Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8044
Gene name
LocationContig_95:35941..37303
Strand+
Gene length (bp)1362
Transcript length (bp)1173
Coding sequence length (bp)1173
Protein length (aa) 391

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18 7.4E-56 15 354

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AM60|CHI4_CANAL Chitinase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHT4 PE=3 SV=1 66 243 2.0E-17
sp|P11220|CHIT_STRPL Chitinase 63 OS=Streptomyces plicatus GN=chtA PE=1 SV=2 60 368 1.0E-16
sp|P36909|CHIT_STRLI Chitinase C OS=Streptomyces lividans GN=chiC PE=2 SV=1 60 354 2.0E-16
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 19 354 3.0E-16
sp|P32470|CHI1_APHAL Chitinase 1 OS=Aphanocladium album GN=CHI1 PE=1 SV=2 77 349 5.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AM60|CHI4_CANAL Chitinase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHT4 PE=3 SV=1 66 243 2.0E-17
sp|P11220|CHIT_STRPL Chitinase 63 OS=Streptomyces plicatus GN=chtA PE=1 SV=2 60 368 1.0E-16
sp|P36909|CHIT_STRLI Chitinase C OS=Streptomyces lividans GN=chiC PE=2 SV=1 60 354 2.0E-16
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 19 354 3.0E-16
sp|P32470|CHI1_APHAL Chitinase 1 OS=Aphanocladium album GN=CHI1 PE=1 SV=2 77 349 5.0E-16
sp|E9QRF2|CHIB1_ASPFU Endochitinase B1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chiB1 PE=3 SV=1 9 365 1.0E-15
sp|Q873X9|CHIB1_ASPFM Endochitinase B1 OS=Neosartorya fumigata GN=chiB1 PE=1 SV=1 9 365 1.0E-15
sp|Q92222|CHIB_EMEND Endochitinase B OS=Emericella nidulans GN=chiB PE=1 SV=3 25 243 2.0E-15
sp|G5EAZ3|CHIB1_EMENI Endochitinase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chiB PE=1 SV=1 25 243 2.0E-15
sp|P20533|CHIA1_BACCI Chitinase A1 OS=Bacillus circulans GN=chiA1 PE=1 SV=1 77 354 4.0E-15
sp|P48827|CHI42_TRIHA Endochitinase 42 OS=Trichoderma harzianum GN=chit42 PE=1 SV=1 67 354 5.0E-15
sp|A6N6J0|CHI46_TRIHA Endochitinase 46 OS=Trichoderma harzianum GN=chit46 PE=1 SV=1 67 373 6.0E-15
sp|Q1E3R8|CHI1_COCIM Endochitinase 1 OS=Coccidioides immitis (strain RS) GN=CTS1 PE=3 SV=1 1 373 7.0E-15
sp|C5P230|CHI1_COCP7 Endochitinase 1 OS=Coccidioides posadasii (strain C735) GN=CTS1 PE=3 SV=1 77 373 7.0E-15
sp|P0CB51|CHI1_COCPS Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=CTS1 PE=1 SV=1 77 373 8.0E-15
sp|Q06350|CHI2_YEAST Sporulation-specific chitinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTS2 PE=1 SV=1 75 272 2.0E-14
sp|Q9W092|CHIT2_DROME Probable chitinase 2 OS=Drosophila melanogaster GN=Cht2 PE=1 SV=1 70 243 2.0E-13
sp|E9ERT9|CHI1_METRA Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=chit1 PE=3 SV=1 68 349 5.0E-13
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 8 354 1.0E-12
sp|O14456|CHI1_METAN Endochitinase 1 OS=Metarhizium anisopliae GN=chit1 PE=1 SV=1 68 354 1.0E-12
sp|Q11174|CHIT_CAEEL Probable endochitinase OS=Caenorhabditis elegans GN=cht-1 PE=1 SV=1 9 354 1.0E-12
sp|Q13231|CHIT1_HUMAN Chitotriosidase-1 OS=Homo sapiens GN=CHIT1 PE=1 SV=1 19 243 5.0E-12
sp|Q28042|OVGP1_BOVIN Oviduct-specific glycoprotein (Fragment) OS=Bos taurus GN=OVGP1 PE=1 SV=1 12 243 3.0E-11
sp|P36362|CHIT_MANSE Endochitinase OS=Manduca sexta PE=2 SV=1 38 243 7.0E-11
sp|Q9D7Q1|CHIT1_MOUSE Chitotriosidase-1 OS=Mus musculus GN=Chit1 PE=1 SV=2 38 243 9.0E-11
sp|Q28542|OVGP1_SHEEP Oviduct-specific glycoprotein OS=Ovis aries GN=OVGP1 PE=1 SV=1 12 243 1.0E-10
sp|Q95M17|CHIA_BOVIN Acidic mammalian chitinase OS=Bos taurus GN=CHIA PE=1 SV=1 38 204 3.0E-10
sp|Q91XA9|CHIA_MOUSE Acidic mammalian chitinase OS=Mus musculus GN=Chia PE=1 SV=2 38 204 5.0E-10
sp|H2A0L4|CHI1_PINMG Putative chitinase 1 OS=Pinctada margaritifera PE=1 SV=1 18 243 5.0E-10
sp|P11797|CHIB_SERMA Chitinase B OS=Serratia marcescens GN=chiB PE=1 SV=1 70 216 6.0E-10
sp|Q6RY07|CHIA_RAT Acidic mammalian chitinase OS=Rattus norvegicus GN=Chia PE=2 SV=1 38 204 4.0E-09
sp|P09805|KTXA_KLULA Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) PE=1 SV=1 76 231 6.0E-09
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 19 354 9.0E-09
sp|Q7YS85|CH3L1_BUBBU Chitinase-3-like protein 1 OS=Bubalus bubalis GN=CHI3L1 PE=1 SV=3 38 214 1.0E-08
sp|Q9WTV1|CH3L1_RAT Chitinase-3-like protein 1 OS=Rattus norvegicus GN=Chi3l1 PE=2 SV=3 38 214 1.0E-08
sp|Q61362|CH3L1_MOUSE Chitinase-3-like protein 1 OS=Mus musculus GN=Chi3l1 PE=1 SV=3 38 214 1.0E-08
sp|Q6TMG6|CH3L1_SHEEP Chitinase-3-like protein 1 OS=Ovis aries GN=CHI3L1 PE=1 SV=1 38 226 2.0E-08
sp|Q62010|OVGP1_MOUSE Oviduct-specific glycoprotein OS=Mus musculus GN=Ovgp1 PE=2 SV=1 22 357 2.0E-08
sp|P30922|CH3L1_BOVIN Chitinase-3-like protein 1 OS=Bos taurus GN=CHI3L1 PE=1 SV=3 38 214 5.0E-08
sp|Q60557|OVGP1_MESAU Oviduct-specific glycoprotein OS=Mesocricetus auratus GN=OVGP1 PE=1 SV=1 12 357 8.0E-08
sp|P29030|CHIT_BRUMA Endochitinase OS=Brugia malayi PE=1 SV=1 38 354 1.0E-07
sp|P36222|CH3L1_HUMAN Chitinase-3-like protein 1 OS=Homo sapiens GN=CHI3L1 PE=1 SV=2 38 214 2.0E-07
sp|Q8SPQ0|CH3L1_CAPHI Chitinase-3-like protein 1 OS=Capra hircus GN=CHI3L1 PE=1 SV=1 38 214 2.0E-07
sp|Q5RBP6|CH3L1_PONAB Chitinase-3-like protein 1 OS=Pongo abelii GN=CHI3L1 PE=2 SV=1 38 214 2.0E-07
sp|O35744|CHIL3_MOUSE Chitinase-like protein 3 OS=Mus musculus GN=Chil3 PE=1 SV=2 38 354 7.0E-07
sp|Q29411|CH3L1_PIG Chitinase-3-like protein 1 OS=Sus scrofa GN=CHI3L1 PE=1 SV=2 38 214 7.0E-07
sp|H2A0L5|CHI2_PINMG Putative chitinase 2 OS=Pinctada margaritifera PE=1 SV=1 23 354 9.0E-07
sp|Q9BZP6|CHIA_HUMAN Acidic mammalian chitinase OS=Homo sapiens GN=CHIA PE=1 SV=1 38 204 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8044
MASMSESPRPEAHKRCIMYLTGQHNVIPQDEETMAGITHIIIAFYSSSLFNVEKTPPEFPLFTTVEKVRRAAHAK
TRVMVAIGGWGDSLGFEEAARDDESRSRWARQVAAMVDQQGADGVDIDWEFPGGNRDDYKLVPNSEREWEIEAFV
YLIEQLRKTLGSSKIISLAVPGGASDLIAFTNTTTRRIARQVDFFNVMTYDMMGRRSTVVAHHSGIADSKDAIKR
YIDRGVPPCMINLGLGYYVKWCMTQECRVENPLGCQTQLLEDPTTGADLGKTGGFSWHDETPPELRHSFQLSLEC
GKYFDDGSYGYWDAAQKRWWSYDTPKTILRKLDAFFAEPSLGLGGVFAWGLGEDAPRFEHLGATLAGLARLQRGS
RACGDDQDVRTCATS*
Coding >OphauB2|8044
ATGGCGTCCATGTCCGAATCGCCCAGGCCTGAGGCGCACAAGCGCTGCATAATGTATCTCACTGGACAGCACAAT
GTCATTCCTCAAGATGAAGAGACCATGGCTGGCATCACGCACATCATCATCGCCTTTTATAGTTCAAGCCTCTTC
AACGTGGAAAAGACGCCCCCCGAGTTCCCCCTCTTCACCACAGTGGAAAAGGTGCGCCGCGCTGCTCATGCCAAG
ACGAGGGTCATGGTGGCCATTGGCGGATGGGGCGACTCGCTAGGCTTTGAAGAGGCGGCGCGAGACGATGAGTCT
CGAAGTCGCTGGGCCCGCCAAGTCGCGGCCATGGTGGACCAGCAGGGAGCCGATGGCGTCGACATTGACTGGGAG
TTTCCAGGCGGCAACCGCGACGACTACAAGCTTGTGCCCAACTCGGAGCGAGAGTGGGAAATCGAGGCCTTTGTA
TACCTGATTGAGCAGCTCCGCAAGACGCTTGGCTCCAGCAAGATTATTTCGCTTGCCGTTCCAGGCGGCGCAAGC
GACTTGATTGCCTTTACAAACACAACAACTCGGCGCATTGCACGCCAAGTCGACTTTTTCAACGTCATGACGTAC
GACATGATGGGCCGCCGCAGCACCGTGGTGGCGCATCACAGCGGCATTGCAGATAGCAAAGACGCCATCAAGCGC
TACATTGACCGAGGCGTGCCGCCTTGCATGATCAACCTTGGTCTGGGATACTATGTCAAGTGGTGCATGACGCAA
GAGTGCCGTGTTGAGAACCCGCTTGGCTGTCAGACGCAGCTGCTCGAAGACCCCACGACGGGCGCCGACTTGGGA
AAGACGGGAGGCTTTAGCTGGCACGACGAGACGCCGCCCGAGCTGCGGCATTCTTTTCAACTGTCGCTAGAGTGC
GGCAAGTACTTTGACGATGGCAGCTATGGCTACTGGGATGCCGCGCAGAAGCGGTGGTGGTCATATGACACGCCA
AAGACCATCTTGCGCAAGCTGGATGCCTTTTTTGCAGAGCCTAGTCTTGGCCTCGGCGGCGTCTTTGCCTGGGGG
CTGGGCGAAGATGCACCTAGGTTTGAGCATCTCGGCGCCACCTTGGCAGGCCTGGCACGGCTCCAGAGAGGCTCG
AGGGCATGTGGCGACGACCAAGACGTGCGCACCTGTGCAACGAGCTAG
Transcript >OphauB2|8044
ATGGCGTCCATGTCCGAATCGCCCAGGCCTGAGGCGCACAAGCGCTGCATAATGTATCTCACTGGACAGCACAAT
GTCATTCCTCAAGATGAAGAGACCATGGCTGGCATCACGCACATCATCATCGCCTTTTATAGTTCAAGCCTCTTC
AACGTGGAAAAGACGCCCCCCGAGTTCCCCCTCTTCACCACAGTGGAAAAGGTGCGCCGCGCTGCTCATGCCAAG
ACGAGGGTCATGGTGGCCATTGGCGGATGGGGCGACTCGCTAGGCTTTGAAGAGGCGGCGCGAGACGATGAGTCT
CGAAGTCGCTGGGCCCGCCAAGTCGCGGCCATGGTGGACCAGCAGGGAGCCGATGGCGTCGACATTGACTGGGAG
TTTCCAGGCGGCAACCGCGACGACTACAAGCTTGTGCCCAACTCGGAGCGAGAGTGGGAAATCGAGGCCTTTGTA
TACCTGATTGAGCAGCTCCGCAAGACGCTTGGCTCCAGCAAGATTATTTCGCTTGCCGTTCCAGGCGGCGCAAGC
GACTTGATTGCCTTTACAAACACAACAACTCGGCGCATTGCACGCCAAGTCGACTTTTTCAACGTCATGACGTAC
GACATGATGGGCCGCCGCAGCACCGTGGTGGCGCATCACAGCGGCATTGCAGATAGCAAAGACGCCATCAAGCGC
TACATTGACCGAGGCGTGCCGCCTTGCATGATCAACCTTGGTCTGGGATACTATGTCAAGTGGTGCATGACGCAA
GAGTGCCGTGTTGAGAACCCGCTTGGCTGTCAGACGCAGCTGCTCGAAGACCCCACGACGGGCGCCGACTTGGGA
AAGACGGGAGGCTTTAGCTGGCACGACGAGACGCCGCCCGAGCTGCGGCATTCTTTTCAACTGTCGCTAGAGTGC
GGCAAGTACTTTGACGATGGCAGCTATGGCTACTGGGATGCCGCGCAGAAGCGGTGGTGGTCATATGACACGCCA
AAGACCATCTTGCGCAAGCTGGATGCCTTTTTTGCAGAGCCTAGTCTTGGCCTCGGCGGCGTCTTTGCCTGGGGG
CTGGGCGAAGATGCACCTAGGTTTGAGCATCTCGGCGCCACCTTGGCAGGCCTGGCACGGCTCCAGAGAGGCTCG
AGGGCATGTGGCGACGACCAAGACGTGCGCACCTGTGCAACGAGCTAG
Gene >OphauB2|8044
ATGGCGTCCATGTCCGAATCGCCCAGGCCTGAGGCGCACAAGCGCTGCATAATGTATCTCACTGGGTAAGCTGCT
ACACACACACGCACACACACACACACATATATATATATATATATATTGTATAGACATCATATACAGGCCACCTCT
TGCTAACTGCAATGCCACGCTTGCAGACAGCACAATGTCATTCCTCAAGATGAAGAGACCATGGCTGGCATCACG
CACATCATCATCGCCTTTTATAGTTCAAGCCTCTTCAACGTGGAAAAGACGCCCCCCGAGTTCCCCCTCTTCACC
ACAGTGGAAAAGGTGCGCCGCGCTGCTCATGCCAAGACGAGGGTCATGGTGGCCATTGGCGGATGGGGCGACTCG
CTAGGCTTTGAAGAGGCGGCGCGAGACGATGAGTCTCGAAGTCGCTGGGCCCGCCAAGTCGCGGCCATGGTGGAC
CAGCAGGGAGCCGATGGCGTCGACATTGACTGGGAGTTTCCAGGGTGCGTGGCTTGCGTCTTGCTTCTAGTGTCT
GGGACGTTTGCCGAGTATTGGCTAATTGGAGAGCTCGTCCTTGGCAGCGGCAACCGCGACGACTACAAGCTTGTG
CCCAACTCGGAGCGAGAGTGGGAAATCGAGGCCTTTGTATACCTGATTGAGCAGCTCCGCAAGACGCTTGGCTCC
AGCAAGATTATTTCGCTTGCCGTTCCAGGCGGCGCAAGCGACTTGATTGCCTTTACAAACACAACAACTCGGCGC
ATTGCACGCCAAGTCGACTTTTTCAACGTCATGACGTACGACATGATGGGCCGCCGCAGCACCGTGGTGGCGCAT
CACAGCGGCATTGCAGATAGCAAAGACGCCATCAAGCGCTACATTGACCGAGGCGTGCCGCCTTGCATGATCAAC
CTTGGTCTGGGATACTATGTCAAGTGGTGCATGACGCAAGAGTGCCGTGTTGAGAACCCGCTTGGCTGTCAGACG
CAGCTGCTCGAAGACCCCACGACGGGCGCCGACTTGGGAAAGACGGGAGGCTTTAGCTGGCACGACGAGACGCCG
CCCGAGCTGCGGCATTCTTTTCAACTGTCGCTAGAGTGCGGCAAGTACTTTGACGATGGCAGCTATGGCTACTGG
GATGCCGCGCAGAAGCGGTGGTGGTCATATGACACGCCAAAGACCATCTTGCGCAAGCTGGATGCCTTTTTTGCA
GAGCCTAGTCTTGGCCTCGGCGGCGTCTTTGCCTGGGGGCTGGGCGAAGATGCACCTAGGTTTGAGCATCTCGGC
GCCACCTTGGCAGGCCTGGCACGGCTCCAGAGAGGCTCGAGGGCATGTGGCGACGACCAAGACGTGCGCACCTGT
GCAACGAGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail