Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|805
Gene name
LocationContig_117:60956..62608
Strand+
Gene length (bp)1652
Transcript length (bp)894
Coding sequence length (bp)894
Protein length (aa) 298

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 8.9E-17 73 164
PF13489 Methyltransf_23 Methyltransferase domain 1.0E-15 55 224
PF08241 Methyltransf_11 Methyltransferase domain 6.8E-15 74 166
PF13847 Methyltransf_31 Methyltransferase domain 7.0E-12 68 177
PF08242 Methyltransf_12 Methyltransferase domain 2.7E-10 74 165
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 9.8E-08 68 171
PF00891 Methyltransf_2 O-methyltransferase domain 2.6E-05 67 180

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q72HI4|MENG_THET2 Demethylmenaquinone methyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=menG PE=3 SV=1 68 171 6.0E-08
sp|Q9RRT0|MENG_DEIRA Demethylmenaquinone methyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=menG PE=3 SV=1 69 171 1.0E-07
sp|B8ISV4|TAM_METNO Trans-aconitate 2-methyltransferase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=tam PE=3 SV=1 66 187 2.0E-07
sp|Q55423|Y829_SYNY3 Uncharacterized methyltransferase sll0829 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0829 PE=3 SV=1 67 172 8.0E-07
sp|B8DBZ5|MENG_LISMH Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=menG PE=3 SV=1 67 173 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q72HI4|MENG_THET2 Demethylmenaquinone methyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=menG PE=3 SV=1 68 171 6.0E-08
sp|Q9RRT0|MENG_DEIRA Demethylmenaquinone methyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=menG PE=3 SV=1 69 171 1.0E-07
sp|B8ISV4|TAM_METNO Trans-aconitate 2-methyltransferase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=tam PE=3 SV=1 66 187 2.0E-07
sp|Q55423|Y829_SYNY3 Uncharacterized methyltransferase sll0829 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0829 PE=3 SV=1 67 172 8.0E-07
sp|B8DBZ5|MENG_LISMH Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=menG PE=3 SV=1 67 173 1.0E-06
sp|A0AK43|MENG_LISW6 Demethylmenaquinone methyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=menG PE=3 SV=1 73 173 1.0E-06
sp|P67055|MENG_LISMO Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menG PE=3 SV=1 67 173 1.0E-06
sp|Q71Y84|MENG_LISMF Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menG PE=3 SV=1 67 173 1.0E-06
sp|C1KWN1|MENG_LISMC Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=menG PE=3 SV=1 67 173 1.0E-06
sp|P67056|MENG_LISIN Demethylmenaquinone methyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menG PE=3 SV=1 67 173 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|805
MDEENGTVPLDESLTETVDFHGRAYQKYALANGTYYAPIDEDEIARLELMHSIFHKVFDNRLIFPPISSPKKILD
CGCGAGDWAVQVARRYPECEILGIDISPHMIPEDAPRNLEIQIDDLNGEFTFPSNEFDLVHSQMMAGGINAQRWR
SYLRDILRVLRPGGWCQMVEMYFNAQSDNGTLKRDAALSRWSSHYLDSLHPQKDLRAALQLPRWMRSAGFTEVET
RLLTLPMCAWSNDARERSIGEANSQNVPLLLHSLALYPLTQLGSMPIDEFDKIVEQAKAEASNPSLKAYFPL*
Coding >OphauB2|805
ATGGACGAAGAAAATGGCACAGTGCCTCTTGATGAATCCCTGACCGAGACGGTAGATTTTCACGGCCGAGCGTAC
CAAAAATATGCCTTGGCAAACGGCACATACTATGCTCCTATTGATGAGGACGAAATTGCGCGTCTCGAGCTGATG
CATTCTATTTTCCACAAAGTCTTCGACAATCGGCTCATATTTCCTCCAATTTCGTCGCCCAAGAAAATTCTCGAT
TGTGGCTGTGGCGCTGGTGACTGGGCTGTCCAAGTCGCCAGACGCTATCCCGAGTGCGAGATCCTGGGCATAGAC
ATTAGCCCGCATATGATTCCCGAGGACGCCCCAAGAAATCTCGAAATACAAATTGACGACTTGAATGGAGAGTTC
ACCTTCCCCTCAAATGAATTCGACCTTGTCCACAGCCAGATGATGGCTGGCGGCATCAACGCGCAAAGATGGCGA
AGTTACTTGCGAGATATTCTACGCGTTCTTCGACCCGGAGGATGGTGTCAAATGGTTGAGATGTATTTCAATGCT
CAATCAGACAACGGCACGTTGAAACGAGACGCTGCTCTTTCCCGGTGGTCCAGTCACTATCTCGACTCATTGCAT
CCGCAAAAAGACCTCAGGGCCGCTCTTCAACTCCCCAGGTGGATGCGCAGCGCCGGATTCACAGAGGTAGAGACG
AGGCTTCTAACGCTGCCCATGTGTGCCTGGTCAAACGATGCGCGGGAGCGCAGTATTGGAGAGGCCAATAGTCAA
AATGTGCCATTGCTGCTACATTCACTGGCGCTTTACCCTTTGACACAACTTGGGAGTATGCCAATTGATGAATTC
GACAAGATTGTTGAGCAAGCAAAGGCCGAAGCAAGTAATCCATCGCTCAAGGCATATTTTCCCCTGTGA
Transcript >OphauB2|805
ATGGACGAAGAAAATGGCACAGTGCCTCTTGATGAATCCCTGACCGAGACGGTAGATTTTCACGGCCGAGCGTAC
CAAAAATATGCCTTGGCAAACGGCACATACTATGCTCCTATTGATGAGGACGAAATTGCGCGTCTCGAGCTGATG
CATTCTATTTTCCACAAAGTCTTCGACAATCGGCTCATATTTCCTCCAATTTCGTCGCCCAAGAAAATTCTCGAT
TGTGGCTGTGGCGCTGGTGACTGGGCTGTCCAAGTCGCCAGACGCTATCCCGAGTGCGAGATCCTGGGCATAGAC
ATTAGCCCGCATATGATTCCCGAGGACGCCCCAAGAAATCTCGAAATACAAATTGACGACTTGAATGGAGAGTTC
ACCTTCCCCTCAAATGAATTCGACCTTGTCCACAGCCAGATGATGGCTGGCGGCATCAACGCGCAAAGATGGCGA
AGTTACTTGCGAGATATTCTACGCGTTCTTCGACCCGGAGGATGGTGTCAAATGGTTGAGATGTATTTCAATGCT
CAATCAGACAACGGCACGTTGAAACGAGACGCTGCTCTTTCCCGGTGGTCCAGTCACTATCTCGACTCATTGCAT
CCGCAAAAAGACCTCAGGGCCGCTCTTCAACTCCCCAGGTGGATGCGCAGCGCCGGATTCACAGAGGTAGAGACG
AGGCTTCTAACGCTGCCCATGTGTGCCTGGTCAAACGATGCGCGGGAGCGCAGTATTGGAGAGGCCAATAGTCAA
AATGTGCCATTGCTGCTACATTCACTGGCGCTTTACCCTTTGACACAACTTGGGAGTATGCCAATTGATGAATTC
GACAAGATTGTTGAGCAAGCAAAGGCCGAAGCAAGTAATCCATCGCTCAAGGCATATTTTCCCCTGTGA
Gene >OphauB2|805
ATGGACGAAGAGTCAGGCCAATCCCCGTTTGCCTCGCAGTCGCTTAAATACTGACGCATCTCCAAGAAATGGCAC
AGTGCCTCTTGATGAATCCCTGACCGAGACGGTAGATTTTCACGGCCGAGCGTACCAAAAATATGCCTTGGCAAA
CGGCACATACTATGCTCCTATTGATGAGGTATCCTTGAGACTTTTATGTCTAGCCCATTTAGAGCAACATGGCGA
CGCCATTGTGATTTTTAACACCTCAGGCAGGACGAAATTGCGCGTCTCGAGCTGATGCATTCTATTTTCCACAAA
GTCTTCGACAATCGGCTCATATTTCCTCCAATTTCGTCGCCCAAGAAAATTCTCGATTGTGGCTGTGGCGCTGGT
GACTGGGCTGTCCAAGTCGCCAGACGCTATCCCGAGTGCGAGGTGCGTCTTTAGTGCGAATCGATATTCTCCCCC
TCGAAACAGCTGTATAGCCTGTCAGCGAGCAATACACGACAGTGGCCTGCACTCTGTTGCATCAACAAAGCGTCT
TGGGGTGTGCGCCAACTCCTTTGCTGGCATCGGCATGGACCAGTAAACAAGCCAAACGTGGGAAGCCTGACAGCC
GACAATGGCGAGCGGCTAACCGCCCTGGTGTCATATCAAATTTCTTTGACCAGCCCTGTGCACCAAATTTGCATT
GGCATGGCATAATCAGAGACGGAGGCTGACAGTAAAGACTAGATCCTGGGCATAGACATTAGCCCGCATATGATT
CCCGAGGACGCCCCAAGAAATCTCGAAATACAAATTGACGACTTGAATGGAGAGTTAGCAATGCACTGTCAAGAC
ACATGTCGGAGCATGATGGACTGACTTGTTGTCTTTGCAAGGTTCACCTTCCCCTCAAATGAATTCGACCTTGTC
CACAGCCAGATGATGGCTGGCGGCATCAACGCGCAAAGATGGCGAAGTTACTTGCGAGATATTCTACGCGTTCTT
CGACCCGGAGGATGGTGTCAAATGGTTGAGATGTATTTCAATGCTCAATCAGACAACGGCACGTTGAAACGAGGC
GAGCACGCGCACCAAGACCAGACATCGAGTGGGCATACCATACTGATGAGGCCAATACCCACAGACGCTGCTCTT
TCCCGGTGGTCCAGTCACTATCTCGACTCATTGCATCCGCAAAAAGACCTCAGGGCCGCTCTTCAACTCCCCAGG
TGGATGCGCAGCGCCGGATTCACAGAGGTAGAGACGAGGCTTCTAACGCTGCCCATGTGTGCCTGGTCAAACGGT
TAGTATTCTCTGTCCGGTATAAAGCACTGACTGATGCCAGAGGGCATATGACAGATGCGCGGGAGCGCAGTATTG
GAGAGGCCAATAGTCAAAATGTGCCATTGCTGCTACATTCACTGGCGCTTTACCCTTTGACACAACTTGGGAGGT
AAGGGAGAGACCAGGCCAGCCCAAGACACTCCAAGCACACCACGGTTGACCAGCAAATATCATCAGTATGCCAAT
TGATGAATTCGACAAGATTGTTGAGCAAGCAAAGGCCGAAGCAAGTAATCCATCGCTCAAGGTATGTCTGAAGTC
AATGCAAACGCACCTAATAATAATGGTAATTTGCTGATGAATCGTGGTATGTAATCAAGGCATATTTTCCCCTGT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail