Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8035
Gene name
LocationContig_95:56..1647
Strand-
Gene length (bp)1591
Transcript length (bp)1461
Coding sequence length (bp)1461
Protein length (aa) 487

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 4.1E-41 163 470
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 7.2E-29 165 468

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54RJ4|IKSA_DICDI Probable serine/threonine-protein kinase iksA OS=Dictyostelium discoideum GN=iksA PE=3 SV=1 157 470 4.0E-51
sp|P47042|IKS1_YEAST Probable serine/threonine-protein kinase IKS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IKS1 PE=1 SV=1 153 468 2.0E-46
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 155 470 2.0E-21
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 162 469 1.0E-20
sp|Q2MHE4|HT1_ARATH Serine/threonine-protein kinase HT1 OS=Arabidopsis thaliana GN=HT1 PE=1 SV=1 211 466 3.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54RJ4|IKSA_DICDI Probable serine/threonine-protein kinase iksA OS=Dictyostelium discoideum GN=iksA PE=3 SV=1 157 470 4.0E-51
sp|P47042|IKS1_YEAST Probable serine/threonine-protein kinase IKS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IKS1 PE=1 SV=1 153 468 2.0E-46
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 155 470 2.0E-21
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 162 469 1.0E-20
sp|Q2MHE4|HT1_ARATH Serine/threonine-protein kinase HT1 OS=Arabidopsis thaliana GN=HT1 PE=1 SV=1 211 466 3.0E-20
sp|Q03963|E2AK2_MOUSE Interferon-induced, double-stranded RNA-activated protein kinase OS=Mus musculus GN=Eif2ak2 PE=1 SV=2 155 400 3.0E-20
sp|Q63184|E2AK2_RAT Interferon-induced, double-stranded RNA-activated protein kinase OS=Rattus norvegicus GN=Eif2ak2 PE=1 SV=1 139 470 4.0E-20
sp|Q9QYZ4|SMOK1_MOUSE Sperm motility kinase 1 OS=Mus musculus GN=Smok1 PE=2 SV=1 168 470 1.0E-19
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 128 477 2.0E-19
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 128 477 2.0E-19
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 130 477 2.0E-19
sp|Q5ZJB4|IKKA_CHICK Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Gallus gallus GN=CHUK PE=2 SV=1 168 410 2.0E-19
sp|Q9QYZ6|SMK2A_MOUSE Sperm motility kinase 2A OS=Mus musculus GN=Smok2a PE=2 SV=1 142 470 2.0E-19
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 148 470 1.0E-18
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 138 470 2.0E-18
sp|P19525|E2AK2_HUMAN Interferon-induced, double-stranded RNA-activated protein kinase OS=Homo sapiens GN=EIF2AK2 PE=1 SV=2 148 470 3.0E-18
sp|Q6RET6|CCAMK_PEA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase (Fragment) OS=Pisum sativum GN=SYM9 PE=1 SV=2 207 470 4.0E-18
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 166 475 5.0E-18
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 148 468 5.0E-18
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 166 465 8.0E-18
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 166 465 9.0E-18
sp|O34507|PRKC_BACSU Serine/threonine-protein kinase PrkC OS=Bacillus subtilis (strain 168) GN=prkC PE=1 SV=1 166 474 3.0E-17
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 113 468 4.0E-17
sp|G5ECJ6|CSK1_CAEEL Tyrosine-protein kinase csk-1 OS=Caenorhabditis elegans GN=csk-1 PE=1 SV=1 182 467 4.0E-17
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 168 465 6.0E-17
sp|P25341|KIN82_YEAST Serine/threonine-protein kinase KIN82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN82 PE=1 SV=3 147 471 7.0E-17
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 106 473 8.0E-17
sp|Q07250|KCCS_MALDO Calcium/calmodulin-dependent serine/threonine-protein kinase OS=Malus domestica PE=2 SV=1 305 470 9.0E-17
sp|O15111|IKKA_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Homo sapiens GN=CHUK PE=1 SV=2 168 410 1.0E-16
sp|Q95KV1|IKKA_BOVIN Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Bos taurus GN=CHUK PE=1 SV=1 168 410 1.0E-16
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 112 470 1.0E-16
sp|F4JTP5|STY46_ARATH Serine/threonine-protein kinase STY46 OS=Arabidopsis thaliana GN=STY46 PE=1 SV=1 305 470 1.0E-16
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 155 465 2.0E-16
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 166 465 2.0E-16
sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK2 PE=1 SV=2 160 470 2.0E-16
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 166 475 3.0E-16
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 137 475 3.0E-16
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 167 465 3.0E-16
sp|Q6RET7|CCAMK_MEDTR Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3 OS=Medicago truncatula GN=DMI3 PE=2 SV=1 188 470 4.0E-16
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 167 416 4.0E-16
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 155 477 4.0E-16
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 155 477 4.0E-16
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 136 471 4.0E-16
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 166 465 5.0E-16
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 166 465 5.0E-16
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 113 473 7.0E-16
sp|P53739|FPK1_YEAST Flippase kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPK1 PE=1 SV=1 147 465 7.0E-16
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 166 465 7.0E-16
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 155 465 7.0E-16
sp|Q60680|IKKA_MOUSE Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Mus musculus GN=Chuk PE=1 SV=1 168 410 7.0E-16
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 188 465 8.0E-16
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 166 465 8.0E-16
sp|P50526|SSP1_SCHPO Serine/threonine-protein kinase ssp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp1 PE=1 SV=1 140 470 9.0E-16
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 166 465 1.0E-15
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 166 470 1.0E-15
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 166 473 1.0E-15
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 161 465 1.0E-15
sp|A0JLX3|SMK4A_MOUSE Sperm motility kinase 4A OS=Mus musculus GN=Smok4a PE=2 SV=2 168 470 1.0E-15
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 161 414 1.0E-15
sp|F4I1N8|ATG1T_ARATH Serine/threonine-protein kinase ATG1t OS=Arabidopsis thaliana GN=At1g49180 PE=2 SV=1 211 477 2.0E-15
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 162 470 2.0E-15
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 211 477 2.0E-15
sp|A0AAR7|CCAMK_LOTJA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lotus japonicus GN=CCAMK PE=1 SV=1 305 470 2.0E-15
sp|Q9EQY0|ERN1_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Mus musculus GN=Ern1 PE=1 SV=1 297 468 2.0E-15
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 166 465 2.0E-15
sp|Q93V58|GRIK1_ARATH Serine/threonine-protein kinase GRIK1 OS=Arabidopsis thaliana GN=GRIK1 PE=1 SV=1 162 465 2.0E-15
sp|P00541|FPS_AVISP Tyrosine-protein kinase transforming protein Fps OS=Avian sarcoma virus (strain PRCII) GN=V-FPS PE=3 SV=1 133 467 3.0E-15
sp|P54739|PKAA_STRCO Serine/threonine-protein kinase PkaA OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pkaA PE=3 SV=1 162 468 3.0E-15
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 166 471 3.0E-15
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 166 465 3.0E-15
sp|Q8RWL6|STY17_ARATH Serine/threonine-protein kinase STY17 OS=Arabidopsis thaliana GN=STY17 PE=1 SV=1 303 470 4.0E-15
sp|P51957|NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens GN=NEK4 PE=1 SV=2 166 468 4.0E-15
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 155 414 4.0E-15
sp|P42683|LCK_CHICK Proto-oncogene tyrosine-protein kinase LCK OS=Gallus gallus GN=LCK PE=2 SV=2 270 467 4.0E-15
sp|P42690|SRK4_SPOLA Tyrosine-protein kinase isoform SRK4 OS=Spongilla lacustris GN=SRK1 PE=2 SV=1 205 467 4.0E-15
sp|Q6CSX2|ATG1_KLULA Serine/threonine-protein kinase ATG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG1 PE=3 SV=1 165 470 4.0E-15
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 166 470 4.0E-15
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 166 465 4.0E-15
sp|O62305|KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans GN=unc-43 PE=1 SV=2 151 486 4.0E-15
sp|Q9CEF5|PKNB_LACLA Probable serine/threonine-protein kinase PknB OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pknB PE=3 SV=1 168 465 4.0E-15
sp|O01775|NEKL2_CAEEL Serine/threonine-protein kinase nekl-2 OS=Caenorhabditis elegans GN=nekl-2 PE=2 SV=1 166 414 4.0E-15
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 162 465 5.0E-15
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 166 465 5.0E-15
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 166 416 5.0E-15
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 165 465 5.0E-15
sp|P13234|KCC4_RAT Calcium/calmodulin-dependent protein kinase type IV OS=Rattus norvegicus GN=Camk4 PE=1 SV=3 158 465 5.0E-15
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 162 473 6.0E-15
sp|P09769|FGR_HUMAN Tyrosine-protein kinase Fgr OS=Homo sapiens GN=FGR PE=1 SV=2 291 467 6.0E-15
sp|P46551|CDK12_CAEEL Cyclin-dependent kinase 12 OS=Caenorhabditis elegans GN=cdk-12 PE=1 SV=4 126 471 6.0E-15
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 162 412 6.0E-15
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 162 412 7.0E-15
sp|A8WXF6|KCC2D_CAEBR Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis briggsae GN=unc-43 PE=3 SV=1 151 471 7.0E-15
sp|P14234|FGR_MOUSE Tyrosine-protein kinase Fgr OS=Mus musculus GN=Fgr PE=1 SV=2 310 467 7.0E-15
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 166 480 7.0E-15
sp|Q80ZW0|STK35_MOUSE Serine/threonine-protein kinase 35 OS=Mus musculus GN=Stk35 PE=1 SV=3 206 470 8.0E-15
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 155 469 9.0E-15
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 166 470 9.0E-15
sp|P00522|ABL_DROME Tyrosine-protein kinase Abl OS=Drosophila melanogaster GN=Abl PE=1 SV=3 177 466 1.0E-14
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 162 414 1.0E-14
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 166 414 1.0E-14
sp|P08414|KCC4_MOUSE Calcium/calmodulin-dependent protein kinase type IV OS=Mus musculus GN=Camk4 PE=1 SV=2 161 465 1.0E-14
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 167 470 1.0E-14
sp|P41239|CSK_CHICK Tyrosine-protein kinase CSK OS=Gallus gallus GN=CSK PE=2 SV=1 144 467 1.0E-14
sp|Q8TDR2|STK35_HUMAN Serine/threonine-protein kinase 35 OS=Homo sapiens GN=STK35 PE=1 SV=2 206 470 1.0E-14
sp|O22558|STY8_ARATH Serine/threonine-protein kinase STY8 OS=Arabidopsis thaliana GN=STY8 PE=1 SV=2 309 470 1.0E-14
sp|O75460|ERN1_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Homo sapiens GN=ERN1 PE=1 SV=2 297 468 2.0E-14
sp|Q16566|KCC4_HUMAN Calcium/calmodulin-dependent protein kinase type IV OS=Homo sapiens GN=CAMK4 PE=1 SV=1 156 465 2.0E-14
sp|A7J1T0|M313B_XENLA Mitogen-activated protein kinase kinase kinase 13-B OS=Xenopus laevis GN=map3k13-b PE=2 SV=1 164 415 2.0E-14
sp|Q8BG48|ST17B_MOUSE Serine/threonine-protein kinase 17B OS=Mus musculus GN=Stk17b PE=1 SV=1 292 480 2.0E-14
sp|P00530|FPS_FUJSV Tyrosine-protein kinase transforming protein Fps OS=Fujinami sarcoma virus GN=V-FPS PE=3 SV=1 133 467 2.0E-14
sp|Q9GM70|ST17A_RABIT Serine/threonine-protein kinase 17A OS=Oryctolagus cuniculus GN=STK17A PE=2 SV=1 301 470 2.0E-14
sp|P06241|FYN_HUMAN Tyrosine-protein kinase Fyn OS=Homo sapiens GN=FYN PE=1 SV=3 206 467 2.0E-14
sp|Q8C0N0|SMKZ_MOUSE Sperm motility kinase Z OS=Mus musculus GN=Gm4922 PE=2 SV=1 151 470 2.0E-14
sp|Q62844|FYN_RAT Tyrosine-protein kinase Fyn OS=Rattus norvegicus GN=Fyn PE=1 SV=1 206 467 2.0E-14
sp|P43637|TOS3_YEAST Serine/threonine-protein kinase TOS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOS3 PE=1 SV=1 211 417 2.0E-14
sp|A0JNB0|FYN_BOVIN Tyrosine-protein kinase Fyn OS=Bos taurus GN=FYN PE=2 SV=1 206 467 2.0E-14
sp|A1Y2K1|FYN_PIG Tyrosine-protein kinase Fyn OS=Sus scrofa GN=FYN PE=2 SV=2 206 467 2.0E-14
sp|A6ZU08|TOS3_YEAS7 Serine/threonine-protein kinase TOS3 OS=Saccharomyces cerevisiae (strain YJM789) GN=TOS3 PE=3 SV=1 211 417 2.0E-14
sp|Q91XS8|ST17B_RAT Serine/threonine-protein kinase 17B OS=Rattus norvegicus GN=Stk17b PE=1 SV=1 292 480 2.0E-14
sp|P00521|ABL_MLVAB Tyrosine-protein kinase transforming protein Abl OS=Abelson murine leukemia virus GN=ABL PE=3 SV=1 177 470 2.0E-14
sp|P10447|ABL_FSVHY Tyrosine-protein kinase transforming protein Abl OS=Feline sarcoma virus (strain Hardy-Zuckerman 2) GN=ABL PE=2 SV=1 205 470 2.0E-14
sp|P00544|FGR_FSVGR Tyrosine-protein kinase transforming protein Fgr OS=Feline sarcoma virus (strain Gardner-Rasheed) GN=V-FGR PE=3 SV=1 298 466 2.0E-14
sp|Q6GM53|IKKA_XENLA Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Xenopus laevis GN=chuk PE=2 SV=1 168 410 2.0E-14
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 158 470 2.0E-14
sp|Q9Z1J2|NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus GN=Nek4 PE=1 SV=1 166 468 2.0E-14
sp|Q61UC4|KRAF1_CAEBR Raf homolog serine/threonine-protein kinase OS=Caenorhabditis briggsae GN=lin-45 PE=3 SV=2 162 470 2.0E-14
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 167 465 3.0E-14
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 165 423 3.0E-14
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 161 484 3.0E-14
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 161 484 3.0E-14
sp|A2KF29|SMKTR_MOUSE Sperm motility kinase Tcr mutant form OS=Mus musculus GN=Smoktcr PE=2 SV=1 168 470 3.0E-14
sp|Q9U1Y5|CHK2_CAEEL Serine/threonine-protein kinase chk-2 OS=Caenorhabditis elegans GN=chk-2 PE=2 SV=2 161 470 3.0E-14
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 165 423 3.0E-14
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 166 470 3.0E-14
sp|P27446|FYN_XIPHE Tyrosine-protein kinase Fyn OS=Xiphophorus helleri GN=fyn PE=2 SV=3 206 467 3.0E-14
sp|Q07292|KRAF1_CAEEL Raf homolog serine/threonine-protein kinase OS=Caenorhabditis elegans GN=lin-45 PE=1 SV=2 162 470 3.0E-14
sp|Q6EWH2|FYNA_DANRE Tyrosine-protein kinase fyna OS=Danio rerio GN=fyna PE=1 SV=2 298 467 3.0E-14
sp|Q6BS08|ATG1_DEBHA Serine/threonine-protein kinase ATG1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG1 PE=3 SV=2 205 470 3.0E-14
sp|Q6P6U0|FGR_RAT Tyrosine-protein kinase Fgr OS=Rattus norvegicus GN=Fgr PE=1 SV=1 297 467 4.0E-14
sp|Q43531|CCAMK_LILLO Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lilium longiflorum GN=CCAMK PE=1 SV=1 188 470 4.0E-14
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 161 420 4.0E-14
sp|Q5Q0U5|SGK1_FUNHE Serine/threonine-protein kinase Sgk1 OS=Fundulus heteroclitus GN=sgk1 PE=2 SV=1 166 415 4.0E-14
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 165 423 4.0E-14
sp|P00519|ABL1_HUMAN Tyrosine-protein kinase ABL1 OS=Homo sapiens GN=ABL1 PE=1 SV=4 177 470 4.0E-14
sp|Q6DGS3|KC2D2_DANRE Calcium/calmodulin-dependent protein kinase type II delta 2 chain OS=Danio rerio GN=camk2d2 PE=2 SV=2 293 486 4.0E-14
sp|Q4G3H4|IKKA_DANRE Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Danio rerio GN=chuk PE=1 SV=1 148 410 4.0E-14
sp|O94768|ST17B_HUMAN Serine/threonine-protein kinase 17B OS=Homo sapiens GN=STK17B PE=1 SV=1 292 468 4.0E-14
sp|P00520|ABL1_MOUSE Tyrosine-protein kinase ABL1 OS=Mus musculus GN=Abl1 PE=1 SV=3 177 470 4.0E-14
sp|Q1LX51|WEE2_DANRE Wee1-like protein kinase 2 OS=Danio rerio GN=wee2 PE=2 SV=2 158 469 4.0E-14
sp|Q1HKZ5|M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus GN=Map3k13 PE=1 SV=1 164 415 4.0E-14
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 166 465 5.0E-14
sp|Q5ZKI0|KCC2D_CHICK Calcium/calmodulin-dependent protein kinase type II delta chain OS=Gallus gallus GN=CAMK2D PE=2 SV=1 293 486 5.0E-14
sp|Q5R8X7|M3K13_PONAB Mitogen-activated protein kinase kinase kinase 13 OS=Pongo abelii GN=MAP3K13 PE=2 SV=1 164 415 5.0E-14
sp|Q6GPN6|SGK1A_XENLA Serine/threonine-protein kinase Sgk1-A OS=Xenopus laevis GN=sgk1-a PE=2 SV=1 166 415 5.0E-14
sp|Q6AVM3|CCAMK_ORYSJ Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Oryza sativa subsp. japonica GN=CCAMK PE=2 SV=1 220 470 5.0E-14
sp|P38070|YPK3_YEAST AGC kinase YPK3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK3 PE=1 SV=1 166 414 5.0E-14
sp|O43283|M3K13_HUMAN Mitogen-activated protein kinase kinase kinase 13 OS=Homo sapiens GN=MAP3K13 PE=1 SV=1 164 415 6.0E-14
sp|P0CP71|ATG1_CRYNB Serine/threonine-protein kinase ATG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATG1 PE=3 SV=1 205 477 6.0E-14
sp|A7MBB4|M3K13_BOVIN Mitogen-activated protein kinase kinase kinase 13 OS=Bos taurus GN=MAP3K13 PE=2 SV=1 164 415 7.0E-14
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 165 465 7.0E-14
sp|P42686|SRK1_SPOLA Tyrosine-protein kinase isoform SRK1 OS=Spongilla lacustris GN=SRK1 PE=2 SV=1 298 467 7.0E-14
sp|Q8NG66|NEK11_HUMAN Serine/threonine-protein kinase Nek11 OS=Homo sapiens GN=NEK11 PE=1 SV=2 151 470 7.0E-14
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 166 416 7.0E-14
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 165 465 8.0E-14
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 165 465 8.0E-14
sp|P08103|HCK_MOUSE Tyrosine-protein kinase HCK OS=Mus musculus GN=Hck PE=1 SV=4 310 467 9.0E-14
sp|P0CP70|ATG1_CRYNJ Serine/threonine-protein kinase ATG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATG1 PE=3 SV=1 205 477 9.0E-14
sp|Q5BKK4|SGK1_XENTR Serine/threonine-protein kinase Sgk1 OS=Xenopus tropicalis GN=sgk1 PE=2 SV=1 166 415 9.0E-14
sp|Q4JIM5|ABL2_MOUSE Abelson tyrosine-protein kinase 2 OS=Mus musculus GN=Abl2 PE=1 SV=1 200 470 9.0E-14
sp|P42684|ABL2_HUMAN Abelson tyrosine-protein kinase 2 OS=Homo sapiens GN=ABL2 PE=1 SV=1 177 470 9.0E-14
sp|P39688|FYN_MOUSE Tyrosine-protein kinase Fyn OS=Mus musculus GN=Fyn PE=1 SV=4 206 467 9.0E-14
sp|P41240|CSK_HUMAN Tyrosine-protein kinase CSK OS=Homo sapiens GN=CSK PE=1 SV=1 144 467 1.0E-13
sp|P50545|HCK_RAT Tyrosine-protein kinase HCK OS=Rattus norvegicus GN=Hck PE=1 SV=4 310 467 1.0E-13
sp|P41241|CSK_MOUSE Tyrosine-protein kinase CSK OS=Mus musculus GN=Csk PE=1 SV=2 144 467 1.0E-13
sp|Q9QY78|IKKB_RAT Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Rattus norvegicus GN=Ikbkb PE=1 SV=1 168 410 1.0E-13
sp|Q6U1I9|SGK1_CHICK Serine/threonine-protein kinase Sgk1 OS=Gallus gallus GN=SGK1 PE=2 SV=1 166 470 1.0E-13
sp|F1RDG9|FYNB_DANRE Tyrosine-protein kinase fynb OS=Danio rerio GN=fynb PE=2 SV=1 298 467 1.0E-13
sp|Q4R633|SGK1_MACFA Serine/threonine-protein kinase Sgk1 OS=Macaca fascicularis GN=SGK1 PE=2 SV=1 166 415 1.0E-13
sp|Q2HJF7|KCC2D_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Bos taurus GN=CAMK2D PE=2 SV=1 293 486 1.0E-13
sp|O00141|SGK1_HUMAN Serine/threonine-protein kinase Sgk1 OS=Homo sapiens GN=SGK1 PE=1 SV=2 166 415 1.0E-13
sp|Q95266|KCC2D_PIG Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Sus scrofa GN=CAMK2D PE=2 SV=1 293 486 1.0E-13
sp|Q6PHZ2|KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus GN=Camk2d PE=1 SV=1 293 486 1.0E-13
sp|Q13557|KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens GN=CAMK2D PE=1 SV=3 293 486 1.0E-13
sp|Q5HZ38|GRIK2_ARATH Serine/threonine-protein kinase GRIK2 OS=Arabidopsis thaliana GN=GRIK2 PE=1 SV=1 168 465 1.0E-13
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 166 414 1.0E-13
sp|P15791|KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus GN=Camk2d PE=1 SV=1 293 486 1.0E-13
sp|Q28DZ1|IKKA_XENTR Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Xenopus tropicalis GN=chuk PE=2 SV=1 168 410 1.0E-13
sp|P39009|DUN1_YEAST DNA damage response protein kinase DUN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUN1 PE=1 SV=1 134 471 1.0E-13
sp|O61267|LOK_DROME Ovarian-specific serine/threonine-protein kinase Lok OS=Drosophila melanogaster GN=lok PE=2 SV=1 160 470 1.0E-13
sp|P05625|RAF1_CHICK RAF proto-oncogene serine/threonine-protein kinase OS=Gallus gallus GN=RAF1 PE=2 SV=1 85 414 1.0E-13
sp|P13406|FYN_XENLA Tyrosine-protein kinase Fyn OS=Xenopus laevis GN=fyn PE=2 SV=3 206 467 1.0E-13
sp|Q05876|FYN_CHICK Tyrosine-protein kinase Fyn OS=Gallus gallus GN=FYN PE=1 SV=2 298 467 1.0E-13
sp|Q8S8S7|PUB34_ARATH U-box domain-containing protein 34 OS=Arabidopsis thaliana GN=PUB34 PE=3 SV=1 140 476 2.0E-13
sp|P32577|CSK_RAT Tyrosine-protein kinase CSK OS=Rattus norvegicus GN=Csk PE=1 SV=1 144 467 2.0E-13
sp|A8XJW8|CST1_CAEBR Serine/threonine-protein kinase cst-1 OS=Caenorhabditis briggsae GN=cst-1 PE=3 SV=2 168 410 2.0E-13
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 202 417 2.0E-13
sp|Q8WMV0|GRK7_BOVIN G protein-coupled receptor kinase 7 OS=Bos taurus GN=GRK7 PE=1 SV=1 154 411 2.0E-13
sp|Q0VBZ0|CSK_BOVIN Tyrosine-protein kinase CSK OS=Bos taurus GN=CSK PE=2 SV=1 144 467 2.0E-13
sp|Q95KR7|LCK_SAISC Proto-oncogene tyrosine-protein kinase LCK OS=Saimiri sciureus GN=LCK PE=1 SV=3 287 467 2.0E-13
sp|Q75H77|SAPKA_ORYSJ Serine/threonine-protein kinase SAPK10 OS=Oryza sativa subsp. japonica GN=SAPK10 PE=2 SV=1 166 470 2.0E-13
sp|Q9SMQ4|SRK2F_ARATH Serine/threonine-protein kinase SRK2F OS=Arabidopsis thaliana GN=SRK2F PE=1 SV=1 166 470 2.0E-13
sp|Q5A649|ATG1_CANAL Serine/threonine-protein kinase ATG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG1 PE=3 SV=1 172 470 2.0E-13
sp|O14920|IKKB_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Homo sapiens GN=IKBKB PE=1 SV=1 168 410 2.0E-13
sp|Q9Z265|CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus GN=Chek2 PE=1 SV=1 162 471 2.0E-13
sp|A7J1T2|M313A_XENLA Mitogen-activated protein kinase kinase kinase 13-A OS=Xenopus laevis GN=map3k13-a PE=2 SV=1 164 415 2.0E-13
sp|Q9DG02|KCC2D_XENLA Calcium/calmodulin-dependent protein kinase type II delta chain OS=Xenopus laevis GN=camk2d PE=2 SV=1 293 486 2.0E-13
sp|Q8WNU8|NEK11_MACFA Serine/threonine-protein kinase Nek11 OS=Macaca fascicularis GN=NEK11 PE=2 SV=1 151 470 2.0E-13
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 166 414 3.0E-13
sp|Q61772|EPHA7_MOUSE Ephrin type-A receptor 7 OS=Mus musculus GN=Epha7 PE=1 SV=2 153 466 3.0E-13
sp|Q6NU47|PDK1A_XENLA Serine/threonine-protein kinase pdik1l-A OS=Xenopus laevis GN=pdik1-a PE=2 SV=1 239 468 3.0E-13
sp|Q9NB31|CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans GN=cst-1 PE=1 SV=1 168 410 3.0E-13
sp|P31152|MK04_HUMAN Mitogen-activated protein kinase 4 OS=Homo sapiens GN=MAPK4 PE=1 SV=2 162 471 3.0E-13
sp|Q9Z2G7|GRK7_ICTTR G protein-coupled receptor kinase 7 OS=Ictidomys tridecemlineatus GN=GRK7 PE=1 SV=1 154 439 3.0E-13
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 167 410 3.0E-13
sp|Q8RXT4|NEK4_ARATH Serine/threonine-protein kinase Nek4 OS=Arabidopsis thaliana GN=NEK4 PE=2 SV=1 168 470 3.0E-13
sp|Q81WH6|PRKC_BACAN Serine/threonine-protein kinase PrkC OS=Bacillus anthracis GN=prkC PE=1 SV=1 166 465 3.0E-13
sp|Q95KV0|IKKB_BOVIN Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Bos taurus GN=IKBKB PE=2 SV=1 168 410 3.0E-13
sp|A7MB74|SGK1_BOVIN Serine/threonine-protein kinase Sgk1 OS=Bos taurus GN=SGK1 PE=2 SV=1 166 415 3.0E-13
sp|Q06226|SGK1_RAT Serine/threonine-protein kinase Sgk1 OS=Rattus norvegicus GN=Sgk1 PE=1 SV=1 166 415 3.0E-13
sp|Q7RAV5|CDPK3_PLAYO Calcium-dependent protein kinase 3 OS=Plasmodium yoelii yoelii GN=CPK3 PE=3 SV=1 211 471 3.0E-13
sp|Q7ZTW4|SGK1_DANRE Serine/threonine-protein kinase Sgk1 OS=Danio rerio GN=sgk1 PE=2 SV=1 166 415 3.0E-13
sp|Q6PA14|STK4_XENLA Serine/threonine-protein kinase 4 OS=Xenopus laevis GN=stk4 PE=2 SV=1 168 410 3.0E-13
sp|P53667|LIMK1_HUMAN LIM domain kinase 1 OS=Homo sapiens GN=LIMK1 PE=1 SV=3 104 467 3.0E-13
sp|P00531|MIL_AVIMH Serine/threonine-protein kinase-transforming protein mil OS=Avian retrovirus MH2 GN=V-MIL PE=3 SV=1 110 414 3.0E-13
sp|Q9XT18|SGK1_RABIT Serine/threonine-protein kinase Sgk1 OS=Oryctolagus cuniculus GN=SGK1 PE=2 SV=1 166 415 4.0E-13
sp|O77708|KCC2D_RABIT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Oryctolagus cuniculus GN=CAMK2D PE=2 SV=2 293 471 4.0E-13
sp|Q02977|YRK_CHICK Proto-oncogene tyrosine-protein kinase Yrk OS=Gallus gallus GN=YRK PE=2 SV=2 298 467 4.0E-13
sp|Q6NU98|PDK1B_XENLA Serine/threonine-protein kinase pdik1l-B OS=Xenopus laevis GN=pdik1-b PE=2 SV=1 239 468 4.0E-13
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 173 477 4.0E-13
sp|P06239|LCK_HUMAN Tyrosine-protein kinase Lck OS=Homo sapiens GN=LCK PE=1 SV=6 287 467 4.0E-13
sp|Q75CH3|ATG1_ASHGO Serine/threonine-protein kinase ATG1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG1 PE=3 SV=1 162 470 4.0E-13
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 127 470 4.0E-13
sp|Q9JI10|STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus GN=Stk3 PE=1 SV=1 138 410 4.0E-13
sp|Q9UEE5|ST17A_HUMAN Serine/threonine-protein kinase 17A OS=Homo sapiens GN=STK17A PE=1 SV=2 301 470 5.0E-13
sp|Q1XHL7|GRK7B_DANRE G protein-coupled receptor kinase 7B OS=Danio rerio GN=grk7b PE=1 SV=2 143 444 5.0E-13
sp|Q6GLY8|SGK1B_XENLA Serine/threonine-protein kinase Sgk1-B OS=Xenopus laevis GN=sgk1-b PE=2 SV=1 166 415 5.0E-13
sp|Q9WVC6|SGK1_MOUSE Serine/threonine-protein kinase Sgk1 OS=Mus musculus GN=Sgk1 PE=1 SV=1 166 415 5.0E-13
sp|Q802A6|STK4_SQUAC Serine/threonine-protein kinase 3/4 OS=Squalus acanthias GN=STK4 PE=2 SV=1 168 410 5.0E-13
sp|Q01621|LCK_RAT Proto-oncogene tyrosine-protein kinase LCK OS=Rattus norvegicus GN=Lck PE=1 SV=3 206 467 5.0E-13
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 161 414 5.0E-13
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 161 414 6.0E-13
sp|O42422|EPHA7_CHICK Ephrin type-A receptor 7 OS=Gallus gallus GN=EPHA7 PE=2 SV=1 153 458 6.0E-13
sp|Q12706|PSK1_SCHPO Serine/threonine-protein kinase psk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psk1 PE=3 SV=1 167 473 6.0E-13
sp|P10936|YES_XENLA Tyrosine-protein kinase Yes OS=Xenopus laevis GN=yes1 PE=2 SV=3 288 467 6.0E-13
sp|A4K2M3|STK4_PAPAN Serine/threonine-protein kinase 4 OS=Papio anubis GN=STK4 PE=3 SV=1 168 410 6.0E-13
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 167 410 6.0E-13
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 161 465 6.0E-13
sp|Q8IWQ3|BRSK2_HUMAN Serine/threonine-protein kinase BRSK2 OS=Homo sapiens GN=BRSK2 PE=1 SV=3 165 465 6.0E-13
sp|O88351|IKKB_MOUSE Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Mus musculus GN=Ikbkb PE=1 SV=1 168 410 6.0E-13
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 164 470 6.0E-13
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 166 416 6.0E-13
sp|Q8GVC7|PKZ1_PHYIN Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans GN=PKZ1 PE=1 SV=1 108 470 7.0E-13
sp|Q4P0K0|ATG1_USTMA Serine/threonine-protein kinase ATG1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATG1 PE=2 SV=1 205 440 7.0E-13
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 160 410 7.0E-13
sp|A6QGC0|PRKC_STAAE Serine/threonine-protein kinase PrkC OS=Staphylococcus aureus (strain Newman) GN=prkC PE=1 SV=1 168 465 7.0E-13
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 158 470 7.0E-13
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 160 410 7.0E-13
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 160 410 7.0E-13
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 168 410 8.0E-13
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 142 410 8.0E-13
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 168 410 8.0E-13
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 168 410 8.0E-13
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 168 410 8.0E-13
sp|P08631|HCK_HUMAN Tyrosine-protein kinase HCK OS=Homo sapiens GN=HCK PE=1 SV=5 310 467 8.0E-13
sp|Q7ZUQ3|STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio GN=stk3 PE=2 SV=1 160 410 8.0E-13
sp|P05480|SRC_MOUSE Neuronal proto-oncogene tyrosine-protein kinase Src OS=Mus musculus GN=Src PE=1 SV=4 206 467 9.0E-13
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 142 410 9.0E-13
sp|A8WRV1|KIN29_CAEBR Serine/threonine-protein kinase kin-29 OS=Caenorhabditis briggsae GN=kin-29 PE=3 SV=2 166 465 9.0E-13
sp|Q10GB1|NEK1_ORYSJ Serine/threonine-protein kinase Nek1 OS=Oryza sativa subsp. japonica GN=NEK1 PE=3 SV=1 168 470 9.0E-13
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 142 410 9.0E-13
sp|P54759|EPHA7_RAT Ephrin type-A receptor 7 OS=Rattus norvegicus GN=Epha7 PE=1 SV=1 153 466 9.0E-13
sp|D3ZGQ5|NEK8_RAT Serine/threonine-protein kinase Nek8 OS=Rattus norvegicus GN=Nek8 PE=1 SV=1 166 466 9.0E-13
sp|Q23551|UNC22_CAEEL Twitchin OS=Caenorhabditis elegans GN=unc-22 PE=1 SV=3 168 465 1.0E-12
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 161 465 1.0E-12
sp|Q8KY50|STKP1_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 168 421 1.0E-12
sp|Q15375|EPHA7_HUMAN Ephrin type-A receptor 7 OS=Homo sapiens GN=EPHA7 PE=1 SV=3 153 466 1.0E-12
sp|P13115|SRC1_XENLA Tyrosine-protein kinase Src-1 OS=Xenopus laevis GN=src-a PE=2 SV=4 206 467 1.0E-12
sp|Q6P3Q4|STK4_XENTR Serine/threonine-protein kinase 4 OS=Xenopus tropicalis GN=stk4 PE=2 SV=1 168 410 1.0E-12
sp|Q13555|KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens GN=CAMK2G PE=1 SV=3 151 486 1.0E-12
sp|Q9WUD9|SRC_RAT Proto-oncogene tyrosine-protein kinase Src OS=Rattus norvegicus GN=Src PE=1 SV=4 206 466 1.0E-12
sp|A4K2P5|STK4_COLGU Serine/threonine-protein kinase 4 OS=Colobus guereza GN=STK4 PE=3 SV=1 168 410 1.0E-12
sp|P13116|SRC2_XENLA Tyrosine-protein kinase Src-2 OS=Xenopus laevis GN=src-b PE=2 SV=3 206 467 1.0E-12
sp|O54748|STK3_RAT Serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Stk3 PE=1 SV=1 168 410 1.0E-12
sp|Q7Y0B9|SAPK8_ORYSJ Serine/threonine-protein kinase SAPK8 OS=Oryza sativa subsp. japonica GN=SAPK8 PE=2 SV=1 166 478 1.0E-12
sp|Q3Y416|KKCC_CAEEL Calcium/calmodulin-dependent protein kinase kinase OS=Caenorhabditis elegans GN=ckk-1 PE=1 SV=2 168 410 1.0E-12
sp|Q69Z98|BRSK2_MOUSE Serine/threonine-protein kinase BRSK2 OS=Mus musculus GN=Brsk2 PE=1 SV=2 165 465 1.0E-12
sp|Q822K5|PKND_CHLCV Serine/threonine-protein kinase PknD OS=Chlamydophila caviae (strain GPIC) GN=pknD PE=3 SV=1 166 465 1.0E-12
sp|P33886|WIS1_SCHPO Protein kinase wis1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis1 PE=1 SV=1 122 410 1.0E-12
sp|Q7T6Y1|YR436_MIMIV Putative serine/threonine-protein kinase R436 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R436 PE=3 SV=2 303 470 1.0E-12
sp|P06240|LCK_MOUSE Proto-oncogene tyrosine-protein kinase LCK OS=Mus musculus GN=Lck PE=1 SV=4 206 467 1.0E-12
sp|D3ZML2|BRSK2_RAT Serine/threonine-protein kinase BRSK2 OS=Rattus norvegicus GN=Brsk2 PE=1 SV=1 165 465 1.0E-12
sp|Q91ZR4|NEK8_MOUSE Serine/threonine-protein kinase Nek8 OS=Mus musculus GN=Nek8 PE=1 SV=1 166 466 1.0E-12
sp|P93050|RKF3_ARATH Probable LRR receptor-like serine/threonine-protein kinase RKF3 OS=Arabidopsis thaliana GN=RKF3 PE=2 SV=1 143 433 1.0E-12
sp|Q9V9J3|SRC42_DROME Tyrosine-protein kinase Src42A OS=Drosophila melanogaster GN=Src42A PE=2 SV=1 298 467 1.0E-12
sp|Q86SG6|NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 166 466 1.0E-12
sp|Q5ZJK4|STK4_CHICK Serine/threonine-protein kinase 4 OS=Gallus gallus GN=STK4 PE=2 SV=1 168 410 1.0E-12
sp|P53104|ATG1_YEAST Serine/threonine-protein kinase ATG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG1 PE=1 SV=1 162 465 2.0E-12
sp|A6ZU07|ATG1_YEAS7 Serine/threonine-protein kinase ATG1 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG1 PE=3 SV=1 162 465 2.0E-12
sp|P09324|YES_CHICK Tyrosine-protein kinase Yes OS=Gallus gallus GN=YES1 PE=1 SV=3 298 467 2.0E-12
sp|Q9HBY8|SGK2_HUMAN Serine/threonine-protein kinase Sgk2 OS=Homo sapiens GN=SGK2 PE=1 SV=1 135 417 2.0E-12
sp|O14408|KCC1_METAN Calcium/calmodulin-dependent protein kinase OS=Metarhizium anisopliae PE=2 SV=1 166 414 2.0E-12
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 161 465 2.0E-12
sp|Q01974|ROR2_HUMAN Tyrosine-protein kinase transmembrane receptor ROR2 OS=Homo sapiens GN=ROR2 PE=1 SV=2 138 478 2.0E-12
sp|Q07494|EPHB1_CHICK Ephrin type-B receptor 1 (Fragment) OS=Gallus gallus GN=EPHB1 PE=2 SV=2 153 470 2.0E-12
sp|Q923T9|KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus GN=Camk2g PE=1 SV=1 151 486 2.0E-12
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 206 470 2.0E-12
sp|Q13188|STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens GN=STK3 PE=1 SV=2 168 410 2.0E-12
sp|P00527|YES_AVISY Tyrosine-protein kinase transforming protein Yes (Fragment) OS=Avian sarcoma virus (strain Y73) GN=V-YES PE=3 SV=2 298 467 2.0E-12
sp|Q63796|M3K12_RAT Mitogen-activated protein kinase kinase kinase 12 OS=Rattus norvegicus GN=Map3k12 PE=1 SV=1 168 415 2.0E-12
sp|P08923|LTK_MOUSE Leukocyte tyrosine kinase receptor OS=Mus musculus GN=Ltk PE=1 SV=3 209 466 2.0E-12
sp|Q12852|M3K12_HUMAN Mitogen-activated protein kinase kinase kinase 12 OS=Homo sapiens GN=MAP3K12 PE=1 SV=2 168 415 2.0E-12
sp|Q8CBF3|EPHB1_MOUSE Ephrin type-B receptor 1 OS=Mus musculus GN=Ephb1 PE=1 SV=1 153 470 2.0E-12
sp|Q49HM9|GRK7A_DANRE G-protein-coupled receptor kinase 7A OS=Danio rerio GN=grk7a PE=1 SV=2 161 415 2.0E-12
sp|P42682|TXK_MOUSE Tyrosine-protein kinase TXK OS=Mus musculus GN=Txk PE=1 SV=1 162 470 2.0E-12
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 211 465 2.0E-12
sp|P09759|EPHB1_RAT Ephrin type-B receptor 1 OS=Rattus norvegicus GN=Ephb1 PE=1 SV=2 153 470 2.0E-12
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 205 470 2.0E-12
sp|Q60700|M3K12_MOUSE Mitogen-activated protein kinase kinase kinase 12 OS=Mus musculus GN=Map3k12 PE=1 SV=1 168 415 2.0E-12
sp|Q5PXS1|LCK_AOTNA Tyrosine-protein kinase Lck OS=Aotus nancymaae GN=LCK PE=2 SV=4 287 467 2.0E-12
sp|Q75V57|SAPK9_ORYSJ Serine/threonine-protein kinase SAPK9 OS=Oryza sativa subsp. japonica GN=SAPK9 PE=2 SV=1 168 470 2.0E-12
sp|P54762|EPHB1_HUMAN Ephrin type-B receptor 1 OS=Homo sapiens GN=EPHB1 PE=1 SV=1 153 470 2.0E-12
sp|Q6IP76|AKT2B_XENLA RAC-beta serine/threonine-protein kinase B OS=Xenopus laevis GN=akt2-b PE=2 SV=1 166 465 2.0E-12
sp|P11730|KCC2G_RAT Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Rattus norvegicus GN=Camk2g PE=1 SV=1 151 486 2.0E-12
sp|Q97PA9|STKP2_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 168 459 2.0E-12
sp|O96017|CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens GN=CHEK2 PE=1 SV=1 54 471 2.0E-12
sp|Q63572|TESK1_RAT Dual specificity testis-specific protein kinase 1 OS=Rattus norvegicus GN=Tesk1 PE=1 SV=1 168 400 3.0E-12
sp|Q91Z96|BMP2K_MOUSE BMP-2-inducible protein kinase OS=Mus musculus GN=Bmp2k PE=1 SV=1 165 410 3.0E-12
sp|Q55CZ1|GDT2_DICDI Probable serine/threonine-protein kinase gdt2 OS=Dictyostelium discoideum GN=gdt2 PE=2 SV=1 201 466 3.0E-12
sp|O45539|SRC2_CAEEL Tyrosine protein-kinase src-2 OS=Caenorhabditis elegans GN=src-2 PE=1 SV=2 209 467 3.0E-12
sp|Q9NSY1|BMP2K_HUMAN BMP-2-inducible protein kinase OS=Homo sapiens GN=BMP2K PE=1 SV=2 165 410 3.0E-12
sp|Q75KK8|MPK14_ORYSJ Mitogen-activated protein kinase 14 OS=Oryza sativa subsp. japonica GN=MPK14 PE=2 SV=1 165 471 3.0E-12
sp|P09560|RAF1_XENLA RAF proto-oncogene serine/threonine-protein kinase OS=Xenopus laevis GN=raf1 PE=2 SV=1 77 410 3.0E-12
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 166 414 3.0E-12
sp|P14085|SRC_AVIST Tyrosine-protein kinase transforming protein Src OS=Avian sarcoma virus (strain S2) GN=V-SRC PE=3 SV=3 206 467 3.0E-12
sp|P25911|LYN_MOUSE Tyrosine-protein kinase Lyn OS=Mus musculus GN=Lyn PE=1 SV=4 310 467 3.0E-12
sp|Q9QZS5|SGK2_MOUSE Serine/threonine-protein kinase Sgk2 OS=Mus musculus GN=Sgk2 PE=1 SV=1 166 417 3.0E-12
sp|Q9ZSA4|CDPKR_ARATH Calcium-dependent protein kinase 27 OS=Arabidopsis thaliana GN=CPK27 PE=1 SV=3 168 470 3.0E-12
sp|Q07014|LYN_RAT Tyrosine-protein kinase Lyn OS=Rattus norvegicus GN=Lyn PE=1 SV=3 310 467 3.0E-12
sp|P15054|SRC_AVIS2 Tyrosine-protein kinase transforming protein Src OS=Avian sarcoma virus (strain PR2257) GN=V-SRC PE=3 SV=3 206 467 3.0E-12
sp|P34244|HSL1_YEAST Probable serine/threonine-protein kinase HSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSL1 PE=1 SV=2 211 470 3.0E-12
sp|F1SPM8|AAK1_PIG AP2-associated protein kinase 1 OS=Sus scrofa GN=AAK1 PE=2 SV=2 165 410 3.0E-12
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 166 416 3.0E-12
sp|P00523|SRC_CHICK Proto-oncogene tyrosine-protein kinase Src OS=Gallus gallus GN=SRC PE=1 SV=4 206 467 3.0E-12
sp|Q8DNS0|STKP_STRR6 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=stkP PE=1 SV=1 168 421 3.0E-12
sp|Q04J43|STKP_STRP2 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=stkP PE=1 SV=1 168 421 3.0E-12
sp|P14084|SRC_AVISS Tyrosine-protein kinase transforming protein Src OS=Avian sarcoma virus (strain S1) GN=V-SRC PE=3 SV=3 206 467 4.0E-12
sp|Q2M2I8|AAK1_HUMAN AP2-associated protein kinase 1 OS=Homo sapiens GN=AAK1 PE=1 SV=3 165 410 4.0E-12
sp|A7TIZ4|ATG1_VANPO Serine/threonine-protein kinase atg1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG1 PE=3 SV=1 189 465 4.0E-12
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 166 465 4.0E-12
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 168 470 4.0E-12
sp|P12931|SRC_HUMAN Proto-oncogene tyrosine-protein kinase Src OS=Homo sapiens GN=SRC PE=1 SV=3 206 467 4.0E-12
sp|Q9P7I2|KCC1_SCHPO Calcium/calmodulin-dependent protein kinase type I OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cmk1 PE=1 SV=1 302 471 4.0E-12
sp|P07948|LYN_HUMAN Tyrosine-protein kinase Lyn OS=Homo sapiens GN=LYN PE=1 SV=3 310 467 4.0E-12
sp|P63185|SRC_RSVSE Tyrosine-protein kinase transforming protein Src OS=Rous sarcoma virus (strain Schmidt-Ruppin E) GN=V-SRC PE=1 SV=3 206 467 4.0E-12
sp|Q8R4U9|SGK2_RAT Serine/threonine-protein kinase Sgk2 OS=Rattus norvegicus GN=Sgk2 PE=1 SV=2 166 417 5.0E-12
sp|Q7ZX15|AKT2A_XENLA RAC-beta serine/threonine-protein kinase A OS=Xenopus laevis GN=akt2-a PE=2 SV=1 134 465 5.0E-12
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 168 480 5.0E-12
sp|O80397|M2K4_ARATH Mitogen-activated protein kinase kinase 4 OS=Arabidopsis thaliana GN=MKK4 PE=1 SV=1 168 410 5.0E-12
sp|Q7T6X2|YR826_MIMIV Putative serine/threonine-protein kinase/receptor R826 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R826 PE=3 SV=2 201 466 5.0E-12
sp|Q5VP69|MPK16_ORYSJ Mitogen-activated protein kinase 16 OS=Oryza sativa subsp. japonica GN=MPK16 PE=2 SV=1 153 471 5.0E-12
sp|Q8SQW2|CTK1_ENCCU Probable CTD kinase subunit alpha homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CTK1 PE=3 SV=1 166 465 5.0E-12
sp|Q9UEW8|STK39_HUMAN STE20/SPS1-related proline-alanine-rich protein kinase OS=Homo sapiens GN=STK39 PE=1 SV=3 172 483 5.0E-12
sp|Q0WPH8|NEK5_ARATH Serine/threonine-protein kinase Nek5 OS=Arabidopsis thaliana GN=NEK5 PE=1 SV=1 168 470 6.0E-12
sp|P0C1X8|AAK1_RAT AP2-associated protein kinase 1 OS=Rattus norvegicus GN=Aak1 PE=1 SV=1 165 410 6.0E-12
sp|Q39193|SRK2I_ARATH Serine/threonine-protein kinase SRK2I OS=Arabidopsis thaliana GN=SRK2I PE=1 SV=1 162 470 6.0E-12
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 156 465 6.0E-12
sp|Q55GU0|Y9955_DICDI Probable serine/threonine-protein kinase DDB_G0267514 OS=Dictyostelium discoideum GN=DDB_G0267514 PE=3 SV=1 139 470 6.0E-12
sp|F1MH24|AAK1_BOVIN AP2-associated protein kinase 1 OS=Bos taurus GN=AAK1 PE=1 SV=2 165 410 6.0E-12
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 202 416 6.0E-12
sp|P00526|SRC_RSVP Tyrosine-protein kinase transforming protein Src OS=Rous sarcoma virus (strain Prague C) GN=V-SRC PE=1 SV=3 206 466 6.0E-12
sp|Q86CS2|ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum GN=atg1 PE=3 SV=1 191 415 6.0E-12
sp|P54755|EPHA5_CHICK Ephrin type-A receptor 5 OS=Gallus gallus GN=EPHA5 PE=2 SV=1 153 470 6.0E-12
sp|Q8QZR7|PDK1L_MOUSE Serine/threonine-protein kinase PDIK1L OS=Mus musculus GN=Pdik1l PE=2 SV=1 206 470 6.0E-12
sp|Q2QMH1|NEK2_ORYSJ Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. japonica GN=NEK2 PE=2 SV=1 168 412 6.0E-12
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 202 416 6.0E-12
sp|Q5Z6X0|CIPKP_ORYSJ CBL-interacting protein kinase 25 OS=Oryza sativa subsp. japonica GN=CIPK25 PE=2 SV=1 167 477 6.0E-12
sp|A2ZMH2|NEK2_ORYSI Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. indica GN=NEK2 PE=3 SV=1 168 412 6.0E-12
sp|Q09499|IRE1_CAEEL Serine/threonine-protein kinase/endoribonuclease ire-1 OS=Caenorhabditis elegans GN=ire-1 PE=1 SV=2 306 433 6.0E-12
sp|Q09831|PPK14_SCHPO Serine/threonine-protein kinase ppk14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk14 PE=1 SV=1 167 471 6.0E-12
sp|O88506|STK39_RAT STE20/SPS1-related proline-alanine-rich protein kinase OS=Rattus norvegicus GN=Stk39 PE=1 SV=2 172 483 7.0E-12
sp|P25020|SRC_RSVH1 Tyrosine-protein kinase transforming protein Src OS=Rous sarcoma virus (strain H-19) GN=V-SRC PE=1 SV=3 206 466 7.0E-12
sp|Q8VCT9|TESK2_MOUSE Dual specificity testis-specific protein kinase 2 OS=Mus musculus GN=Tesk2 PE=1 SV=1 151 400 7.0E-12
sp|Q8N165|PDK1L_HUMAN Serine/threonine-protein kinase PDIK1L OS=Homo sapiens GN=PDIK1L PE=1 SV=1 206 470 7.0E-12
sp|Q8TFN2|ATG1_PICAN Serine/threonine-protein kinase ATG1 OS=Pichia angusta GN=ATG1 PE=3 SV=1 201 465 7.0E-12
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 161 470 8.0E-12
sp|Q9Z1W9|STK39_MOUSE STE20/SPS1-related proline-alanine-rich protein kinase OS=Mus musculus GN=Stk39 PE=1 SV=1 172 483 8.0E-12
sp|Q3UHJ0|AAK1_MOUSE AP2-associated protein kinase 1 OS=Mus musculus GN=Aak1 PE=1 SV=2 165 410 8.0E-12
sp|P34100|PKD1_DICDI Developmentally-regulated protein kinase 1 OS=Dictyostelium discoideum GN=pkaD PE=2 SV=2 139 465 8.0E-12
sp|Q9UM73|ALK_HUMAN ALK tyrosine kinase receptor OS=Homo sapiens GN=ALK PE=1 SV=3 209 466 8.0E-12
sp|Q10407|MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mkh1 PE=3 SV=1 159 417 8.0E-12
sp|O42626|NRC2_NEUCR Serine/threonine-protein kinase nrc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nrc-2 PE=3 SV=1 162 414 8.0E-12
sp|P00524|SRC_RSVSA Tyrosine-protein kinase transforming protein Src OS=Avian leukosis virus RSA GN=V-SRC PE=1 SV=5 206 467 8.0E-12
sp|P00525|SRC_AVISR Tyrosine-protein kinase transforming protein Src OS=Avian sarcoma virus (strain rASV1441) GN=V-SRC PE=1 SV=3 206 467 8.0E-12
sp|A7E3S4|RAF1_BOVIN RAF proto-oncogene serine/threonine-protein kinase OS=Bos taurus GN=RAF1 PE=2 SV=1 110 414 8.0E-12
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 141 481 8.0E-12
sp|Q54YF2|AMPKA_DICDI 5'-AMP-activated serine/threonine-protein kinase catalytic subunit alpha OS=Dictyostelium discoideum GN=snfA PE=2 SV=1 165 470 9.0E-12
sp|Q5R7A7|SGK3_PONAB Serine/threonine-protein kinase Sgk3 OS=Pongo abelii GN=SGK3 PE=2 SV=1 166 470 9.0E-12
sp|Q96BR1|SGK3_HUMAN Serine/threonine-protein kinase Sgk3 OS=Homo sapiens GN=SGK3 PE=1 SV=1 166 470 9.0E-12
sp|P24719|MEK1_YEAST Meiosis-specific serine/threonine-protein kinase MEK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEK1 PE=3 SV=1 163 481 1.0E-11
sp|Q03002|FRK1_YEAST Fatty acyl-CoA synthetase and RNA processing-associated kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRK1 PE=1 SV=1 187 465 1.0E-11
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 202 416 1.0E-11
sp|P87248|ATG1_COLLN Serine/threonine-protein kinase ATG1 OS=Colletotrichum lindemuthianum GN=ATG1 PE=3 SV=1 169 465 1.0E-11
sp|O73798|IGF1R_XENLA Insulin-like growth factor 1 receptor OS=Xenopus laevis GN=igf1r PE=1 SV=1 271 470 1.0E-11
sp|Q15772|SPEG_HUMAN Striated muscle preferentially expressed protein kinase OS=Homo sapiens GN=SPEG PE=1 SV=4 144 467 1.0E-11
sp|Q255D2|PKND_CHLFF Serine/threonine-protein kinase PknD OS=Chlamydophila felis (strain Fe/C-56) GN=pknD PE=3 SV=2 166 470 1.0E-11
sp|Q6DEH3|KC2D1_DANRE Calcium/calmodulin-dependent protein kinase type II delta 1 chain OS=Danio rerio GN=camk2d1 PE=2 SV=2 293 486 1.0E-11
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 166 414 1.0E-11
sp|P53669|LIMK1_RAT LIM domain kinase 1 OS=Rattus norvegicus GN=Limk1 PE=1 SV=1 104 467 1.0E-11
sp|P97793|ALK_MOUSE ALK tyrosine kinase receptor OS=Mus musculus GN=Alk PE=1 SV=2 209 466 1.0E-11
sp|Q00168|KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain OS=Drosophila melanogaster GN=CaMKII PE=1 SV=1 151 486 1.0E-11
sp|P9WI67|PKNJ_MYCTU Serine/threonine-protein kinase PknJ OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknJ PE=1 SV=1 154 410 1.0E-11
sp|P9WI66|PKNJ_MYCTO Serine/threonine-protein kinase PknJ OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknJ PE=1 SV=1 154 410 1.0E-11
sp|P65733|PKNJ_MYCBO Serine/threonine-protein kinase PknJ OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknJ PE=3 SV=1 154 410 1.0E-11
sp|P47197|AKT2_RAT RAC-beta serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt2 PE=1 SV=1 166 465 1.0E-11
sp|Q6L5F7|MPK17_ORYSJ Mitogen-activated protein kinase 17 OS=Oryza sativa subsp. japonica GN=MPK17 PE=2 SV=2 167 471 1.0E-11
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=3 SV=1 168 410 1.0E-11
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 203 465 1.0E-11
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 211 470 1.0E-11
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 168 480 1.0E-11
sp|A8KBH6|KPCB_XENTR Protein kinase C beta type OS=Xenopus tropicalis GN=prkcb PE=2 SV=1 130 414 1.0E-11
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 168 480 1.0E-11
sp|F1M7Y5|KPCI_RAT Protein kinase C iota type OS=Rattus norvegicus GN=Prkci PE=1 SV=1 166 465 1.0E-11
sp|Q54WW7|Y0010_DICDI Probable serine/threonine-protein kinase DDB_G0279405 OS=Dictyostelium discoideum GN=DDB_G0279405 PE=3 SV=1 162 470 2.0E-11
sp|O88831|KKCC2_RAT Calcium/calmodulin-dependent protein kinase kinase 2 OS=Rattus norvegicus GN=Camkk2 PE=1 SV=1 203 470 2.0E-11
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 166 414 2.0E-11
sp|P45894|AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans GN=aak-1 PE=2 SV=2 162 415 2.0E-11
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 168 480 2.0E-11
sp|P00528|SRC64_DROME Tyrosine-protein kinase Src64B OS=Drosophila melanogaster GN=Src64B PE=1 SV=3 211 467 2.0E-11
sp|Q8C078|KKCC2_MOUSE Calcium/calmodulin-dependent protein kinase kinase 2 OS=Mus musculus GN=Camkk2 PE=1 SV=2 203 470 2.0E-11
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 205 410 2.0E-11
sp|Q6Z9F4|CIPK6_ORYSJ CBL-interacting protein kinase 6 OS=Oryza sativa subsp. japonica GN=CIPK6 PE=2 SV=1 203 410 2.0E-11
sp|Q95M30|HCK_MACFA Tyrosine-protein kinase HCK OS=Macaca fascicularis GN=HCK PE=2 SV=3 310 467 2.0E-11
sp|Q91736|EPB1B_XENLA Ephrin type-B receptor 1-B (Fragment) OS=Xenopus laevis GN=ephb1-b PE=1 SV=1 153 466 2.0E-11
sp|P11345|RAF1_RAT RAF proto-oncogene serine/threonine-protein kinase OS=Rattus norvegicus GN=Raf1 PE=1 SV=1 110 414 2.0E-11
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 299 470 2.0E-11
sp|Q62074|KPCI_MOUSE Protein kinase C iota type OS=Mus musculus GN=Prkci PE=1 SV=3 166 465 2.0E-11
sp|O80673|CAMK1_ARATH CDPK-related kinase 1 OS=Arabidopsis thaliana GN=CRK1 PE=1 SV=1 124 477 2.0E-11
sp|Q1JPZ3|SRC_DANRE Proto-oncogene tyrosine-protein kinase Src OS=Danio rerio GN=src PE=1 SV=2 206 467 2.0E-11
sp|A4IFM7|MYLK2_BOVIN Myosin light chain kinase 2, skeletal/cardiac muscle OS=Bos taurus GN=MYLK2 PE=2 SV=1 165 412 2.0E-11
sp|Q5R4K9|KPCI_PONAB Protein kinase C iota type OS=Pongo abelii GN=PRKCI PE=2 SV=2 166 465 2.0E-11
sp|Q91694|EPA4B_XENLA Ephrin type-A receptor 4-B OS=Xenopus laevis GN=epha4-b PE=2 SV=1 153 466 2.0E-11
sp|P41743|KPCI_HUMAN Protein kinase C iota type OS=Homo sapiens GN=PRKCI PE=1 SV=2 166 465 2.0E-11
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 203 465 2.0E-11
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 84 470 2.0E-11
sp|P42681|TXK_HUMAN Tyrosine-protein kinase TXK OS=Homo sapiens GN=TXK PE=1 SV=3 162 470 2.0E-11
sp|P28327|RK_BOVIN Rhodopsin kinase OS=Bos taurus GN=GRK1 PE=1 SV=1 161 412 2.0E-11
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 166 470 2.0E-11
sp|Q96RR4|KKCC2_HUMAN Calcium/calmodulin-dependent protein kinase kinase 2 OS=Homo sapiens GN=CAMKK2 PE=1 SV=2 203 470 2.0E-11
sp|O81472|MP3K2_ARATH Mitogen-activated protein kinase kinase kinase 9 OS=Arabidopsis thaliana GN=MEKK2 PE=1 SV=1 191 470 2.0E-11
sp|Q8H186|Y3545_ARATH Probable receptor-like protein kinase At3g55450 OS=Arabidopsis thaliana GN=At3g55450 PE=1 SV=1 130 470 2.0E-11
sp|Q5RCC4|KCC2A_PONAB Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Pongo abelii GN=CAMK2A PE=2 SV=2 293 471 2.0E-11
sp|Q9UQM7|KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Homo sapiens GN=CAMK2A PE=1 SV=2 293 471 2.0E-11
sp|Q96S53|TESK2_HUMAN Dual specificity testis-specific protein kinase 2 OS=Homo sapiens GN=TESK2 PE=1 SV=1 168 400 2.0E-11
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 166 416 2.0E-11
sp|P11275|KCC2A_RAT Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Rattus norvegicus GN=Camk2a PE=1 SV=1 293 471 2.0E-11
sp|P11798|KCC2A_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus GN=Camk2a PE=1 SV=2 293 471 2.0E-11
sp|P00532|RAF_MSV36 Serine/threonine-protein kinase-transforming protein raf OS=Murine sarcoma virus 3611 GN=V-RAF PE=3 SV=1 303 414 2.0E-11
sp|P06213|INSR_HUMAN Insulin receptor OS=Homo sapiens GN=INSR PE=1 SV=4 294 470 2.0E-11
sp|P29319|EPHA3_MOUSE Ephrin type-A receptor 3 OS=Mus musculus GN=Epha3 PE=1 SV=1 153 466 3.0E-11
sp|A0JM20|TYRO3_XENTR Tyrosine-protein kinase receptor TYRO3 OS=Xenopus tropicalis GN=tyro3 PE=2 SV=1 162 467 3.0E-11
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 160 410 3.0E-11
sp|Q940H6|SRK2E_ARATH Serine/threonine-protein kinase SRK2E OS=Arabidopsis thaliana GN=SRK2E PE=1 SV=1 168 470 3.0E-11
sp|Q8AYG3|TTK_DANRE Dual specificity protein kinase Ttk OS=Danio rerio GN=ttk PE=1 SV=2 302 470 3.0E-11
sp|Q99N57|RAF1_MOUSE RAF proto-oncogene serine/threonine-protein kinase OS=Mus musculus GN=Raf1 PE=1 SV=2 110 414 3.0E-11
sp|Q9Y884|SKH1_SCHPO MAP kinase kinase skh1/pek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=skh1 PE=3 SV=1 168 408 3.0E-11
sp|Q54VV7|Y0111_DICDI Probable serine/threonine-protein kinase DDB_G0280111 OS=Dictyostelium discoideum GN=DDB_G0280111 PE=3 SV=1 162 470 3.0E-11
sp|Q9SJG9|MPK20_ARATH Mitogen-activated protein kinase 20 OS=Arabidopsis thaliana GN=MPK20 PE=1 SV=2 141 471 3.0E-11
sp|Q55C57|GLKA_DICDI Probable serine/threonine-protein kinase glkA OS=Dictyostelium discoideum GN=glkA PE=3 SV=1 297 470 3.0E-11
sp|Q93105|INSR_AEDAE Insulin-like receptor OS=Aedes aegypti GN=InR PE=2 SV=2 274 470 3.0E-11
sp|Q9ERE3|SGK3_MOUSE Serine/threonine-protein kinase Sgk3 OS=Mus musculus GN=Sgk3 PE=1 SV=1 166 470 3.0E-11
sp|P31693|SRC_RSVPA Tyrosine-protein kinase transforming protein Src OS=Rous sarcoma virus (strain PA101T) GN=V-SRC PE=3 SV=3 298 467 3.0E-11
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 299 470 3.0E-11
sp|G5EE56|SRC1_CAEEL Tyrosine protein-kinase src-1 OS=Caenorhabditis elegans GN=src-1 PE=1 SV=1 206 424 3.0E-11
sp|P22612|KAPCG_HUMAN cAMP-dependent protein kinase catalytic subunit gamma OS=Homo sapiens GN=PRKACG PE=1 SV=3 145 417 3.0E-11
sp|Q91845|EPA4A_XENLA Ephrin type-A receptor 4-A OS=Xenopus laevis GN=epha4-a PE=2 SV=1 153 410 3.0E-11
sp|P49673|KAPC_ASCSU cAMP-dependent protein kinase catalytic subunit OS=Ascaris suum GN=CAPK PE=2 SV=1 168 412 3.0E-11
sp|Q9CAL8|PEK13_ARATH Proline-rich receptor-like protein kinase PERK13 OS=Arabidopsis thaliana GN=PERK13 PE=2 SV=1 162 459 3.0E-11
sp|D3ZBE5|NEK7_RAT Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus GN=Nek7 PE=2 SV=1 138 412 3.0E-11
sp|Q8TDX7|NEK7_HUMAN Serine/threonine-protein kinase Nek7 OS=Homo sapiens GN=NEK7 PE=1 SV=1 138 469 3.0E-11
sp|Q9HFF4|PPK1_SCHPO Serine/threonine-protein kinase ppk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk1 PE=1 SV=2 207 465 3.0E-11
sp|Q922K9|FRK_MOUSE Tyrosine-protein kinase FRK OS=Mus musculus GN=Frk PE=1 SV=3 310 467 4.0E-11
sp|Q9FKG5|PUB51_ARATH U-box domain-containing protein 51 OS=Arabidopsis thaliana GN=PUB51 PE=2 SV=2 162 457 4.0E-11
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 309 471 4.0E-11
sp|Q9ES74|NEK7_MOUSE Serine/threonine-protein kinase Nek7 OS=Mus musculus GN=Nek7 PE=1 SV=1 138 412 4.0E-11
sp|O45818|DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans GN=dkf-2 PE=1 SV=4 161 424 4.0E-11
sp|Q12152|YP150_YEAST Putative serine/threonine-protein kinase YPL150W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL150W PE=1 SV=1 306 470 4.0E-11
sp|Q5PU49|KPCD_CANLF Protein kinase C delta type OS=Canis lupus familiaris GN=PRKCD PE=2 SV=1 162 469 4.0E-11
sp|P21709|EPHA1_HUMAN Ephrin type-A receptor 1 OS=Homo sapiens GN=EPHA1 PE=1 SV=4 297 466 4.0E-11
sp|Q5L5J7|PKND_CHLAB Serine/threonine-protein kinase PknD OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=pknD PE=3 SV=1 166 471 4.0E-11
sp|Q8C0Q4|NEK11_MOUSE Serine/threonine-protein kinase Nek11 OS=Mus musculus GN=Nek11 PE=2 SV=2 162 470 4.0E-11
sp|Q6P5G0|MK04_MOUSE Mitogen-activated protein kinase 4 OS=Mus musculus GN=Mapk4 PE=1 SV=1 162 471 4.0E-11
sp|P20689|MYLK2_RAT Myosin light chain kinase 2, skeletal/cardiac muscle OS=Rattus norvegicus GN=Mylk2 PE=1 SV=2 165 412 4.0E-11
sp|Q3U3Q1|ULK3_MOUSE Serine/threonine-protein kinase ULK3 OS=Mus musculus GN=Ulk3 PE=2 SV=1 205 465 4.0E-11
sp|P35426|CDK4_RAT Cyclin-dependent kinase 4 OS=Rattus norvegicus GN=Cdk4 PE=1 SV=1 288 468 4.0E-11
sp|Q8GUH1|PUB33_ARATH U-box domain-containing protein 33 OS=Arabidopsis thaliana GN=PUB33 PE=2 SV=2 168 459 4.0E-11
sp|P27966|RMIL_AVEVR Serine/threonine-protein kinase-transforming protein Rmil OS=Avian rous-associated virus type 1 GN=V-RMIL PE=3 SV=1 303 466 5.0E-11
sp|F1LM93|YES_RAT Tyrosine-protein kinase Yes OS=Rattus norvegicus GN=Yes1 PE=1 SV=1 298 467 5.0E-11
sp|Q8R4V0|SGK3_RAT Serine/threonine-protein kinase Sgk3 OS=Rattus norvegicus GN=Sgk3 PE=1 SV=2 166 470 5.0E-11
sp|Q8RXG3|M2K5_ARATH Mitogen-activated protein kinase kinase 5 OS=Arabidopsis thaliana GN=MKK5 PE=1 SV=2 165 410 5.0E-11
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 170 416 5.0E-11
sp|Q15772|SPEG_HUMAN Striated muscle preferentially expressed protein kinase OS=Homo sapiens GN=SPEG PE=1 SV=4 293 414 2.0E-07
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 310 470 2.0E-07
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 310 470 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0006807 nitrogen compound metabolic process No
GO:0036211 protein modification process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0032553 ribonucleotide binding No
GO:0016301 kinase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0043170 macromolecule metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:0030554 adenyl nucleotide binding No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0043412 macromolecule modification No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0016310 phosphorylation No
GO:0043168 anion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8035
MSLIPYLPREGREIVLRHHNAIVVRDRDSQQLEIRRTECPTCHQPLMGTSSSGERPYERQYDMNHEYVNPEYFRM
LRTGSQHNVVSRAGASSPVKRFFQPALPGYSAEASPLGGRPRTPSSASSAPLDKEAEFVSSTPGVDQAEGSRIRK
TAFSDNYFATFFVEERVLGRGGKGVVLLVRHEIDGCQLGHFACKRVPVGDDHGWLEKVLVEVELLAKLSHPNLVS
YRHVWLEDTQLTRFGPRVACAFILQQYCNGGDLHGYVVGSAPRDATKEELKARMRRRSKGQADTAKPAGRPQLSF
EDIYSLFKDITSGVAYLHANNYIHRDLKPSNCLLHSEGGMVTCLISDFGEVQPENMVRRSTGSTGTISYCAPEVL
RTDPATGCYGNFTTKSDMFSLGMILYFMCFGRLPYRGANALQEELEDVEQLRAEIADWKGFHDERRERPDLPPRL
YKLLKKLLALDPAERPAATEGPECRAWGAQQSRAES*
Coding >OphauB2|8035
ATGTCGCTGATTCCCTATCTTCCTCGCGAGGGCCGCGAAATCGTGCTGCGGCACCACAATGCCATTGTGGTGCGG
GATCGCGACTCGCAGCAGCTTGAGATTCGACGGACGGAATGCCCAACGTGCCACCAGCCGCTCATGGGGACGTCG
AGCTCGGGGGAGCGGCCATATGAGCGGCAATACGACATGAACCACGAGTACGTCAATCCCGAGTACTTTCGGATG
CTGCGGACGGGCAGCCAGCACAATGTTGTGTCGCGGGCGGGGGCGTCGAGTCCGGTGAAGCGGTTTTTCCAGCCG
GCGCTGCCAGGCTACTCGGCCGAGGCGTCGCCATTGGGAGGGCGGCCTCGGACGCCGTCGAGTGCAAGCAGCGCT
CCCTTGGACAAGGAGGCCGAGTTTGTGTCGAGCACGCCCGGGGTGGACCAGGCCGAGGGCAGCCGGATACGCAAG
ACGGCCTTTAGCGACAACTACTTTGCCACCTTCTTCGTGGAGGAGCGGGTGCTGGGGCGGGGCGGCAAGGGCGTG
GTGCTGCTGGTGCGGCACGAGATTGACGGGTGCCAGCTGGGCCACTTTGCCTGCAAGCGCGTGCCCGTGGGCGAC
GACCATGGGTGGCTGGAAAAGGTGCTGGTCGAGGTTGAGCTGCTGGCCAAGCTGTCGCACCCCAACCTCGTCTCG
TACCGGCACGTGTGGCTCGAGGACACGCAGCTGACGCGCTTTGGCCCGCGCGTGGCGTGTGCCTTTATCCTGCAG
CAGTACTGCAACGGCGGCGACCTGCACGGCTATGTCGTGGGCAGCGCGCCGCGCGATGCCACCAAGGAGGAGCTC
AAGGCACGCATGCGGCGCCGCTCCAAGGGGCAGGCCGACACGGCCAAGCCAGCCGGGCGCCCGCAGCTGTCGTTT
GAGGACATTTACTCCCTCTTCAAGGACATTACGTCGGGCGTGGCCTATCTGCACGCCAACAACTACATCCACCGC
GATCTCAAGCCGAGCAACTGCCTCTTGCACAGCGAGGGCGGCATGGTGACGTGCCTCATTAGCGACTTTGGCGAG
GTGCAGCCGGAGAACATGGTGCGTCGCTCCACGGGCTCAACCGGCACCATTTCCTACTGTGCGCCCGAGGTGTTG
AGGACAGACCCGGCCACGGGCTGCTACGGCAACTTTACCACCAAGTCGGACATGTTTTCCCTGGGCATGATTCTC
TACTTTATGTGTTTTGGCCGCCTGCCCTACCGCGGCGCAAACGCGCTGCAAGAGGAGCTCGAGGACGTGGAGCAG
CTGCGCGCCGAGATTGCCGACTGGAAGGGCTTCCACGACGAGCGGCGCGAGCGGCCAGACTTGCCCCCGCGCCTG
TACAAGCTGCTCAAGAAGCTGCTGGCCCTGGATCCGGCCGAGAGGCCGGCCGCCACCGAGGGCCCCGAGTGTAGG
GCCTGGGGCGCGCAGCAGTCGCGTGCAGAGTCTTGA
Transcript >OphauB2|8035
ATGTCGCTGATTCCCTATCTTCCTCGCGAGGGCCGCGAAATCGTGCTGCGGCACCACAATGCCATTGTGGTGCGG
GATCGCGACTCGCAGCAGCTTGAGATTCGACGGACGGAATGCCCAACGTGCCACCAGCCGCTCATGGGGACGTCG
AGCTCGGGGGAGCGGCCATATGAGCGGCAATACGACATGAACCACGAGTACGTCAATCCCGAGTACTTTCGGATG
CTGCGGACGGGCAGCCAGCACAATGTTGTGTCGCGGGCGGGGGCGTCGAGTCCGGTGAAGCGGTTTTTCCAGCCG
GCGCTGCCAGGCTACTCGGCCGAGGCGTCGCCATTGGGAGGGCGGCCTCGGACGCCGTCGAGTGCAAGCAGCGCT
CCCTTGGACAAGGAGGCCGAGTTTGTGTCGAGCACGCCCGGGGTGGACCAGGCCGAGGGCAGCCGGATACGCAAG
ACGGCCTTTAGCGACAACTACTTTGCCACCTTCTTCGTGGAGGAGCGGGTGCTGGGGCGGGGCGGCAAGGGCGTG
GTGCTGCTGGTGCGGCACGAGATTGACGGGTGCCAGCTGGGCCACTTTGCCTGCAAGCGCGTGCCCGTGGGCGAC
GACCATGGGTGGCTGGAAAAGGTGCTGGTCGAGGTTGAGCTGCTGGCCAAGCTGTCGCACCCCAACCTCGTCTCG
TACCGGCACGTGTGGCTCGAGGACACGCAGCTGACGCGCTTTGGCCCGCGCGTGGCGTGTGCCTTTATCCTGCAG
CAGTACTGCAACGGCGGCGACCTGCACGGCTATGTCGTGGGCAGCGCGCCGCGCGATGCCACCAAGGAGGAGCTC
AAGGCACGCATGCGGCGCCGCTCCAAGGGGCAGGCCGACACGGCCAAGCCAGCCGGGCGCCCGCAGCTGTCGTTT
GAGGACATTTACTCCCTCTTCAAGGACATTACGTCGGGCGTGGCCTATCTGCACGCCAACAACTACATCCACCGC
GATCTCAAGCCGAGCAACTGCCTCTTGCACAGCGAGGGCGGCATGGTGACGTGCCTCATTAGCGACTTTGGCGAG
GTGCAGCCGGAGAACATGGTGCGTCGCTCCACGGGCTCAACCGGCACCATTTCCTACTGTGCGCCCGAGGTGTTG
AGGACAGACCCGGCCACGGGCTGCTACGGCAACTTTACCACCAAGTCGGACATGTTTTCCCTGGGCATGATTCTC
TACTTTATGTGTTTTGGCCGCCTGCCCTACCGCGGCGCAAACGCGCTGCAAGAGGAGCTCGAGGACGTGGAGCAG
CTGCGCGCCGAGATTGCCGACTGGAAGGGCTTCCACGACGAGCGGCGCGAGCGGCCAGACTTGCCCCCGCGCCTG
TACAAGCTGCTCAAGAAGCTGCTGGCCCTGGATCCGGCCGAGAGGCCGGCCGCCACCGAGGGCCCCGAGTGTAGG
GCCTGGGGCGCGCAGCAGTCGCGTGCAGAGTCTTGA
Gene >OphauB2|8035
ATGTCGCTGATTCCCTATCTTCCTCGCGAGGGCCGCGAAATCGTGCTGTGAGAGGGCCAAGAGGAGATTTTCTGA
GACGAGGCACGTCAGTGCACTGCTAACGGGGATTGGTTTACAGGCGGCACCACAATGCCATTGTGGTGCGGGATC
GCGACTCGCAGCAGCTTGAGATTCGACGGACGGAATGCCCAACGTGCCACCAGCCGCTCATGGGGACGTCGAGCT
CGGGGGAGCGGCCATATGAGCGGCAATACGACATGAACCACGAGTACGTCAATCCCGAGTACTTTCGGATGCTGC
GGACGGGCAGCCAGCACAATGTTGTGTCGCGGGCGGGGGCGTCGAGTCCGGTGAAGCGGTTTTTCCAGCCGGCGC
TGCCAGGCTACTCGGCCGAGGCGTCGCCATTGGGAGGGCGGCCTCGGACGCCGTCGAGTGCAAGCAGCGCTCCCT
TGGACAAGGAGGCCGAGTTTGTGTCGAGCACGCCCGGGGTGGACCAGGCCGAGGGCAGCCGGATACGCAAGACGG
CCTTTAGCGACAACTACTTTGCCACCTTCTTCGTGGAGGAGCGGGTGCTGGGGCGGGGCGGCAAGGGCGTGGTGC
TGCTGGTGCGGCACGAGATTGACGGGTGCCAGCTGGGCCACTTTGCCTGCAAGCGCGTGCCCGTGGGCGACGACC
ATGGGTGGCTGGAAAAGGTGCTGGTCGAGGTTGAGCTGCTGGCCAAGCTGTCGCACCCCAACCTCGTCTCGTACC
GGCACGTGTGGCTCGAGGACACGCAGCTGACGCGCTTTGGCCCGCGCGTGGCGTGTGCCTTTATCCTGCAGCAGT
ACTGCAACGGCGGCGACCTGCACGGCTATGTCGTGGGCAGCGCGCCGCGCGATGCCACCAAGGAGGAGCTCAAGG
CACGCATGCGGCGCCGCTCCAAGGGGCAGGCCGACACGGCCAAGCCAGCCGGGCGCCCGCAGCTGTCGTTTGAGG
ACATTTACTCCCTCTTCAAGGACATTACGTCGGGCGTGGCCTATCTGCACGCCAACAACTACATCCACCGCGATC
TCAAGCCGAGCAACTGCCTCTTGCACAGCGAGGGCGGCATGGTGACGTGCCTCATTAGCGACTTTGGCGAGGTGC
AGCCGGAGAACATGGTGCGTCGCTCCACGGGCTCAACCGGCACCATTTCCTACTGTGCGCCCGAGGTGTTGAGGA
CAGACCCGGCCACGGGCTGCTACGGCAACTTTACCACCAAGTCGGACATGTTTTCCCTGGGCATGATTCTCTACT
TTATGTGTTTTGGCCGCCTGCCCTACCGCGGCGCAAACGCGCTGCAAGAGGAGCTCGAGGACGTGGAGCAGCTGC
GCGCCGAGATTGCCGACTGGAAGGGCTTCCACGACGAGCGGCGCGAGCGGCCAGACTTGCCCCCGCGCCTGTACA
AGCTGCTCAAGAAGCTGCTGGCCCTGGATCCGGCCGAGAGGCCGGCCGCCACCGAGGTGCTGAGTGCAATGAGGA
GCGAGACCAACTTTGATGCGGTTGGGCGGGGGGCGGATAGGGCCCCGAGTGTAGGGCCTGGGGCGCGCAGCAGTC
GCGTGCAGAGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail