTTCGCTTCGTCGTCTACACCGCAATCACCTGCCTGGCCACCGCA
TTCAACCACGTCGCCTCGCGCAACGCCCGCGTCCTGCCCCTCTTCAACTCCCTCATTGGCGCCTGGTTCGCCGTC
GAGTTCTTCCTCTATGCCACGGCGCTGCCCACGTCGGTCCATCTTCACCCCGCACTGGCCTTTCAGCCCGCCGCC
TGGGTCTTTGGCGGTTGGATCAACCAGACGGGCTGGCCCGATGCCGTCGTCTTTCTCATGGGGCTTGTCCAGGGC
GCCTATGGCCTGACGGCTTTTGACACCGTCATCCACATGGTGGAGGAGATTCCTTCGCCTCGCCGCAACGCCCCG
CGCACAATGTGTCTTGCCGTGGTGCTTGGCGCCGTCTCGGGCTTCGTCTTTATGCTCATTTGCCTCTTTTGCATC
CAAGACGTCTCAGACGTTATTGGCGGCGCCGAGTTTTCCTTTCCCTTCATCACCATTACCAGTTCCATCATGGGC
CGCTCCACCGCTGCCGTCTTGATTGGCTTGTTTATTGCAAACGGCTTGGGACAGGCCGTCAGCGTCCAGACCTCG
GCGTCGCGCCTGACGTGGAGCTTTGCCCGTGACGGCGGCATCCCCCATGGCCAGTCCTACTTTGCCCACGTTGAC
GAAAAATGGCACGCCCCTGTCCGCGCTCTCTGGCTGCAGGCCGTCATTGTCAGCCTCGTCGGCCTTCTCTATCTC
TTTTCAGACGCCGTGCTGCAAGCCATTCTCAGCGTCAGCACCATTGCCCTTACTCTCTCCTACGGCATGCCCATC
TTTGCTCTCATGCTGGTTGGCCGGCGACAGCTTCCTCCGCGCGGCCAGTTTGGCCTTGGTCCTCGCCTGGGCCCC
GTCATCAACACCATTTCCATCCTCTACTGCATCACCACCACCATTGTCTTTTTCTTTCCCCACTCGCCCAATCCC
GGCATCAGAGACATGAATTGGGCCATTGCCGTCTTTGGCGTCATGCTCGTGATTTCTATTGGCTTTTGGCTCATT
CAGGGCTGCAATACTTTTATGGCAGGCATTGGGCAAGCCGACGAGGGTGTCGTGGTGGAAGCCGTCTTGTCTGCG
CAGAGTTCTGTCTTGAGCAGCGGCAGTCGCAGTGAGTTGCTCGACCCGGCGCCGGCACAGGTTGAAAGCGTGATT
ACTAGCAATGTCAAGACGTGA
Gene >OphauB2|8055
ATGTCCGACCTCGACGCCGCCGACCTTGCCGCCCTCGGCCACGCCCAATCCCTCTCCCGCTCCTTCTCCCCCCTC
TCCATGCTCGCCCTCTCCTTCTCCGTCCTCGGCACCTGGTCCACCTGCGCGCAAAACCTCGGCCTCGGCCTCTCC
ACCGGCGGGCCCGTCGCCATCCTCTGGGGGCTCGTGCTCGTTGCCCTGTGCAACACGTGTGTCGCGGCCTCGCTC
GGCGAGCTCGTCAGTAGCATGCCCACTGCCCTCGGACAGGCTTACTGGGTGGCTCGGCTGCTGGGAGACGACAAG
CACAAGCCAGCGAGGCAAGGGGAGGCGGCTGCACAGGGGACATTGGGCAACGGTGAAAAAAAAAAGGGGCAGGCT
GGCCGCTTCGCCGCATACATGTGTGCGTGGATAAACACATTTGGCTGGTGGACGCTCGCCGCGTCGCAAAACGCC
TTCATGACAGACTTTATCCTCGCCATGCGCCTCCTCATCTCCCCCGACGCCCCCACCGCCTGGCCGGCAAGCTCC
TCGTCCTCGTCGCGCTCCCCCCCCGGCTGGCTTCGCTTCGTCGTCTACACCGCAATCACCTGCCTGGCCACCGCA
TTCAACCACGTCGCCTCGCGCAACGCCCGCGTCCTGCCCCTCTTCAACTCCCTCATTGGCGCCTGGTTCGCCGTC
GAGTTCTTCCTCTATGCCACGGCGCTGCCCACGTCGGTCCATCTTCACCCCGCACTGGCCTTTCAGCCCGCCGCC
TGGGTCTTTGGCGGTTGGATCAACCAGACGGGCTGGCCCGATGCCGTCGTCTTTCTCATGGGGCTTGTCCAGGGC
GCCTATGGCCTGACGGCTTTTGACACCGTCATCCACATGGTGGAGGAGATTCCTTCGCCTCGCCGCAACGCCCCG
CGCACAATGTGTCTTGCCGTGGTGCTTGGCGCCGTCTCGGGCTTCGTCTTTATGCTCATTTGCCTCTTTTGCATC
CAAGACGTCTCAGACGTTATTGGCGGCGCCGAGTTTTCCTTTCCCTTCATCACCATTACCAGTTCCATCATGGGC
CGCTCCACCGCTGCCGTCTTGATTGGCTTGTTTATTGCAAACGGCTTGGGACAGGCCGTCAGCGTCCAGACCTCG
GCGTCGCGCCTGACGTGGAGCTTTGCCCGTGACGGCGGCATCCCCCATGGCCAGTCCTACTTTGCCCACGTTGAC
GAAAAATGGCACGCCCCTGTCCGCGCTCTCTGGCTGCAGGCCGTCATTGTCAGCCTCGTCGGCCTTCTCTATCTC
TTTTCAGACGCCGTGCTGCAAGCCATTCTCAGCGTCAGCACCATTGCCCTTACTCTCTCCTACGGCATGCCCATC
TTTGCTCTCATGCTGGTTGGCCGGCGACAGCTTCCTCCGCGCGGCCAGTTTGGCCTTGGTCCTCGCCTGGGCCCC
GTCATCAACACCATTTCCATCCTCTACTGCATCACCACCACCATTGTCTTTTTCTTTCCCCACTCGCCCAATCCC
GGCATCAGAGACATGAATTGGGCCATTGCCGTCTTTGGCGTCATGCTCGTGATTTCTATTGGCTTTTGGCTCATT
CAGGGCTGCAATACTTTTATGGCAGGCATTGGGCAAGCCGACGAGGGTGTCGTGGTGGAAGCCGTCTTGTCTGCG
CAGAGTTCTGTCTTGAGCAGCGGCAGTCGCAGTGAGTTGCTCGACCCGGCGCCGGCACAGGTTGAAAGCGTGATT
ACTAGCAATGTCAAGACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail