Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8041
Gene name
LocationContig_95:28235..30082
Strand+
Gene length (bp)1847
Transcript length (bp)1770
Coding sequence length (bp)1770
Protein length (aa) 590

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00860 Xan_ur_permease Permease family 2.2E-62 79 504

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P48777|UAPC_EMENI Purine permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=uapC PE=2 SV=2 6 555 0.0E+00
sp|Q07307|UAPA_EMENI Uric acid-xanthine permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=uapA PE=1 SV=3 9 557 0.0E+00
sp|Q9HE12|YI31_SCHPO Putative purine permease C1399.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.01c PE=3 SV=1 33 574 0.0E+00
sp|P0AGN2|XANP_SHIFL Xanthine permease XanP OS=Shigella flexneri GN=xanP PE=3 SV=1 50 554 7.0E-54
sp|P0AGM9|XANP_ECOLI Xanthine permease XanP OS=Escherichia coli (strain K12) GN=xanP PE=1 SV=1 50 554 7.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P48777|UAPC_EMENI Purine permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=uapC PE=2 SV=2 6 555 0.0E+00
sp|Q07307|UAPA_EMENI Uric acid-xanthine permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=uapA PE=1 SV=3 9 557 0.0E+00
sp|Q9HE12|YI31_SCHPO Putative purine permease C1399.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.01c PE=3 SV=1 33 574 0.0E+00
sp|P0AGN2|XANP_SHIFL Xanthine permease XanP OS=Shigella flexneri GN=xanP PE=3 SV=1 50 554 7.0E-54
sp|P0AGM9|XANP_ECOLI Xanthine permease XanP OS=Escherichia coli (strain K12) GN=xanP PE=1 SV=1 50 554 7.0E-54
sp|P0AGN0|XANP_ECOL6 Xanthine permease XanP OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=xanP PE=3 SV=1 50 554 7.0E-54
sp|P0AGN1|XANP_ECO57 Xanthine permease XanP OS=Escherichia coli O157:H7 GN=xanP PE=3 SV=1 50 554 7.0E-54
sp|P67444|XANQ_ECOLI Xanthine permease XanQ OS=Escherichia coli (strain K12) GN=xanQ PE=1 SV=2 67 558 1.0E-50
sp|P67445|XANQ_ECOL6 Xanthine permease XanQ OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=xanQ PE=3 SV=2 67 558 1.0E-50
sp|P67446|XANQ_ECO57 Xanthine permease XanQ OS=Escherichia coli O157:H7 GN=xanQ PE=3 SV=2 67 558 1.0E-50
sp|P50487|Y397_CLOPE Putative purine permease CPE0397 OS=Clostridium perfringens (strain 13 / Type A) GN=cpx PE=3 SV=3 54 558 9.0E-38
sp|Q46821|UACT_ECOLI Uric acid transporter UacT OS=Escherichia coli (strain K12) GN=uacT PE=1 SV=2 79 512 2.0E-32
sp|O32140|PUCK_BACSU Uric acid permease PucK OS=Bacillus subtilis (strain 168) GN=pucK PE=2 SV=1 79 524 1.0E-31
sp|P42086|PBUX_BACSU Xanthine permease OS=Bacillus subtilis (strain 168) GN=pbuX PE=3 SV=1 79 561 3.0E-30
sp|O32139|PUCJ_BACSU Uric acid permease PucJ OS=Bacillus subtilis (strain 168) GN=pucJ PE=2 SV=1 81 511 3.0E-16
sp|Q0WPE9|NAT7_ARATH Nucleobase-ascorbate transporter 7 OS=Arabidopsis thaliana GN=NAT7 PE=2 SV=2 78 520 3.0E-15
sp|P0AGM7|URAA_ECOLI Uracil permease OS=Escherichia coli (strain K12) GN=uraA PE=1 SV=1 68 494 3.0E-14
sp|P0AGM8|URAA_ECO57 Uracil permease OS=Escherichia coli O157:H7 GN=uraA PE=3 SV=1 68 494 3.0E-14
sp|Q8VZQ5|NAT8_ARATH Nucleobase-ascorbate transporter 8 OS=Arabidopsis thaliana GN=NAT8 PE=2 SV=1 79 560 3.0E-12
sp|Q8RWE9|NAT5_ARATH Nucleobase-ascorbate transporter 5 OS=Arabidopsis thaliana GN=NAT5 PE=2 SV=1 78 554 1.0E-11
sp|P41006|PYRP_BACCL Uracil permease OS=Bacillus caldolyticus GN=pyrP PE=3 SV=1 290 552 4.0E-11
sp|Q9SHZ3|NAT1_ARATH Nucleobase-ascorbate transporter 1 OS=Arabidopsis thaliana GN=NAT1 PE=2 SV=1 54 567 3.0E-10
sp|Q27GI3|NAT6_ARATH Nucleobase-ascorbate transporter 6 OS=Arabidopsis thaliana GN=NAT6 PE=2 SV=2 78 515 4.0E-10
sp|P93039|NAT4_ARATH Nucleobase-ascorbate transporter 4 OS=Arabidopsis thaliana GN=NAT4 PE=2 SV=2 79 513 6.0E-10
sp|Q41760|LPE1_MAIZE Nucleobase-ascorbate transporter LPE1 OS=Zea mays GN=LPE1 PE=1 SV=2 391 548 2.0E-09
sp|B0JZG0|S23A2_XENTR Solute carrier family 23 member 2 OS=Xenopus tropicalis GN=slc23a2 PE=2 SV=1 61 558 3.0E-09
sp|P75892|RUTG_ECOLI Putative pyrimidine permease RutG OS=Escherichia coli (strain K12) GN=rutG PE=1 SV=2 70 477 7.0E-09
sp|Q8GZD4|NAT3_ARATH Nucleobase-ascorbate transporter 3 OS=Arabidopsis thaliana GN=NAT3 PE=2 SV=2 79 558 6.0E-08
sp|Q9EPR4|S23A2_MOUSE Solute carrier family 23 member 2 OS=Mus musculus GN=Slc23a2 PE=1 SV=2 61 584 8.0E-08
sp|Q9UHI7|S23A1_HUMAN Solute carrier family 23 member 1 OS=Homo sapiens GN=SLC23A1 PE=1 SV=3 363 576 2.0E-07
sp|Q9Z2J0|S23A1_MOUSE Solute carrier family 23 member 1 OS=Mus musculus GN=Slc23a1 PE=1 SV=2 363 579 4.0E-07
sp|P39766|PYRP_BACSU Uracil permease OS=Bacillus subtilis (strain 168) GN=pyrP PE=1 SV=2 290 565 5.0E-07
sp|O04472|NAT10_ARATH Putative nucleobase-ascorbate transporter 10 OS=Arabidopsis thaliana GN=NAT10 PE=3 SV=2 407 557 6.0E-07
sp|Q9CPL9|URAA_PASMU Probable uracil permease OS=Pasteurella multocida (strain Pm70) GN=uraA PE=3 SV=1 284 560 9.0E-07
sp|P45117|URAA_HAEIN Probable uracil permease OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=uraA PE=3 SV=1 295 557 1.0E-06
sp|Q9WTW7|S23A1_RAT Solute carrier family 23 member 1 OS=Rattus norvegicus GN=Slc23a1 PE=2 SV=1 363 558 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 76 98 22
2 113 135 22
3 142 164 22
4 190 209 19
5 214 236 22
6 270 292 22
7 305 327 22
8 337 359 22
9 432 454 22
10 464 483 19
11 490 509 19
12 529 551 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8041
MEEHGGTQPASPPQPPTNALVRTLQSARHTFTTRQGLIGDYDYASLFRPTLPFIKRSPLANRNSPFFGIDDSMPV
LLALLLGLQHALAMLAGVITPPILLSGPDGANLTPDEQHYLVSTALIVSGILSCLQINRFRIPKTRYFIGTGVLS
VVGISFSTIPIAQGAFTQMYANGFCPSLADGTRLPCPKGYGALLGTSAVCALIQVGISFLPPRILLRLFPPIVTG
PTVMLIGVHLIESGFKDWMGGSGPCSAAEATDMFAKCPNIDAPHALPWGSPEYLGLGFAAFVTIILCERFGSPIM
KSTSVVIGLAVGCIFGGAFGYFDATGVNEAPVASFIWVHTFPLSLYGPLVLPLIAVFLIVSTEAVGDITATCDVS
RLAVEGGSYESRIQGGLLTDGLNSIFSALMTMTPMSRFAQNNGVIALTRCANRKAGYASCFFLILFGVFAKFAAG
VVAIPKPVLGGMTTFLFASVAVSGMAIIARGVPFNRRTRFILTTGLSLGFGATLVPNWFERVFGYTGSNKALAGL
LNAIVLIMQTGFAVTAICCMLLDLVLPKEMDEEVDIELTHLDVATGAKTSDEVSGRNTPASPRA*
Coding >OphauB2|8041
ATGGAGGAACATGGCGGCACACAGCCCGCTTCGCCTCCCCAGCCGCCCACCAACGCCCTGGTGCGCACCCTCCAG
TCTGCCAGACACACCTTTACCACTCGCCAAGGCCTCATCGGAGACTATGACTATGCCTCGCTCTTTCGCCCCACG
CTGCCCTTTATAAAGCGCTCGCCGCTGGCAAACCGCAACAGCCCCTTTTTTGGCATTGACGACTCGATGCCCGTC
TTGCTGGCGCTGCTGCTGGGCTTGCAGCATGCCCTGGCTATGCTGGCTGGCGTTATCACGCCGCCCATTTTGCTC
AGCGGCCCTGATGGCGCCAACTTGACGCCTGACGAGCAGCACTATCTCGTGTCGACGGCTCTCATTGTTTCGGGC
ATCTTGTCGTGCCTCCAGATTAACCGGTTTCGCATCCCCAAGACGCGCTACTTTATTGGAACTGGCGTCTTGTCC
GTCGTCGGCATATCCTTTTCCACCATTCCAATTGCCCAGGGCGCCTTTACCCAAATGTACGCCAATGGCTTTTGT
CCGTCGTTGGCCGACGGCACTCGACTGCCCTGTCCAAAGGGCTACGGCGCTTTGCTCGGAACATCGGCCGTCTGC
GCGCTCATTCAAGTGGGCATTTCCTTTTTGCCGCCGCGCATCCTGCTGCGCCTGTTCCCGCCCATTGTCACGGGG
CCCACGGTGATGCTGATTGGCGTCCACCTGATTGAGAGCGGCTTCAAGGACTGGATGGGCGGCAGCGGGCCCTGC
TCGGCTGCTGAGGCAACCGACATGTTTGCCAAGTGTCCCAATATTGATGCTCCGCATGCGCTGCCCTGGGGCTCG
CCCGAGTATCTGGGCCTGGGCTTTGCCGCCTTTGTCACCATTATTCTGTGCGAGCGCTTTGGCTCGCCCATTATG
AAGTCGACGTCTGTGGTGATTGGACTTGCGGTGGGGTGCATCTTTGGCGGCGCCTTTGGCTACTTTGACGCGACG
GGCGTCAATGAGGCGCCAGTGGCGTCGTTTATCTGGGTGCACACGTTTCCCTTGTCTTTGTACGGGCCGCTGGTG
CTGCCGCTCATTGCCGTGTTTCTCATTGTGTCGACCGAGGCCGTGGGCGACATTACGGCTACTTGCGATGTTTCG
CGCCTTGCGGTCGAGGGAGGCAGCTATGAATCTCGGATCCAGGGCGGCCTGCTGACGGACGGGCTCAATAGCATC
TTTTCAGCACTCATGACCATGACGCCCATGAGCCGCTTTGCTCAAAACAATGGCGTCATAGCACTGACGCGGTGC
GCCAATCGCAAGGCGGGCTATGCTAGCTGCTTCTTCCTCATCTTGTTTGGCGTCTTTGCCAAGTTTGCGGCGGGC
GTGGTTGCCATTCCCAAGCCTGTGCTGGGCGGCATGACGACGTTTTTGTTTGCCTCGGTGGCTGTGTCGGGCATG
GCCATTATTGCGCGGGGCGTGCCCTTTAACCGACGGACACGCTTTATCCTGACGACGGGCCTGTCGCTTGGCTTT
GGCGCGACGCTGGTGCCCAATTGGTTTGAGCGCGTCTTTGGCTACACGGGCAGCAACAAGGCGCTGGCGGGCCTG
CTCAATGCTATTGTCTTGATAATGCAGACGGGCTTTGCCGTGACTGCGATTTGCTGCATGCTGCTGGACCTGGTG
CTACCCAAGGAGATGGACGAAGAGGTGGATATTGAATTGACGCATCTAGATGTTGCCACGGGGGCCAAGACTAGT
GACGAGGTGAGTGGTAGAAACACGCCGGCGTCGCCACGAGCCTAG
Transcript >OphauB2|8041
ATGGAGGAACATGGCGGCACACAGCCCGCTTCGCCTCCCCAGCCGCCCACCAACGCCCTGGTGCGCACCCTCCAG
TCTGCCAGACACACCTTTACCACTCGCCAAGGCCTCATCGGAGACTATGACTATGCCTCGCTCTTTCGCCCCACG
CTGCCCTTTATAAAGCGCTCGCCGCTGGCAAACCGCAACAGCCCCTTTTTTGGCATTGACGACTCGATGCCCGTC
TTGCTGGCGCTGCTGCTGGGCTTGCAGCATGCCCTGGCTATGCTGGCTGGCGTTATCACGCCGCCCATTTTGCTC
AGCGGCCCTGATGGCGCCAACTTGACGCCTGACGAGCAGCACTATCTCGTGTCGACGGCTCTCATTGTTTCGGGC
ATCTTGTCGTGCCTCCAGATTAACCGGTTTCGCATCCCCAAGACGCGCTACTTTATTGGAACTGGCGTCTTGTCC
GTCGTCGGCATATCCTTTTCCACCATTCCAATTGCCCAGGGCGCCTTTACCCAAATGTACGCCAATGGCTTTTGT
CCGTCGTTGGCCGACGGCACTCGACTGCCCTGTCCAAAGGGCTACGGCGCTTTGCTCGGAACATCGGCCGTCTGC
GCGCTCATTCAAGTGGGCATTTCCTTTTTGCCGCCGCGCATCCTGCTGCGCCTGTTCCCGCCCATTGTCACGGGG
CCCACGGTGATGCTGATTGGCGTCCACCTGATTGAGAGCGGCTTCAAGGACTGGATGGGCGGCAGCGGGCCCTGC
TCGGCTGCTGAGGCAACCGACATGTTTGCCAAGTGTCCCAATATTGATGCTCCGCATGCGCTGCCCTGGGGCTCG
CCCGAGTATCTGGGCCTGGGCTTTGCCGCCTTTGTCACCATTATTCTGTGCGAGCGCTTTGGCTCGCCCATTATG
AAGTCGACGTCTGTGGTGATTGGACTTGCGGTGGGGTGCATCTTTGGCGGCGCCTTTGGCTACTTTGACGCGACG
GGCGTCAATGAGGCGCCAGTGGCGTCGTTTATCTGGGTGCACACGTTTCCCTTGTCTTTGTACGGGCCGCTGGTG
CTGCCGCTCATTGCCGTGTTTCTCATTGTGTCGACCGAGGCCGTGGGCGACATTACGGCTACTTGCGATGTTTCG
CGCCTTGCGGTCGAGGGAGGCAGCTATGAATCTCGGATCCAGGGCGGCCTGCTGACGGACGGGCTCAATAGCATC
TTTTCAGCACTCATGACCATGACGCCCATGAGCCGCTTTGCTCAAAACAATGGCGTCATAGCACTGACGCGGTGC
GCCAATCGCAAGGCGGGCTATGCTAGCTGCTTCTTCCTCATCTTGTTTGGCGTCTTTGCCAAGTTTGCGGCGGGC
GTGGTTGCCATTCCCAAGCCTGTGCTGGGCGGCATGACGACGTTTTTGTTTGCCTCGGTGGCTGTGTCGGGCATG
GCCATTATTGCGCGGGGCGTGCCCTTTAACCGACGGACACGCTTTATCCTGACGACGGGCCTGTCGCTTGGCTTT
GGCGCGACGCTGGTGCCCAATTGGTTTGAGCGCGTCTTTGGCTACACGGGCAGCAACAAGGCGCTGGCGGGCCTG
CTCAATGCTATTGTCTTGATAATGCAGACGGGCTTTGCCGTGACTGCGATTTGCTGCATGCTGCTGGACCTGGTG
CTACCCAAGGAGATGGACGAAGAGGTGGATATTGAATTGACGCATCTAGATGTTGCCACGGGGGCCAAGACTAGT
GACGAGGTGAGTGGTAGAAACACGCCGGCGTCGCCACGAGCCTAG
Gene >OphauB2|8041
ATGGAGGAACATGGCGGCACACAGCCCGCTTCGCCTCCCCAGCCGCCCACCAACGCCCTGGTGCGCACCCTCCAG
TCTGCCAGACACACCTTTACCACTCGCCAAGGCCTCATCGGAGACTATGACTATGCCTCGCTCTTTCGCCCCACG
CTGCCCTTTATAAAGCGCTCGCCGCTGGCAAACCGCAACAGCCCCTTTTTTGGCATTGACGACTCGATGCCCGTC
TTGCTGGCGCTGCTGCTGGGCTTGCAGCATGCCCTGGCTATGCTGGCTGGCGTTATCACGCCGCCCATTTTGCTC
AGCGGCCCTGATGGCGCCAACTTGACGCCTGACGAGCAGCACTATCTCGTGTCGACGGCTCTCATTGTTTCGGGC
ATCTTGTCGTGCCTCCAGATTAACCGGTTTCGCATCCCCAAGACGCGGTGAGTCTTGTTTATTGTAGAGGCGTGT
GTGTGTGTGTGTGTGTCAGGAAAAGGGGCCCTGGACTGACTGTTGACAGCTACTTTATTGGAACTGGCGTCTTGT
CCGTCGTCGGCATATCCTTTTCCACCATTCCAATTGCCCAGGGCGCCTTTACCCAAATGTACGCCAATGGCTTTT
GTCCGTCGTTGGCCGACGGCACTCGACTGCCCTGTCCAAAGGGCTACGGCGCTTTGCTCGGAACATCGGCCGTCT
GCGCGCTCATTCAAGTGGGCATTTCCTTTTTGCCGCCGCGCATCCTGCTGCGCCTGTTCCCGCCCATTGTCACGG
GGCCCACGGTGATGCTGATTGGCGTCCACCTGATTGAGAGCGGCTTCAAGGACTGGATGGGCGGCAGCGGGCCCT
GCTCGGCTGCTGAGGCAACCGACATGTTTGCCAAGTGTCCCAATATTGATGCTCCGCATGCGCTGCCCTGGGGCT
CGCCCGAGTATCTGGGCCTGGGCTTTGCCGCCTTTGTCACCATTATTCTGTGCGAGCGCTTTGGCTCGCCCATTA
TGAAGTCGACGTCTGTGGTGATTGGACTTGCGGTGGGGTGCATCTTTGGCGGCGCCTTTGGCTACTTTGACGCGA
CGGGCGTCAATGAGGCGCCAGTGGCGTCGTTTATCTGGGTGCACACGTTTCCCTTGTCTTTGTACGGGCCGCTGG
TGCTGCCGCTCATTGCCGTGTTTCTCATTGTGTCGACCGAGGCCGTGGGCGACATTACGGCTACTTGCGATGTTT
CGCGCCTTGCGGTCGAGGGAGGCAGCTATGAATCTCGGATCCAGGGCGGCCTGCTGACGGACGGGCTCAATAGCA
TCTTTTCAGCACTCATGACCATGACGCCCATGAGCCGCTTTGCTCAAAACAATGGCGTCATAGCACTGACGCGGT
GCGCCAATCGCAAGGCGGGCTATGCTAGCTGCTTCTTCCTCATCTTGTTTGGCGTCTTTGCCAAGTTTGCGGCGG
GCGTGGTTGCCATTCCCAAGCCTGTGCTGGGCGGCATGACGACGTTTTTGTTTGCCTCGGTGGCTGTGTCGGGCA
TGGCCATTATTGCGCGGGGCGTGCCCTTTAACCGACGGACACGCTTTATCCTGACGACGGGCCTGTCGCTTGGCT
TTGGCGCGACGCTGGTGCCCAATTGGTTTGAGCGCGTCTTTGGCTACACGGGCAGCAACAAGGCGCTGGCGGGCC
TGCTCAATGCTATTGTCTTGATAATGCAGACGGGCTTTGCCGTGACTGCGATTTGCTGCATGCTGCTGGACCTGG
TGCTACCCAAGGAGATGGACGAAGAGGTGGATATTGAATTGACGCATCTAGATGTTGCCACGGGGGCCAAGACTA
GTGACGAGGTGAGTGGTAGAAACACGCCGGCGTCGCCACGAGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail