Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8039
Gene name
LocationContig_95:18013..21708
Strand-
Gene length (bp)3695
Transcript length (bp)3561
Coding sequence length (bp)3561
Protein length (aa) 1187

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18004 RPN2_C 26S proteasome regulatory subunit RPN2 C-terminal domain 5.4E-54 870 1044
PF01851 PC_rep Proteasome/cyclosome repeat 1.3E-04 525 554
PF01851 PC_rep Proteasome/cyclosome repeat 1.2E-04 598 628
PF01851 PC_rep Proteasome/cyclosome repeat 1.2E-08 735 769
PF13646 HEAT_2 HEAT repeats 8.2E-15 684 775

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3TXS7|PSMD1_MOUSE 26S proteasome non-ATPase regulatory subunit 1 OS=Mus musculus GN=Psmd1 PE=1 SV=1 201 920 0.0E+00
sp|Q6FIP2|RPN2_CANGA 26S proteasome regulatory subunit RPN2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPN2 PE=3 SV=1 170 1046 0.0E+00
sp|Q75CF3|RPN2_ASHGO 26S proteasome regulatory subunit RPN2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPN2 PE=3 SV=1 201 1056 0.0E+00
sp|P32565|RPN2_YEAST 26S proteasome regulatory subunit RPN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN2 PE=1 SV=4 190 1059 0.0E+00
sp|Q54JM5|PSMD1_DICDI 26S proteasome non-ATPase regulatory subunit 1 OS=Dictyostelium discoideum GN=psmD1 PE=1 SV=1 194 1064 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3TXS7|PSMD1_MOUSE 26S proteasome non-ATPase regulatory subunit 1 OS=Mus musculus GN=Psmd1 PE=1 SV=1 201 920 0.0E+00
sp|Q6FIP2|RPN2_CANGA 26S proteasome regulatory subunit RPN2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPN2 PE=3 SV=1 170 1046 0.0E+00
sp|Q75CF3|RPN2_ASHGO 26S proteasome regulatory subunit RPN2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPN2 PE=3 SV=1 201 1056 0.0E+00
sp|P32565|RPN2_YEAST 26S proteasome regulatory subunit RPN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN2 PE=1 SV=4 190 1059 0.0E+00
sp|Q54JM5|PSMD1_DICDI 26S proteasome non-ATPase regulatory subunit 1 OS=Dictyostelium discoideum GN=psmD1 PE=1 SV=1 194 1064 0.0E+00
sp|Q9V3P6|PSMD1_DROME 26S proteasome non-ATPase regulatory subunit 1 OS=Drosophila melanogaster GN=Rpn2 PE=1 SV=1 201 1046 0.0E+00
sp|Q5R5S4|PSMD1_PONAB 26S proteasome non-ATPase regulatory subunit 1 OS=Pongo abelii GN=PSMD1 PE=2 SV=1 201 920 0.0E+00
sp|Q99460|PSMD1_HUMAN 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens GN=PSMD1 PE=1 SV=2 201 920 0.0E+00
sp|Q5F418|PSMD1_CHICK 26S proteasome non-ATPase regulatory subunit 1 OS=Gallus gallus GN=PSMD1 PE=2 SV=1 201 920 0.0E+00
sp|O48844|PSD1A_ARATH 26S proteasome non-ATPase regulatory subunit 1 homolog A OS=Arabidopsis thaliana GN=RPN2A PE=1 SV=1 201 1044 0.0E+00
sp|Q9MAT0|PSD1B_ARATH 26S proteasome non-ATPase regulatory subunit 1 homolog B OS=Arabidopsis thaliana GN=RPN2B PE=1 SV=1 201 1044 0.0E+00
sp|O88761|PSMD1_RAT 26S proteasome non-ATPase regulatory subunit 1 OS=Rattus norvegicus GN=Psmd1 PE=1 SV=1 4 920 0.0E+00
sp|O74762|RPN2_SCHPO 26S proteasome regulatory subunit rpn2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn2 PE=1 SV=1 201 1046 0.0E+00
sp|Q18115|PSMD1_CAEEL 26S proteasome non-ATPase regulatory subunit 1 OS=Caenorhabditis elegans GN=rpn-2 PE=3 SV=4 169 1054 2.0E-158
sp|Q8SSH5|RPN2_ENCCU 26S proteasome regulatory subunit RPN2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPN2 PE=1 SV=1 309 879 4.0E-63
sp|Q9V3P6|PSMD1_DROME 26S proteasome non-ATPase regulatory subunit 1 OS=Drosophila melanogaster GN=Rpn2 PE=1 SV=1 3 125 6.0E-26
sp|Q5F418|PSMD1_CHICK 26S proteasome non-ATPase regulatory subunit 1 OS=Gallus gallus GN=PSMD1 PE=2 SV=1 4 131 2.0E-25
sp|Q6FIP2|RPN2_CANGA 26S proteasome regulatory subunit RPN2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPN2 PE=3 SV=1 4 303 2.0E-25
sp|Q3TXS7|PSMD1_MOUSE 26S proteasome non-ATPase regulatory subunit 1 OS=Mus musculus GN=Psmd1 PE=1 SV=1 4 131 5.0E-25
sp|Q99460|PSMD1_HUMAN 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens GN=PSMD1 PE=1 SV=2 4 131 2.0E-24
sp|Q5R5S4|PSMD1_PONAB 26S proteasome non-ATPase regulatory subunit 1 OS=Pongo abelii GN=PSMD1 PE=2 SV=1 4 131 2.0E-24
sp|O74762|RPN2_SCHPO 26S proteasome regulatory subunit rpn2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn2 PE=1 SV=1 4 121 3.0E-24
sp|P32565|RPN2_YEAST 26S proteasome regulatory subunit RPN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN2 PE=1 SV=4 4 144 3.0E-22
sp|Q75CF3|RPN2_ASHGO 26S proteasome regulatory subunit RPN2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPN2 PE=3 SV=1 4 111 2.0E-18
sp|O48844|PSD1A_ARATH 26S proteasome non-ATPase regulatory subunit 1 homolog A OS=Arabidopsis thaliana GN=RPN2A PE=1 SV=1 2 122 3.0E-18
sp|Q54JM5|PSMD1_DICDI 26S proteasome non-ATPase regulatory subunit 1 OS=Dictyostelium discoideum GN=psmD1 PE=1 SV=1 1 123 5.0E-17
sp|P87048|RPN1_SCHPO 26S proteasome regulatory subunit rpn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn1 PE=1 SV=2 450 878 8.0E-16
sp|Q9MAT0|PSD1B_ARATH 26S proteasome non-ATPase regulatory subunit 1 homolog B OS=Arabidopsis thaliana GN=RPN2B PE=1 SV=1 6 110 2.0E-15
sp|Q7S8R8|RPN1_NEUCR 26S proteasome regulatory subunit rpn-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rpn-1 PE=3 SV=2 450 879 2.0E-12
sp|Q9SIV2|PSD2A_ARATH 26S proteasome non-ATPase regulatory subunit 2 homolog A OS=Arabidopsis thaliana GN=RPN1A PE=1 SV=2 450 879 7.0E-11
sp|Q6XJG8|PSD2B_ARATH 26S proteasome non-ATPase regulatory subunit 2 homolog B OS=Arabidopsis thaliana GN=RPN1B PE=1 SV=1 450 879 1.0E-09
sp|P56701|PSMD2_BOVIN 26S proteasome non-ATPase regulatory subunit 2 OS=Bos taurus GN=PSMD2 PE=1 SV=2 447 690 9.0E-09
sp|P38764|RPN1_YEAST 26S proteasome regulatory subunit RPN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN1 PE=1 SV=3 450 688 1.0E-08
sp|Q8VDM4|PSMD2_MOUSE 26S proteasome non-ATPase regulatory subunit 2 OS=Mus musculus GN=Psmd2 PE=1 SV=1 447 690 1.0E-08
sp|Q13200|PSMD2_HUMAN 26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens GN=PSMD2 PE=1 SV=3 447 690 1.0E-08
sp|Q4FZT9|PSMD2_RAT 26S proteasome non-ATPase regulatory subunit 2 OS=Rattus norvegicus GN=Psmd2 PE=1 SV=1 447 690 1.0E-08
sp|Q5R9I6|PSMD2_PONAB 26S proteasome non-ATPase regulatory subunit 2 OS=Pongo abelii GN=PSMD2 PE=2 SV=1 447 690 1.0E-08
sp|Q54BC6|PSMD2_DICDI 26S proteasome non-ATPase regulatory subunit 2 OS=Dictyostelium discoideum GN=psmD2 PE=1 SV=1 447 831 1.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8039
MPGLVSATGVLAFLADEEAELKVFALQTLNDDIDTVWTEVADSLNQLEALYEDDSFPERQLVALVLAKVYYHLQA
YNDSMVFALAAGDLFKLDAPGEFEETIISKCVDQYIASSASKHIKPNPASNSELPELTTTFSHASDGALMSPTTP
FSHTTLPPKSLLSRASLDNTIIDATFQPVLKQGRSGSVAQLLPDQATEASLQRVIDRLFESALKQGRYRQVVGIA
VEAKNLEVLRRVIKRASDDEKRAKSSCRIQDGLPGPAEELMEYMLGICMDIVQERSFRTEILRLILDLLSDIPHP
DYFAIARCVVYLNADDEASRMLRCLVDKGERTSLASAYQIAFDLYDNGTQEFLGKVLASLPSGKQVEKKESGEEA
PQEEQSLLANQQDGDEERLPEREAKAWRNIGSILDGSKTIRLNLEFLYRNNHTDLSILNKVRDSLEGRNSIFHTA
VTFCNGFMNQGTTNDKFFRDNLEWLGKAVNWSKFSATAALGVIHRGNLSQSRKLLEPYLPKPGAVGTGSVFSQGG
ALYAYGLIHANHGADALDYLKAQFGQTKDDVVQHGGALGLGIAGMATGDGDLFEKLKRVLFEDKALNGEAVGLSM
GLIMLGTGNVKALEDMITYAHETTHEKIVRGVAIGMALIMYGRQEGADVLIEGLLNDPDPTLRYGGILTVALAYC
GTGSNKAIRKLLHTAVSDVNDDVRRIAVMSLGFILFRRPSSVPRMVELLSESYNPHVRYGSAMALGISCAGTGLD
EAIDLLEPMMKDPTDFVRQGALIALSMIMVQQNEAMNPKVASIRKTLKRVVGDRHEDAMTKFGAAIALGIIDAGG
RNCTIGLQTQTGNLNMAGIVGMAVFTQYWYWFPFTHFLCLSFSPTAIIGLDHDLDIPDFKFYCAARQSLFDYPPE
QEVKAEEGPTVVAAAILSTTAQAKRRAQKKERAQRRESMDLDTVPPAAKSAGGDNKAGGDKMDIDDEGKKKDEAK
DKEAATSDTKTSKKPEKEKIGFEIGNMSRVLPSQLRYISLPSGRYKPVKKPTGGPLLLTDSQPDEPKALLEEKLK
KVTTERAPVAGQSGHRAQVVSRSGDRSLLDSLMEQSGRGGGAAAAVDRILRSQIRPGEGAGGQQHQQHQQQRQGR
RGAQDGSRGGGAAAAAAEADDAAAVAAVLTALDEGDDEAPVPTDFDYYSDDEGEGSSNEAK*
Coding >OphauB2|8039
ATGCCTGGACTGGTATCCGCTACGGGCGTGCTCGCCTTCCTTGCTGACGAAGAAGCCGAGCTCAAGGTGTTTGCT
CTGCAAACGCTCAATGATGATATTGACACGGTCTGGACAGAGGTGGCGGACAGCTTGAATCAACTCGAGGCCCTC
TATGAAGACGACTCTTTTCCGGAGCGCCAGCTTGTCGCCTTGGTCCTCGCCAAAGTTTACTATCACCTCCAGGCG
TATAATGACAGCATGGTGTTTGCCCTGGCCGCCGGCGACTTGTTCAAGCTTGACGCGCCCGGAGAGTTTGAGGAG
ACGATTATATCAAAGTGTGTTGACCAGTACATTGCCTCGTCGGCCTCGAAGCACATCAAGCCCAATCCGGCCTCC
AACTCGGAGCTCCCCGAGCTCACTACTACCTTCTCCCACGCCTCGGATGGCGCTCTTATGTCTCCGACGACGCCC
TTTTCCCATACAACCCTACCTCCCAAGTCGCTGCTGTCGCGCGCGTCGCTCGATAACACGATAATCGATGCTACC
TTTCAGCCTGTGCTCAAGCAGGGCCGCTCGGGTTCCGTGGCCCAGCTGCTGCCGGATCAAGCAACCGAGGCCTCG
CTGCAGCGCGTCATTGACCGTCTGTTTGAGAGCGCTCTTAAGCAGGGCCGCTATCGCCAGGTGGTGGGCATCGCC
GTCGAGGCCAAAAACTTGGAGGTGTTGCGACGCGTCATCAAGCGCGCAAGCGATGACGAGAAGCGCGCCAAGTCG
TCGTGTAGGATACAGGACGGTCTTCCTGGTCCAGCCGAGGAGCTCATGGAGTACATGCTGGGCATTTGTATGGAT
ATTGTCCAGGAACGGAGCTTCCGCACTGAGATTCTGCGCCTCATTCTCGACTTGCTCAGCGATATTCCCCACCCC
GACTATTTTGCCATTGCAAGATGTGTCGTTTACCTCAATGCCGATGACGAGGCGTCGCGCATGCTGCGATGTCTA
GTAGACAAGGGGGAACGCACGTCGCTGGCCAGTGCCTATCAAATTGCCTTTGACTTGTACGACAATGGCACACAG
GAATTCCTGGGAAAGGTGCTGGCGTCGCTGCCGTCGGGAAAGCAGGTTGAGAAGAAGGAGTCGGGCGAGGAGGCG
CCGCAAGAAGAGCAGAGCCTGCTGGCAAACCAGCAAGACGGGGACGAGGAGAGGCTTCCAGAGAGGGAGGCCAAA
GCATGGCGCAACATTGGCTCCATTCTCGACGGCTCCAAGACGATTCGACTCAACCTGGAATTCTTGTACCGCAAT
AACCACACAGATCTCAGCATTCTCAACAAGGTGCGCGACAGCCTAGAGGGCCGCAACTCCATCTTCCACACGGCA
GTGACGTTTTGCAATGGCTTCATGAACCAAGGCACGACGAATGACAAGTTTTTCCGCGACAACCTCGAGTGGCTG
GGCAAGGCTGTGAACTGGTCTAAGTTTTCAGCCACAGCTGCCCTGGGAGTCATTCACCGCGGCAATCTGTCGCAG
TCGCGCAAGCTGCTGGAGCCGTATCTGCCAAAGCCCGGGGCTGTTGGCACGGGGTCCGTGTTTAGCCAGGGCGGC
GCCCTGTATGCCTATGGCCTGATTCACGCCAATCACGGGGCGGATGCGCTCGACTACCTCAAGGCCCAGTTTGGG
CAGACCAAGGACGATGTGGTGCAGCACGGCGGGGCGCTGGGGCTGGGGATTGCGGGCATGGCGACGGGCGACGGC
GACTTGTTTGAGAAGCTCAAGAGAGTCTTGTTTGAGGACAAGGCGCTCAATGGCGAGGCAGTTGGGCTGTCCATG
GGCCTCATCATGCTGGGCACGGGCAACGTCAAGGCGCTCGAGGACATGATTACGTATGCGCACGAGACGACGCAC
GAGAAGATTGTGCGCGGGGTGGCGATTGGCATGGCGCTCATCATGTATGGGCGACAAGAGGGCGCCGACGTGCTC
ATTGAGGGCCTGCTCAACGACCCGGATCCCACGCTGCGCTACGGCGGCATCCTGACGGTGGCGCTGGCGTATTGC
GGGACGGGCAGCAACAAGGCGATTCGCAAGCTGCTGCACACAGCCGTCAGCGACGTGAATGACGACGTGCGGCGC
ATCGCCGTCATGAGCCTGGGCTTTATTCTCTTTCGCCGCCCCAGCAGCGTGCCGCGCATGGTGGAGCTGCTGTCC
GAGTCGTACAATCCCCATGTGCGCTACGGCTCGGCCATGGCGCTGGGCATCTCGTGTGCCGGCACCGGGCTGGAC
GAGGCCATTGACCTGCTGGAGCCCATGATGAAGGATCCCACCGACTTTGTCCGCCAGGGCGCCCTCATTGCCCTG
TCCATGATTATGGTGCAGCAGAATGAGGCCATGAACCCCAAGGTGGCGTCGATTCGCAAGACGCTCAAGCGCGTC
GTGGGCGATCGCCACGAGGACGCCATGACCAAGTTTGGCGCCGCCATTGCCCTGGGCATCATTGATGCCGGCGGC
CGCAACTGCACCATTGGCCTGCAGACCCAGACGGGCAATCTCAACATGGCTGGCATTGTCGGCATGGCCGTCTTT
ACCCAGTACTGGTACTGGTTCCCCTTTACGCACTTTTTGTGCCTGAGCTTCTCGCCCACGGCCATTATTGGCCTC
GACCACGACTTGGACATTCCCGACTTTAAGTTTTACTGCGCCGCCCGCCAGAGCCTCTTTGACTATCCGCCCGAG
CAAGAAGTCAAGGCCGAGGAAGGCCCCACGGTTGTCGCGGCTGCCATTTTGTCCACGACGGCCCAGGCGAAGCGC
AGGGCGCAAAAGAAGGAGCGCGCGCAGCGCCGCGAGAGCATGGACCTGGACACTGTACCGCCGGCGGCCAAGAGC
GCGGGCGGCGACAACAAGGCGGGCGGCGACAAGATGGACATTGACGACGAGGGCAAGAAGAAGGACGAGGCCAAG
GACAAGGAGGCGGCCACGAGCGACACCAAGACGAGCAAGAAGCCGGAAAAGGAAAAGATTGGCTTTGAGATTGGA
AACATGAGCCGCGTGCTGCCCAGCCAACTCCGCTATATAAGCCTGCCGTCGGGCCGCTACAAGCCCGTCAAAAAG
CCAACCGGCGGCCCTCTGCTCCTCACCGACTCGCAGCCCGACGAGCCCAAGGCGCTGCTGGAGGAGAAGCTCAAA
AAGGTGACGACGGAGCGCGCCCCCGTGGCGGGACAGAGCGGCCACCGCGCCCAAGTGGTGAGCCGCTCAGGCGAC
CGCAGCCTTTTGGATAGCCTCATGGAGCAGTCGGGGCGAGGCGGCGGCGCCGCGGCGGCCGTGGACAGGATTCTG
CGCAGCCAGATTCGGCCGGGCGAGGGGGCCGGAGGCCAGCAGCACCAGCAGCACCAGCAGCAGCGCCAGGGACGG
CGGGGCGCGCAGGATGGATCGCGGGGCGGCGGGGCGGCGGCGGCGGCGGCAGAGGCGGATGATGCGGCGGCCGTG
GCGGCGGTGCTGACGGCGCTGGACGAGGGCGATGACGAGGCGCCGGTGCCGACAGACTTTGACTATTATTCCGAC
GACGAGGGCGAGGGCAGCAGCAATGAGGCCAAGTAG
Transcript >OphauB2|8039
ATGCCTGGACTGGTATCCGCTACGGGCGTGCTCGCCTTCCTTGCTGACGAAGAAGCCGAGCTCAAGGTGTTTGCT
CTGCAAACGCTCAATGATGATATTGACACGGTCTGGACAGAGGTGGCGGACAGCTTGAATCAACTCGAGGCCCTC
TATGAAGACGACTCTTTTCCGGAGCGCCAGCTTGTCGCCTTGGTCCTCGCCAAAGTTTACTATCACCTCCAGGCG
TATAATGACAGCATGGTGTTTGCCCTGGCCGCCGGCGACTTGTTCAAGCTTGACGCGCCCGGAGAGTTTGAGGAG
ACGATTATATCAAAGTGTGTTGACCAGTACATTGCCTCGTCGGCCTCGAAGCACATCAAGCCCAATCCGGCCTCC
AACTCGGAGCTCCCCGAGCTCACTACTACCTTCTCCCACGCCTCGGATGGCGCTCTTATGTCTCCGACGACGCCC
TTTTCCCATACAACCCTACCTCCCAAGTCGCTGCTGTCGCGCGCGTCGCTCGATAACACGATAATCGATGCTACC
TTTCAGCCTGTGCTCAAGCAGGGCCGCTCGGGTTCCGTGGCCCAGCTGCTGCCGGATCAAGCAACCGAGGCCTCG
CTGCAGCGCGTCATTGACCGTCTGTTTGAGAGCGCTCTTAAGCAGGGCCGCTATCGCCAGGTGGTGGGCATCGCC
GTCGAGGCCAAAAACTTGGAGGTGTTGCGACGCGTCATCAAGCGCGCAAGCGATGACGAGAAGCGCGCCAAGTCG
TCGTGTAGGATACAGGACGGTCTTCCTGGTCCAGCCGAGGAGCTCATGGAGTACATGCTGGGCATTTGTATGGAT
ATTGTCCAGGAACGGAGCTTCCGCACTGAGATTCTGCGCCTCATTCTCGACTTGCTCAGCGATATTCCCCACCCC
GACTATTTTGCCATTGCAAGATGTGTCGTTTACCTCAATGCCGATGACGAGGCGTCGCGCATGCTGCGATGTCTA
GTAGACAAGGGGGAACGCACGTCGCTGGCCAGTGCCTATCAAATTGCCTTTGACTTGTACGACAATGGCACACAG
GAATTCCTGGGAAAGGTGCTGGCGTCGCTGCCGTCGGGAAAGCAGGTTGAGAAGAAGGAGTCGGGCGAGGAGGCG
CCGCAAGAAGAGCAGAGCCTGCTGGCAAACCAGCAAGACGGGGACGAGGAGAGGCTTCCAGAGAGGGAGGCCAAA
GCATGGCGCAACATTGGCTCCATTCTCGACGGCTCCAAGACGATTCGACTCAACCTGGAATTCTTGTACCGCAAT
AACCACACAGATCTCAGCATTCTCAACAAGGTGCGCGACAGCCTAGAGGGCCGCAACTCCATCTTCCACACGGCA
GTGACGTTTTGCAATGGCTTCATGAACCAAGGCACGACGAATGACAAGTTTTTCCGCGACAACCTCGAGTGGCTG
GGCAAGGCTGTGAACTGGTCTAAGTTTTCAGCCACAGCTGCCCTGGGAGTCATTCACCGCGGCAATCTGTCGCAG
TCGCGCAAGCTGCTGGAGCCGTATCTGCCAAAGCCCGGGGCTGTTGGCACGGGGTCCGTGTTTAGCCAGGGCGGC
GCCCTGTATGCCTATGGCCTGATTCACGCCAATCACGGGGCGGATGCGCTCGACTACCTCAAGGCCCAGTTTGGG
CAGACCAAGGACGATGTGGTGCAGCACGGCGGGGCGCTGGGGCTGGGGATTGCGGGCATGGCGACGGGCGACGGC
GACTTGTTTGAGAAGCTCAAGAGAGTCTTGTTTGAGGACAAGGCGCTCAATGGCGAGGCAGTTGGGCTGTCCATG
GGCCTCATCATGCTGGGCACGGGCAACGTCAAGGCGCTCGAGGACATGATTACGTATGCGCACGAGACGACGCAC
GAGAAGATTGTGCGCGGGGTGGCGATTGGCATGGCGCTCATCATGTATGGGCGACAAGAGGGCGCCGACGTGCTC
ATTGAGGGCCTGCTCAACGACCCGGATCCCACGCTGCGCTACGGCGGCATCCTGACGGTGGCGCTGGCGTATTGC
GGGACGGGCAGCAACAAGGCGATTCGCAAGCTGCTGCACACAGCCGTCAGCGACGTGAATGACGACGTGCGGCGC
ATCGCCGTCATGAGCCTGGGCTTTATTCTCTTTCGCCGCCCCAGCAGCGTGCCGCGCATGGTGGAGCTGCTGTCC
GAGTCGTACAATCCCCATGTGCGCTACGGCTCGGCCATGGCGCTGGGCATCTCGTGTGCCGGCACCGGGCTGGAC
GAGGCCATTGACCTGCTGGAGCCCATGATGAAGGATCCCACCGACTTTGTCCGCCAGGGCGCCCTCATTGCCCTG
TCCATGATTATGGTGCAGCAGAATGAGGCCATGAACCCCAAGGTGGCGTCGATTCGCAAGACGCTCAAGCGCGTC
GTGGGCGATCGCCACGAGGACGCCATGACCAAGTTTGGCGCCGCCATTGCCCTGGGCATCATTGATGCCGGCGGC
CGCAACTGCACCATTGGCCTGCAGACCCAGACGGGCAATCTCAACATGGCTGGCATTGTCGGCATGGCCGTCTTT
ACCCAGTACTGGTACTGGTTCCCCTTTACGCACTTTTTGTGCCTGAGCTTCTCGCCCACGGCCATTATTGGCCTC
GACCACGACTTGGACATTCCCGACTTTAAGTTTTACTGCGCCGCCCGCCAGAGCCTCTTTGACTATCCGCCCGAG
CAAGAAGTCAAGGCCGAGGAAGGCCCCACGGTTGTCGCGGCTGCCATTTTGTCCACGACGGCCCAGGCGAAGCGC
AGGGCGCAAAAGAAGGAGCGCGCGCAGCGCCGCGAGAGCATGGACCTGGACACTGTACCGCCGGCGGCCAAGAGC
GCGGGCGGCGACAACAAGGCGGGCGGCGACAAGATGGACATTGACGACGAGGGCAAGAAGAAGGACGAGGCCAAG
GACAAGGAGGCGGCCACGAGCGACACCAAGACGAGCAAGAAGCCGGAAAAGGAAAAGATTGGCTTTGAGATTGGA
AACATGAGCCGCGTGCTGCCCAGCCAACTCCGCTATATAAGCCTGCCGTCGGGCCGCTACAAGCCCGTCAAAAAG
CCAACCGGCGGCCCTCTGCTCCTCACCGACTCGCAGCCCGACGAGCCCAAGGCGCTGCTGGAGGAGAAGCTCAAA
AAGGTGACGACGGAGCGCGCCCCCGTGGCGGGACAGAGCGGCCACCGCGCCCAAGTGGTGAGCCGCTCAGGCGAC
CGCAGCCTTTTGGATAGCCTCATGGAGCAGTCGGGGCGAGGCGGCGGCGCCGCGGCGGCCGTGGACAGGATTCTG
CGCAGCCAGATTCGGCCGGGCGAGGGGGCCGGAGGCCAGCAGCACCAGCAGCACCAGCAGCAGCGCCAGGGACGG
CGGGGCGCGCAGGATGGATCGCGGGGCGGCGGGGCGGCGGCGGCGGCGGCAGAGGCGGATGATGCGGCGGCCGTG
GCGGCGGTGCTGACGGCGCTGGACGAGGGCGATGACGAGGCGCCGGTGCCGACAGACTTTGACTATTATTCCGAC
GACGAGGGCGAGGGCAGCAGCAATGAGGCCAAGTAG
Gene >OphauB2|8039
ATGCCTGGACTGGTATCCGCTACGGGCGTGCTCGCCTTCCTTGCTGACGAAGAAGCCGAGCTCAAGGTGTTTGCT
CTGCAAACGCTCAATGATGATATTGACACGGTCTGGACAGAGGTGGCGGACAGCTTGAATCAACTGTGAGCCCAT
TGTCTCTTGGGCTGTCTGGCAGGACACAGCTGACTTGGAATTAGCGAGGCCCTCTATGAAGACGACTCTTTTCCG
GAGCGCCAGCTTGTCGCCTTGGTCCTCGCCAAAGTTTACTATCACCTCCAGGCGTATAATGACAGCATGGTGTTT
GCCCTGGCCGCCGGCGACTTGTTCAAGCTTGACGCGCCCGGAGAGTTTGAGGAGACGATTATATCAAAGTGTGTT
GACCAGTACATTGCCTCGTCGGCCTCGAAGCACATCAAGCCCAATCCGGCCTCCAACTCGGAGCTCCCCGAGCTC
ACTACTACCTTCTCCCACGCCTCGGATGGCGCTCTTATGTCTCCGACGACGCCCTTTTCCCATACAACCCTACCT
CCCAAGTCGCTGCTGTCGCGCGCGTCGCTCGATAACACGATAATCGATGCTACCTTTCAGCCTGTGCTCAAGCAG
GGCCGCTCGGGTTCCGTGGCCCAGCTGCTGCCGGATCAAGCAACCGAGGCCTCGCTGCAGCGCGTCATTGACCGT
CTGTTTGAGAGCGCTCTTAAGCAGGGCCGCTATCGCCAGGTGGTGGGCATCGCCGTCGAGGCCAAAAACTTGGAG
GTGTTGCGACGCGTCATCAAGCGCGCAAGCGATGACGAGAAGCGCGCCAAGTCGTCGTGTAGGATACAGGACGGT
CTTCCTGGTCCAGCCGAGGAGCTCATGGAGTACATGCTGGGCATTTGTATGGATATTGTCCAGGAACGGAGCTTC
CGCACTGAGATTCTGCGCCTCATTCTCGACTTGCTCAGCGATATTCCCCACCCCGACTATTTTGCCATTGCAAGA
TGTGTCGTTTACCTCAATGCCGATGACGAGGCGTCGCGCATGCTGCGATGTCTAGTAGACAAGGGGGAACGCACG
TCGCTGGCCAGTGCCTATCAAATTGCCTTTGACTTGTACGACAATGGCACACAGGAATTCCTGGGAAAGGTGCTG
GCGTCGCTGCCGTCGGGAAAGCAGGTTGAGAAGAAGGAGTCGGGCGAGGAGGCGCCGCAAGAAGAGCAGAGCCTG
CTGGCAAACCAGCAAGACGGGGACGAGGAGAGGCTTCCAGAGAGGGAGGCCAAAGCATGGCGCAACATTGGCTCC
ATTCTCGACGGCTCCAAGACGATTCGACTCAACCTGGAATTCTTGTACCGCAATAACCACACAGATCTCAGCATT
CTCAACAAGGTGCGCGACAGCCTAGAGGGCCGCAACTCCATCTTCCACACGGCAGTGACGTTTTGCAATGGCTTC
ATGAACCAAGGCACGACGAATGACAAGTTTTTCCGCGACAACCTCGAGTGGCTGGGCAAGGCTGTGAACTGGTCT
AAGTTTTCAGCCACAGCTGCCCTGGGAGTCATTCACCGCGGCAATCTGTCGCAGTCGCGCAAGCTGCTGGAGCCG
TATCTGCCAAAGCCCGGGGCTGTTGGCACGGGGTCCGTGTTTAGCCAGGGCGGCGCCCTGTATGCCTATGGCCTG
ATTCACGCCAATCACGGGGCGGATGCGCTCGACTACCTCAAGGCCCAGTTTGGGCAGACCAAGGACGATGTGGTG
CAGCACGGCGGGGCGCTGGGGCTGGGGATTGCGGGCATGGCGACGGGCGACGGCGACTTGTTTGAGAAGCTCAAG
AGAGTCTTGTTTGAGGACAAGGCGCTCAATGGCGAGGCAGTTGGGCTGTCCATGGGCCTCATCATGCTGGGCACG
GGCAACGTCAAGGCGCTCGAGGACATGATTACGTATGCGCACGAGACGACGCACGAGAAGATTGTGCGCGGGGTG
GCGATTGGCATGGCGCTCATCATGTATGGGCGACAAGAGGGCGCCGACGTGCTCATTGAGGGCCTGCTCAACGAC
CCGGATCCCACGCTGCGCTACGGCGGCATCCTGACGGTGGCGCTGGCGTATTGCGGGACGGGCAGCAACAAGGCG
ATTCGCAAGCTGCTGCACACAGCCGTCAGCGACGTGAATGACGACGTGCGGCGCATCGCCGTCATGAGCCTGGGC
TTTATTCTCTTTCGCCGCCCCAGCAGCGTGCCGCGCATGGTGGAGCTGCTGTCCGAGTCGTACAATCCCCATGTG
CGCTACGGCTCGGCCATGGCGCTGGGCATCTCGTGTGCCGGCACCGGGCTGGACGAGGCCATTGACCTGCTGGAG
CCCATGATGAAGGATCCCACCGACTTTGTCCGCCAGGGCGCCCTCATTGCCCTGTCCATGATTATGGTGCAGCAG
AATGAGGCCATGAACCCCAAGGTGGCGTCGATTCGCAAGACGCTCAAGCGCGTCGTGGGCGATCGCCACGAGGAC
GCCATGACCAAGTTTGGCGCCGCCATTGCCCTGGGCATCATTGATGCCGGCGGCCGCAACTGCACCATTGGCCTG
CAGACCCAGACGGGCAATCTCAACATGGCTGGCATTGTCGGCATGGCCGTCTTTACCCAGTACTGGTACTGGTTC
CCCTTTACGCACTTTTTGTGCCTGAGCTTCTCGCCCACGGCCATTATTGGCCTCGACCACGACTTGGACATTCCC
GACTTTAAGTTTTACTGCGCCGCCCGCCAGAGCCTCTTTGACTATCCGCCCGAGCAAGAAGTCAAGGCCGAGGAA
GGCCCCACGGTTGTCGCGGCTGCCATTTTGTCCACGACGGCCCAGGCGAAGCGCAGGGCGCAAAAGAAGGAGCGC
GCGCAGCGCCGCGAGAGCATGGACCTGGACACTGTACCGCCGGCGGCCAAGAGCGCGGGCGGCGACAACAAGGCG
GGCGGCGACAAGATGGACATTGACGACGAGGGCAAGAAGAAGGACGAGGCCAAGGACAAGGAGGCGGCCACGAGC
GACACCAAGACGAGCAAGAAGCCGGAAAAGGAAAAGATTGGCTTTGAGATTGGAAACATGAGCCGCGTGCTGCCC
AGCCAACTCCGCTATATAAGCCTGCCGTCGGGCCGCTACAAGCCCGTCAAAAAGGTGAGTCTTTTTTTCCCTCCT
CTTCTTTTTCCCCCCTCTGAGCTTGTCTCCTCTGCGGCGCCTCTGCTGACTCGCCCCAGCCAACCGGCGGCCCTC
TGCTCCTCACCGACTCGCAGCCCGACGAGCCCAAGGCGCTGCTGGAGGAGAAGCTCAAAAAGGTGACGACGGAGC
GCGCCCCCGTGGCGGGACAGAGCGGCCACCGCGCCCAAGTGGTGAGCCGCTCAGGCGACCGCAGCCTTTTGGATA
GCCTCATGGAGCAGTCGGGGCGAGGCGGCGGCGCCGCGGCGGCCGTGGACAGGATTCTGCGCAGCCAGATTCGGC
CGGGCGAGGGGGCCGGAGGCCAGCAGCACCAGCAGCACCAGCAGCAGCGCCAGGGACGGCGGGGCGCGCAGGATG
GATCGCGGGGCGGCGGGGCGGCGGCGGCGGCGGCAGAGGCGGATGATGCGGCGGCCGTGGCGGCGGTGCTGACGG
CGCTGGACGAGGGCGATGACGAGGCGCCGGTGCCGACAGACTTTGACTATTATTCCGACGACGAGGGCGAGGGCA
GCAGCAATGAGGCCAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail