Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8037
Gene name
LocationContig_95:13244..14595
Strand-
Gene length (bp)1351
Transcript length (bp)1224
Coding sequence length (bp)1224
Protein length (aa) 408

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06963 FPN1 Ferroportin1 (FPN1) 2.0E-99 30 395

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|F4KGN5|S40A2_ARATH Solute carrier family 40 member 2 OS=Arabidopsis thaliana GN=IREG2 PE=2 SV=1 32 397 9.0E-39
sp|Q5Z922|S40A1_ORYSJ Solute carrier family 40 member 1 OS=Oryza sativa subsp. japonica GN=Os06g0560000 PE=2 SV=1 27 395 5.0E-38
sp|O80905|S40A1_ARATH Solute carrier family 40 member 1 OS=Arabidopsis thaliana GN=IREG1 PE=3 SV=1 22 407 5.0E-37
sp|Q9JHI9|S40A1_MOUSE Solute carrier family 40 member 1 OS=Mus musculus GN=Slc40a1 PE=1 SV=1 32 351 8.0E-28
sp|Q9NP59|S40A1_HUMAN Solute carrier family 40 member 1 OS=Homo sapiens GN=SLC40A1 PE=1 SV=1 32 340 1.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|F4KGN5|S40A2_ARATH Solute carrier family 40 member 2 OS=Arabidopsis thaliana GN=IREG2 PE=2 SV=1 32 397 9.0E-39
sp|Q5Z922|S40A1_ORYSJ Solute carrier family 40 member 1 OS=Oryza sativa subsp. japonica GN=Os06g0560000 PE=2 SV=1 27 395 5.0E-38
sp|O80905|S40A1_ARATH Solute carrier family 40 member 1 OS=Arabidopsis thaliana GN=IREG1 PE=3 SV=1 22 407 5.0E-37
sp|Q9JHI9|S40A1_MOUSE Solute carrier family 40 member 1 OS=Mus musculus GN=Slc40a1 PE=1 SV=1 32 351 8.0E-28
sp|Q9NP59|S40A1_HUMAN Solute carrier family 40 member 1 OS=Homo sapiens GN=SLC40A1 PE=1 SV=1 32 340 1.0E-27
sp|Q923U9|S40A1_RAT Solute carrier family 40 member 1 OS=Rattus norvegicus GN=Slc40a1 PE=2 SV=2 32 351 4.0E-27
sp|Q9I9R3|S40A1_DANRE Solute carrier family 40 member 1 OS=Danio rerio GN=slc40a1 PE=2 SV=2 32 355 9.0E-24
sp|Q8W4E7|S40A3_ARATH Solute carrier family 40 member 3, chloroplastic OS=Arabidopsis thaliana GN=IREG3 PE=1 SV=1 54 394 9.0E-13
sp|Q2QNK7|S40A2_ORYSJ Solute carrier family 40 member 2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os12g0562100 PE=2 SV=1 26 187 9.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0005381 iron ion transmembrane transporter activity Yes
GO:0034755 iron ion transmembrane transport Yes
GO:0098655 cation transmembrane transport No
GO:0006811 ion transport No
GO:0008324 cation transmembrane transporter activity No
GO:0006826 iron ion transport No
GO:0005575 cellular_component No
GO:0000041 transition metal ion transport No
GO:0006812 cation transport No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0030001 metal ion transport No
GO:0046915 transition metal ion transmembrane transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0015075 ion transmembrane transporter activity No
GO:0051179 localization No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0098662 inorganic cation transmembrane transport No
GO:0005215 transporter activity No
GO:0055085 transmembrane transport No
GO:0009987 cellular process No
GO:0098660 inorganic ion transmembrane transport No
GO:0046873 metal ion transmembrane transporter activity No
GO:0034220 ion transmembrane transport No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 48 70 22
2 100 119 19
3 129 151 22
4 182 204 22
5 267 289 22
6 296 318 22
7 338 360 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8037
MSGHIPDESSPLFPQPAWALAQHVAPAIARRLYLSHFLSMWNSRVFEFGAVLYLAALFPGTLLPVSTYALMRGLS
AVVFASAVGEHVDHGQRLHVARGSIVGQRVAVAASCLVFYLLALELPRASAPRLAMLALVTLVACVEKLCSIINL
IAIERDWLVVVASDKPEALTALNAQMRRIDLLCKLFGPLFIALIESFSIRAAIITNFSINVVSIPVEYIAIARVY
HDVPALHEPYSNNQDGPRQHESPRTWQRPLCWLQTLIAHHKLYLHHGLFLPSFAAALLHLTVLSFGGQMTTYLLS
AGYSSIHVSIARTLSVLAEMAATWLAPWLMSGLGPLRAGLWLSSWQVTMLVAGVAVFCVFENTPLVSASGLVIGT
IVSRLGLRGFGLCVQFLIQQVRAVFTFSWCCC*
Coding >OphauB2|8037
ATGTCAGGCCACATCCCCGACGAATCCAGCCCTCTGTTTCCGCAACCCGCCTGGGCATTGGCACAACACGTCGCT
CCTGCAATTGCTCGCCGCCTCTACCTGTCGCATTTCTTGTCCATGTGGAATTCGCGCGTCTTTGAGTTTGGCGCC
GTCTTGTACCTGGCTGCCCTTTTCCCGGGCACGCTTTTGCCCGTTTCGACGTATGCGTTGATGCGTGGGCTGTCT
GCTGTAGTCTTTGCGTCGGCTGTAGGAGAGCATGTTGATCATGGGCAGAGGCTACACGTGGCTCGTGGGTCGATT
GTTGGGCAGCGAGTTGCCGTGGCCGCGTCGTGTCTCGTTTTTTACCTTTTAGCTCTAGAACTGCCTCGTGCCTCT
GCTCCAAGACTGGCCATGCTTGCTCTCGTCACTCTTGTTGCGTGTGTTGAAAAGCTGTGCTCCATCATCAACTTG
ATTGCCATTGAACGAGATTGGCTTGTAGTTGTAGCCAGCGACAAGCCCGAGGCATTAACCGCTCTAAACGCACAG
ATGCGCCGCATCGACTTGCTGTGTAAGCTATTCGGCCCCTTGTTCATTGCTTTGATCGAGTCCTTTTCCATCAGA
GCCGCCATCATTACCAATTTCTCCATCAATGTTGTCTCCATCCCCGTGGAATACATTGCCATTGCTCGAGTCTAC
CACGATGTACCTGCTCTTCATGAACCCTACTCAAACAACCAAGACGGCCCACGCCAACATGAATCACCGCGCACT
TGGCAGCGACCTCTTTGCTGGCTTCAAACCCTCATTGCTCACCACAAGCTTTACCTTCATCATGGTCTCTTCTTG
CCCTCCTTTGCAGCAGCGTTGCTCCATTTGACCGTGCTAAGTTTCGGAGGGCAAATGACAACCTATCTTCTTTCA
GCAGGCTACTCCTCGATACATGTCAGCATTGCAAGGACGCTGAGCGTCTTGGCCGAAATGGCTGCTACTTGGCTA
GCTCCTTGGCTCATGTCGGGCCTCGGTCCCCTTAGAGCAGGCCTCTGGCTGAGTAGCTGGCAAGTCACCATGCTA
GTTGCTGGAGTCGCCGTCTTTTGCGTCTTTGAGAACACGCCACTTGTTTCCGCATCTGGACTGGTTATTGGGACA
ATCGTGAGCCGTTTGGGACTCCGAGGCTTTGGCTTGTGTGTACAGTTTCTCATTCAGCAGGTAAGAGCTGTTTTT
ACTTTCTCATGGTGCTGTTGCTGA
Transcript >OphauB2|8037
ATGTCAGGCCACATCCCCGACGAATCCAGCCCTCTGTTTCCGCAACCCGCCTGGGCATTGGCACAACACGTCGCT
CCTGCAATTGCTCGCCGCCTCTACCTGTCGCATTTCTTGTCCATGTGGAATTCGCGCGTCTTTGAGTTTGGCGCC
GTCTTGTACCTGGCTGCCCTTTTCCCGGGCACGCTTTTGCCCGTTTCGACGTATGCGTTGATGCGTGGGCTGTCT
GCTGTAGTCTTTGCGTCGGCTGTAGGAGAGCATGTTGATCATGGGCAGAGGCTACACGTGGCTCGTGGGTCGATT
GTTGGGCAGCGAGTTGCCGTGGCCGCGTCGTGTCTCGTTTTTTACCTTTTAGCTCTAGAACTGCCTCGTGCCTCT
GCTCCAAGACTGGCCATGCTTGCTCTCGTCACTCTTGTTGCGTGTGTTGAAAAGCTGTGCTCCATCATCAACTTG
ATTGCCATTGAACGAGATTGGCTTGTAGTTGTAGCCAGCGACAAGCCCGAGGCATTAACCGCTCTAAACGCACAG
ATGCGCCGCATCGACTTGCTGTGTAAGCTATTCGGCCCCTTGTTCATTGCTTTGATCGAGTCCTTTTCCATCAGA
GCCGCCATCATTACCAATTTCTCCATCAATGTTGTCTCCATCCCCGTGGAATACATTGCCATTGCTCGAGTCTAC
CACGATGTACCTGCTCTTCATGAACCCTACTCAAACAACCAAGACGGCCCACGCCAACATGAATCACCGCGCACT
TGGCAGCGACCTCTTTGCTGGCTTCAAACCCTCATTGCTCACCACAAGCTTTACCTTCATCATGGTCTCTTCTTG
CCCTCCTTTGCAGCAGCGTTGCTCCATTTGACCGTGCTAAGTTTCGGAGGGCAAATGACAACCTATCTTCTTTCA
GCAGGCTACTCCTCGATACATGTCAGCATTGCAAGGACGCTGAGCGTCTTGGCCGAAATGGCTGCTACTTGGCTA
GCTCCTTGGCTCATGTCGGGCCTCGGTCCCCTTAGAGCAGGCCTCTGGCTGAGTAGCTGGCAAGTCACCATGCTA
GTTGCTGGAGTCGCCGTCTTTTGCGTCTTTGAGAACACGCCACTTGTTTCCGCATCTGGACTGGTTATTGGGACA
ATCGTGAGCCGTTTGGGACTCCGAGGCTTTGGCTTGTGTGTACAGTTTCTCATTCAGCAGGTAAGAGCTGTTTTT
ACTTTCTCATGGTGCTGTTGCTGA
Gene >OphauB2|8037
ATGTCAGGCCACATCCCCGACGAATCCAGCCCTCTGTTTCCGCAACCCGCCTGGGCATTGGCACAACACGTCGCT
CCTGCAATTGCTCGCCGCCTCTACCTGTCGCATTTCTTGTCCATGTGGAATTCGCGCGTCTTTGAGTTTGGCGCC
GTCTTGTACCTGGCTGCCCTTTTCCCGGGCACGCTTTTGCCCGTTTCGACGTATGCGTTGATGCGTGGGCTGTCT
GCTGTAGTCTTTGCGTCGGCTGTAGGAGAGCATGTTGATCATGGGCAGAGGCTACACGTGGCTCGTGGGTCGATT
GGTGAGTCGTCTCTGCTTATTGTGGCTTGCCGCCTTTCAAAGGGGGGTGCTCATGTCTGCTGCTGTGGCTAGTTG
GGCAGCGAGTTGCCGTGGCCGCGTCGTGTCTCGTTTTTTACCTTTTAGCTCTAGAACTGCCTCGTGCCTCTGCTC
CAAGACTGGCCATGCTTGCTCTCGTCACTCTTGTTGCGTGTGTTGAAAAGCTGTGCTCCATCATCAACTTGATTG
CCATTGAACGAGATTGGGCAAGTCTCCTCTTCACAACTCTATGTCAAGGGCATCCTGCTAACTTGAGCTGCAGCT
TGTAGTTGTAGCCAGCGACAAGCCCGAGGCATTAACCGCTCTAAACGCACAGATGCGCCGCATCGACTTGCTGTG
TAAGCTATTCGGCCCCTTGTTCATTGCTTTGATCGAGTCCTTTTCCATCAGAGCCGCCATCATTACCAATTTCTC
CATCAATGTTGTCTCCATCCCCGTGGAATACATTGCCATTGCTCGAGTCTACCACGATGTACCTGCTCTTCATGA
ACCCTACTCAAACAACCAAGACGGCCCACGCCAACATGAATCACCGCGCACTTGGCAGCGACCTCTTTGCTGGCT
TCAAACCCTCATTGCTCACCACAAGCTTTACCTTCATCATGGTCTCTTCTTGCCCTCCTTTGCAGCAGCGTTGCT
CCATTTGACCGTGCTAAGTTTCGGAGGGCAAATGACAACCTATCTTCTTTCAGCAGGCTACTCCTCGATACATGT
CAGCATTGCAAGGACGCTGAGCGTCTTGGCCGAAATGGCTGCTACTTGGCTAGCTCCTTGGCTCATGTCGGGCCT
CGGTCCCCTTAGAGCAGGCCTCTGGCTGAGTAGCTGGCAAGTCACCATGCTAGTTGCTGGAGTCGCCGTCTTTTG
CGTCTTTGAGAACACGCCACTTGTTTCCGCATCTGGACTGGTTATTGGGACAATCGTGAGCCGTTTGGGACTCCG
AGGCTTTGGCTTGTGTGTACAGTTTCTCATTCAGCAGGTAAGAGCTGTTTTTACTTTCTCATGGTGCTGTTGCTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail