Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8046
Gene name
LocationContig_95:40954..41547
Strand+
Gene length (bp)593
Transcript length (bp)492
Coding sequence length (bp)492
Protein length (aa) 164

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01284 MARVEL Membrane-associating domain 8.2E-14 7 135

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22
2 46 68 22
3 77 99 22
4 114 136 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8046
MALALSITTILYAVLAVFLVIELGLTAYVVSPRSTWWGGSPSQFNFMLFNTIWSLLALAYLALAPAFFPRLFHRT
AALGLLAVTTIFWFAGSIAMAAFVGAPDCRRSDACSLVQSAQAAVAFGFFIWAGFMALSVLDGLSFWRGGGARVD
GGRKTTQQPYPGV*
Coding >OphauB2|8046
ATGGCGCTCGCGCTGAGCATAACAACTATTCTCTATGCCGTCTTGGCCGTCTTTCTCGTTATTGAGCTGGGCCTC
ACTGCCTATGTCGTCAGCCCACGCTCGACTTGGTGGGGCGGCTCCCCCTCGCAATTCAACTTCATGCTCTTCAAC
ACCATTTGGTCCCTCCTCGCTCTCGCATACCTCGCTCTCGCTCCCGCCTTCTTCCCCCGCCTCTTCCACCGCACC
GCCGCCCTTGGGCTTCTTGCCGTCACCACCATTTTTTGGTTCGCCGGCAGCATCGCCATGGCCGCCTTTGTTGGC
GCCCCCGACTGTCGCCGTAGCGATGCCTGCTCCCTCGTCCAGAGCGCCCAGGCCGCCGTCGCCTTTGGCTTCTTT
ATATGGGCCGGATTCATGGCCTTGTCCGTCTTGGACGGCTTGAGCTTTTGGCGCGGCGGTGGCGCTCGCGTCGAT
GGCGGCCGCAAAACGACGCAGCAGCCATATCCAGGTGTTTAG
Transcript >OphauB2|8046
ATGGCGCTCGCGCTGAGCATAACAACTATTCTCTATGCCGTCTTGGCCGTCTTTCTCGTTATTGAGCTGGGCCTC
ACTGCCTATGTCGTCAGCCCACGCTCGACTTGGTGGGGCGGCTCCCCCTCGCAATTCAACTTCATGCTCTTCAAC
ACCATTTGGTCCCTCCTCGCTCTCGCATACCTCGCTCTCGCTCCCGCCTTCTTCCCCCGCCTCTTCCACCGCACC
GCCGCCCTTGGGCTTCTTGCCGTCACCACCATTTTTTGGTTCGCCGGCAGCATCGCCATGGCCGCCTTTGTTGGC
GCCCCCGACTGTCGCCGTAGCGATGCCTGCTCCCTCGTCCAGAGCGCCCAGGCCGCCGTCGCCTTTGGCTTCTTT
ATATGGGCCGGATTCATGGCCTTGTCCGTCTTGGACGGCTTGAGCTTTTGGCGCGGCGGTGGCGCTCGCGTCGAT
GGCGGCCGCAAAACGACGCAGCAGCCATATCCAGGTGTTTAG
Gene >OphauB2|8046
ATGGCGCTCGCGCTGAGCATAACAACTATTCTCTATGCCGTCTTGGCCGTCTTTCTCGTTATTGAGCTGGGCCTC
ACTGCCTATGGCAAGTCTTTTTTTTCTTCTCCCTTCTTGTCCTCCAAGCCTTCAAGACCACTATATCTCTTCTCT
CTTATCCTCTACGCCCATTTGCTAACCGTTTCGCAGTCGTCAGCCCACGCTCGACTTGGTGGGGCGGCTCCCCCT
CGCAATTCAACTTCATGCTCTTCAACACCATTTGGTCCCTCCTCGCTCTCGCATACCTCGCTCTCGCTCCCGCCT
TCTTCCCCCGCCTCTTCCACCGCACCGCCGCCCTTGGGCTTCTTGCCGTCACCACCATTTTTTGGTTCGCCGGCA
GCATCGCCATGGCCGCCTTTGTTGGCGCCCCCGACTGTCGCCGTAGCGATGCCTGCTCCCTCGTCCAGAGCGCCC
AGGCCGCCGTCGCCTTTGGCTTCTTTATATGGGCCGGATTCATGGCCTTGTCCGTCTTGGACGGCTTGAGCTTTT
GGCGCGGCGGTGGCGCTCGCGTCGATGGCGGCCGCAAAACGACGCAGCAGCCATATCCAGGTGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail